data_6LMS # _entry.id 6LMS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6LMS pdb_00006lms 10.2210/pdb6lms/pdb WWPDB D_1300015074 ? ? BMRB 36307 ? 10.13018/BMR36307 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-07-22 2 'Structure model' 1 1 2021-02-17 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 3 'Structure model' '_database_2.pdbx_DOI' 14 3 'Structure model' '_database_2.pdbx_database_accession' 15 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 16 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6LMS _pdbx_database_status.recvd_initial_deposition_date 2019-12-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution NMR structure cold shock domain of YB1 from Homo sapiens' _pdbx_database_related.db_id 36307 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Li, S.' 1 ? 'Zhang, J.' 2 ? 'Yang, Y.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_id_ASTM NARHAD _citation.journal_id_CSD 0389 _citation.journal_id_ISSN 1362-4962 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 48 _citation.language ? _citation.page_first 9361 _citation.page_last 9371 _citation.title 'Structural basis of DNA binding to human YB-1 cold shock domain regulated by phosphorylation.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1093/nar/gkaa619 _citation.pdbx_database_id_PubMed 32710623 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, J.' 1 ? primary 'Fan, J.S.' 2 ? primary 'Li, S.' 3 ? primary 'Yang, Y.' 4 ? primary 'Sun, P.' 5 ? primary 'Zhu, Q.' 6 ? primary 'Wang, J.' 7 ? primary 'Jiang, B.' 8 ? primary 'Yang, D.' 9 ? primary 'Liu, M.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Y-box-binding protein 1' _entity.formula_weight 11600.004 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;YB-1,CCAAT-binding transcription factor I subunit A,CBF-A,DNA-binding protein B,DBPB,Enhancer factor I subunit A,EFI-A,Nuclease-sensitive element-binding protein 1,Y-box transcription factor ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHSSGLVPRGSDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVV EGEKGAEAANVTGPGGVPVQGSKYAA ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHSSGLVPRGSDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVV EGEKGAEAANVTGPGGVPVQGSKYAA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 SER n 1 9 SER n 1 10 GLY n 1 11 LEU n 1 12 VAL n 1 13 PRO n 1 14 ARG n 1 15 GLY n 1 16 SER n 1 17 ASP n 1 18 LYS n 1 19 LYS n 1 20 VAL n 1 21 ILE n 1 22 ALA n 1 23 THR n 1 24 LYS n 1 25 VAL n 1 26 LEU n 1 27 GLY n 1 28 THR n 1 29 VAL n 1 30 LYS n 1 31 TRP n 1 32 PHE n 1 33 ASN n 1 34 VAL n 1 35 ARG n 1 36 ASN n 1 37 GLY n 1 38 TYR n 1 39 GLY n 1 40 PHE n 1 41 ILE n 1 42 ASN n 1 43 ARG n 1 44 ASN n 1 45 ASP n 1 46 THR n 1 47 LYS n 1 48 GLU n 1 49 ASP n 1 50 VAL n 1 51 PHE n 1 52 VAL n 1 53 HIS n 1 54 GLN n 1 55 THR n 1 56 ALA n 1 57 ILE n 1 58 LYS n 1 59 LYS n 1 60 ASN n 1 61 ASN n 1 62 PRO n 1 63 ARG n 1 64 LYS n 1 65 TYR n 1 66 LEU n 1 67 ARG n 1 68 SER n 1 69 VAL n 1 70 GLY n 1 71 ASP n 1 72 GLY n 1 73 GLU n 1 74 THR n 1 75 VAL n 1 76 GLU n 1 77 PHE n 1 78 ASP n 1 79 VAL n 1 80 VAL n 1 81 GLU n 1 82 GLY n 1 83 GLU n 1 84 LYS n 1 85 GLY n 1 86 ALA n 1 87 GLU n 1 88 ALA n 1 89 ALA n 1 90 ASN n 1 91 VAL n 1 92 THR n 1 93 GLY n 1 94 PRO n 1 95 GLY n 1 96 GLY n 1 97 VAL n 1 98 PRO n 1 99 VAL n 1 100 GLN n 1 101 GLY n 1 102 SER n 1 103 LYS n 1 104 TYR n 1 105 ALA n 1 106 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 106 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'YBX1, NSEP1, YB1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 35 ? ? ? A . n A 1 2 HIS 2 36 ? ? ? A . n A 1 3 HIS 3 37 ? ? ? A . n A 1 4 HIS 4 38 ? ? ? A . n A 1 5 HIS 5 39 ? ? ? A . n A 1 6 HIS 6 40 ? ? ? A . n A 1 7 HIS 7 41 ? ? ? A . n A 1 8 SER 8 42 ? ? ? A . n A 1 9 SER 9 43 ? ? ? A . n A 1 10 GLY 10 44 ? ? ? A . n A 1 11 LEU 11 45 ? ? ? A . n A 1 12 VAL 12 46 ? ? ? A . n A 1 13 PRO 13 47 ? ? ? A . n A 1 14 ARG 14 48 ? ? ? A . n A 1 15 GLY 15 49 ? ? ? A . n A 1 16 SER 16 50 ? ? ? A . n A 1 17 ASP 17 51 51 ASP ASP A . n A 1 18 LYS 18 52 52 LYS LYS A . n A 1 19 LYS 19 53 53 LYS LYS A . n A 1 20 VAL 20 54 54 VAL VAL A . n A 1 21 ILE 21 55 55 ILE ILE A . n A 1 22 ALA 22 56 56 ALA ALA A . n A 1 23 THR 23 57 57 THR THR A . n A 1 24 LYS 24 58 58 LYS LYS A . n A 1 25 VAL 25 59 59 VAL VAL A . n A 1 26 LEU 26 60 60 LEU LEU A . n A 1 27 GLY 27 61 61 GLY GLY A . n A 1 28 THR 28 62 62 THR THR A . n A 1 29 VAL 29 63 63 VAL VAL A . n A 1 30 LYS 30 64 64 LYS LYS A . n A 1 31 TRP 31 65 65 TRP TRP A . n A 1 32 PHE 32 66 66 PHE PHE A . n A 1 33 ASN 33 67 67 ASN ASN A . n A 1 34 VAL 34 68 68 VAL VAL A . n A 1 35 ARG 35 69 69 ARG ARG A . n A 1 36 ASN 36 70 70 ASN ASN A . n A 1 37 GLY 37 71 71 GLY GLY A . n A 1 38 TYR 38 72 72 TYR TYR A . n A 1 39 GLY 39 73 73 GLY GLY A . n A 1 40 PHE 40 74 74 PHE PHE A . n A 1 41 ILE 41 75 75 ILE ILE A . n A 1 42 ASN 42 76 76 ASN ASN A . n A 1 43 ARG 43 77 77 ARG ARG A . n A 1 44 ASN 44 78 78 ASN ASN A . n A 1 45 ASP 45 79 79 ASP ASP A . n A 1 46 THR 46 80 80 THR THR A . n A 1 47 LYS 47 81 81 LYS LYS A . n A 1 48 GLU 48 82 82 GLU GLU A . n A 1 49 ASP 49 83 83 ASP ASP A . n A 1 50 VAL 50 84 84 VAL VAL A . n A 1 51 PHE 51 85 85 PHE PHE A . n A 1 52 VAL 52 86 86 VAL VAL A . n A 1 53 HIS 53 87 87 HIS HIS A . n A 1 54 GLN 54 88 88 GLN GLN A . n A 1 55 THR 55 89 89 THR THR A . n A 1 56 ALA 56 90 90 ALA ALA A . n A 1 57 ILE 57 91 91 ILE ILE A . n A 1 58 LYS 58 92 92 LYS LYS A . n A 1 59 LYS 59 93 93 LYS LYS A . n A 1 60 ASN 60 94 94 ASN ASN A . n A 1 61 ASN 61 95 95 ASN ASN A . n A 1 62 PRO 62 96 96 PRO PRO A . n A 1 63 ARG 63 97 97 ARG ARG A . n A 1 64 LYS 64 98 98 LYS LYS A . n A 1 65 TYR 65 99 99 TYR TYR A . n A 1 66 LEU 66 100 100 LEU LEU A . n A 1 67 ARG 67 101 101 ARG ARG A . n A 1 68 SER 68 102 102 SER SER A . n A 1 69 VAL 69 103 103 VAL VAL A . n A 1 70 GLY 70 104 104 GLY GLY A . n A 1 71 ASP 71 105 105 ASP ASP A . n A 1 72 GLY 72 106 106 GLY GLY A . n A 1 73 GLU 73 107 107 GLU GLU A . n A 1 74 THR 74 108 108 THR THR A . n A 1 75 VAL 75 109 109 VAL VAL A . n A 1 76 GLU 76 110 110 GLU GLU A . n A 1 77 PHE 77 111 111 PHE PHE A . n A 1 78 ASP 78 112 112 ASP ASP A . n A 1 79 VAL 79 113 113 VAL VAL A . n A 1 80 VAL 80 114 114 VAL VAL A . n A 1 81 GLU 81 115 115 GLU GLU A . n A 1 82 GLY 82 116 116 GLY GLY A . n A 1 83 GLU 83 117 117 GLU GLU A . n A 1 84 LYS 84 118 118 LYS LYS A . n A 1 85 GLY 85 119 119 GLY GLY A . n A 1 86 ALA 86 120 120 ALA ALA A . n A 1 87 GLU 87 121 121 GLU GLU A . n A 1 88 ALA 88 122 122 ALA ALA A . n A 1 89 ALA 89 123 123 ALA ALA A . n A 1 90 ASN 90 124 124 ASN ASN A . n A 1 91 VAL 91 125 125 VAL VAL A . n A 1 92 THR 92 126 126 THR THR A . n A 1 93 GLY 93 127 127 GLY GLY A . n A 1 94 PRO 94 128 128 PRO PRO A . n A 1 95 GLY 95 129 129 GLY GLY A . n A 1 96 GLY 96 130 130 GLY GLY A . n A 1 97 VAL 97 131 131 VAL VAL A . n A 1 98 PRO 98 132 132 PRO PRO A . n A 1 99 VAL 99 133 133 VAL VAL A . n A 1 100 GLN 100 134 134 GLN GLN A . n A 1 101 GLY 101 135 135 GLY GLY A . n A 1 102 SER 102 136 136 SER SER A . n A 1 103 LYS 103 137 137 LYS LYS A . n A 1 104 TYR 104 138 138 TYR TYR A . n A 1 105 ALA 105 139 139 ALA ALA A . n A 1 106 ALA 106 140 140 ALA ALA A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6LMS _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6LMS _struct.title 'Solution NMR structure cold shock domain of YB1 from Homo sapiens' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6LMS _struct_keywords.text 'CSD, transcription, DNA binding' _struct_keywords.pdbx_keywords TRANSCRIPTION # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code YBOX1_HUMAN _struct_ref.pdbx_db_accession P67809 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGG VPVQGSKYAA ; _struct_ref.pdbx_align_begin 51 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6LMS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 17 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 106 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P67809 _struct_ref_seq.db_align_beg 51 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 140 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 51 _struct_ref_seq.pdbx_auth_seq_align_end 140 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6LMS MET A 1 ? UNP P67809 ? ? 'initiating methionine' 35 1 1 6LMS HIS A 2 ? UNP P67809 ? ? 'expression tag' 36 2 1 6LMS HIS A 3 ? UNP P67809 ? ? 'expression tag' 37 3 1 6LMS HIS A 4 ? UNP P67809 ? ? 'expression tag' 38 4 1 6LMS HIS A 5 ? UNP P67809 ? ? 'expression tag' 39 5 1 6LMS HIS A 6 ? UNP P67809 ? ? 'expression tag' 40 6 1 6LMS HIS A 7 ? UNP P67809 ? ? 'expression tag' 41 7 1 6LMS SER A 8 ? UNP P67809 ? ? 'expression tag' 42 8 1 6LMS SER A 9 ? UNP P67809 ? ? 'expression tag' 43 9 1 6LMS GLY A 10 ? UNP P67809 ? ? 'expression tag' 44 10 1 6LMS LEU A 11 ? UNP P67809 ? ? 'expression tag' 45 11 1 6LMS VAL A 12 ? UNP P67809 ? ? 'expression tag' 46 12 1 6LMS PRO A 13 ? UNP P67809 ? ? 'expression tag' 47 13 1 6LMS ARG A 14 ? UNP P67809 ? ? 'expression tag' 48 14 1 6LMS GLY A 15 ? UNP P67809 ? ? 'expression tag' 49 15 1 6LMS SER A 16 ? UNP P67809 ? ? 'expression tag' 50 16 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 5690 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 55 ? ILE A 57 ? THR A 89 ILE A 91 5 ? 3 HELX_P HELX_P2 AA2 GLY A 93 ? VAL A 97 ? GLY A 127 VAL A 131 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 20 ? ASN A 33 ? VAL A 54 ASN A 67 AA1 2 TYR A 38 ? ARG A 43 ? TYR A 72 ARG A 77 AA1 3 ASP A 49 ? HIS A 53 ? ASP A 83 HIS A 87 AA1 4 GLY A 85 ? THR A 92 ? GLY A 119 THR A 126 AA1 5 THR A 74 ? GLY A 82 ? THR A 108 GLY A 116 AA1 6 VAL A 20 ? ASN A 33 ? VAL A 54 ASN A 67 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 28 ? N THR A 62 O ASN A 42 ? O ASN A 76 AA1 2 3 N ILE A 41 ? N ILE A 75 O VAL A 50 ? O VAL A 84 AA1 3 4 N PHE A 51 ? N PHE A 85 O ALA A 88 ? O ALA A 122 AA1 4 5 O GLU A 87 ? O GLU A 121 N VAL A 80 ? N VAL A 114 AA1 5 6 O PHE A 77 ? O PHE A 111 N VAL A 25 ? N VAL A 59 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 4 HD1 A HIS 87 ? ? H A THR 89 ? ? 1.25 2 11 HD1 A HIS 87 ? ? H A THR 89 ? ? 1.23 3 14 HD1 A HIS 87 ? ? H A THR 89 ? ? 1.24 4 17 HD1 A HIS 87 ? ? H A THR 89 ? ? 1.28 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 52 ? ? 64.74 -173.98 2 1 LYS A 58 ? ? -42.19 108.09 3 2 LYS A 58 ? ? -43.04 105.92 4 2 SER A 136 ? ? -118.04 -163.70 5 3 LYS A 58 ? ? -46.30 105.73 6 4 LYS A 58 ? ? -44.34 105.44 7 5 LYS A 58 ? ? -47.76 104.70 8 6 LYS A 58 ? ? -44.33 107.46 9 7 LYS A 58 ? ? -50.85 107.08 10 7 LYS A 118 ? ? -140.93 31.60 11 8 LYS A 52 ? ? 66.37 -170.11 12 8 LYS A 58 ? ? -36.87 104.27 13 9 LYS A 58 ? ? -47.72 104.44 14 10 LYS A 58 ? ? -46.25 107.33 15 11 LYS A 58 ? ? -42.34 106.15 16 12 LYS A 52 ? ? -152.45 -155.16 17 12 LYS A 58 ? ? -45.65 107.74 18 12 SER A 136 ? ? -119.17 -168.58 19 13 LYS A 58 ? ? -41.98 105.92 20 14 LYS A 58 ? ? -44.55 106.49 21 15 LYS A 58 ? ? -44.51 106.17 22 16 LYS A 58 ? ? -44.48 108.25 23 17 LYS A 58 ? ? -42.93 107.09 24 18 LYS A 52 ? ? 66.13 -169.49 25 18 LYS A 58 ? ? -45.02 106.39 26 18 TRP A 65 ? ? -171.58 148.83 27 18 SER A 136 ? ? -102.87 -165.39 28 19 LYS A 58 ? ? -43.56 104.91 29 19 THR A 80 ? ? -141.83 -8.57 30 19 ASP A 83 ? ? 74.83 133.74 31 20 LYS A 58 ? ? -46.21 106.26 # _pdbx_nmr_ensemble.entry_id 6LMS _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6LMS _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria medoid # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.8 mM [U-100% 13C; U-100% 15N] YB1, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label '13C, 15N_sample' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component YB1 _pdbx_nmr_exptl_sample.concentration 0.8 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-100% 13C; U-100% 15N]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.details '0.8 mM, 20 mM PBS, 50 mM NaCl, 1 mM EDTA' _pdbx_nmr_exptl_sample_conditions.ionic_strength_err 0.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.05 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err 0.01 _pdbx_nmr_exptl_sample_conditions.temperature_err 0.1 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC aliphatic' 1 isotropic 3 1 1 '2D 1H-13C HSQC aromatic' 1 isotropic 4 1 1 '3D HNCO' 1 isotropic 5 1 1 '3D HNCA' 1 isotropic 6 1 1 '3D HN(CO)CA' 1 isotropic 7 1 1 '3D CBCA(CO)NH' 1 isotropic 8 1 1 '3D HNCACB' 1 isotropic 9 1 1 '3D HBHA(CO)NH' 1 isotropic 10 1 1 '3D HCCH-TOCSY' 1 isotropic 11 1 1 '3D HCCH-COSY' 1 isotropic 12 1 1 '3D C(CO)NH' 1 isotropic 13 1 1 '3D 1H-13C NOESY aliphatic' 2 isotropic 14 1 1 '3D 1H-13C NOESY aromatic' 2 isotropic 15 1 1 '3D 1H-15N NOESY' 2 isotropic # _pdbx_nmr_refine.entry_id 6LMS _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'eefx force-field' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 3 'chemical shift assignment' Sparky ? Goddard 4 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 5 'peak picking' NMRFAM-SPARKY ? 'Lee W, Tonelli M, Markley JL' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 35 ? A MET 1 2 1 Y 1 A HIS 36 ? A HIS 2 3 1 Y 1 A HIS 37 ? A HIS 3 4 1 Y 1 A HIS 38 ? A HIS 4 5 1 Y 1 A HIS 39 ? A HIS 5 6 1 Y 1 A HIS 40 ? A HIS 6 7 1 Y 1 A HIS 41 ? A HIS 7 8 1 Y 1 A SER 42 ? A SER 8 9 1 Y 1 A SER 43 ? A SER 9 10 1 Y 1 A GLY 44 ? A GLY 10 11 1 Y 1 A LEU 45 ? A LEU 11 12 1 Y 1 A VAL 46 ? A VAL 12 13 1 Y 1 A PRO 47 ? A PRO 13 14 1 Y 1 A ARG 48 ? A ARG 14 15 1 Y 1 A GLY 49 ? A GLY 15 16 1 Y 1 A SER 50 ? A SER 16 17 2 Y 1 A MET 35 ? A MET 1 18 2 Y 1 A HIS 36 ? A HIS 2 19 2 Y 1 A HIS 37 ? A HIS 3 20 2 Y 1 A HIS 38 ? A HIS 4 21 2 Y 1 A HIS 39 ? A HIS 5 22 2 Y 1 A HIS 40 ? A HIS 6 23 2 Y 1 A HIS 41 ? A HIS 7 24 2 Y 1 A SER 42 ? A SER 8 25 2 Y 1 A SER 43 ? A SER 9 26 2 Y 1 A GLY 44 ? A GLY 10 27 2 Y 1 A LEU 45 ? A LEU 11 28 2 Y 1 A VAL 46 ? A VAL 12 29 2 Y 1 A PRO 47 ? A PRO 13 30 2 Y 1 A ARG 48 ? A ARG 14 31 2 Y 1 A GLY 49 ? A GLY 15 32 2 Y 1 A SER 50 ? A SER 16 33 3 Y 1 A MET 35 ? A MET 1 34 3 Y 1 A HIS 36 ? A HIS 2 35 3 Y 1 A HIS 37 ? A HIS 3 36 3 Y 1 A HIS 38 ? A HIS 4 37 3 Y 1 A HIS 39 ? A HIS 5 38 3 Y 1 A HIS 40 ? A HIS 6 39 3 Y 1 A HIS 41 ? A HIS 7 40 3 Y 1 A SER 42 ? A SER 8 41 3 Y 1 A SER 43 ? A SER 9 42 3 Y 1 A GLY 44 ? A GLY 10 43 3 Y 1 A LEU 45 ? A LEU 11 44 3 Y 1 A VAL 46 ? A VAL 12 45 3 Y 1 A PRO 47 ? A PRO 13 46 3 Y 1 A ARG 48 ? A ARG 14 47 3 Y 1 A GLY 49 ? A GLY 15 48 3 Y 1 A SER 50 ? A SER 16 49 4 Y 1 A MET 35 ? A MET 1 50 4 Y 1 A HIS 36 ? A HIS 2 51 4 Y 1 A HIS 37 ? A HIS 3 52 4 Y 1 A HIS 38 ? A HIS 4 53 4 Y 1 A HIS 39 ? A HIS 5 54 4 Y 1 A HIS 40 ? A HIS 6 55 4 Y 1 A HIS 41 ? A HIS 7 56 4 Y 1 A SER 42 ? A SER 8 57 4 Y 1 A SER 43 ? A SER 9 58 4 Y 1 A GLY 44 ? A GLY 10 59 4 Y 1 A LEU 45 ? A LEU 11 60 4 Y 1 A VAL 46 ? A VAL 12 61 4 Y 1 A PRO 47 ? A PRO 13 62 4 Y 1 A ARG 48 ? A ARG 14 63 4 Y 1 A GLY 49 ? A GLY 15 64 4 Y 1 A SER 50 ? A SER 16 65 5 Y 1 A MET 35 ? A MET 1 66 5 Y 1 A HIS 36 ? A HIS 2 67 5 Y 1 A HIS 37 ? A HIS 3 68 5 Y 1 A HIS 38 ? A HIS 4 69 5 Y 1 A HIS 39 ? A HIS 5 70 5 Y 1 A HIS 40 ? A HIS 6 71 5 Y 1 A HIS 41 ? A HIS 7 72 5 Y 1 A SER 42 ? A SER 8 73 5 Y 1 A SER 43 ? A SER 9 74 5 Y 1 A GLY 44 ? A GLY 10 75 5 Y 1 A LEU 45 ? A LEU 11 76 5 Y 1 A VAL 46 ? A VAL 12 77 5 Y 1 A PRO 47 ? A PRO 13 78 5 Y 1 A ARG 48 ? A ARG 14 79 5 Y 1 A GLY 49 ? A GLY 15 80 5 Y 1 A SER 50 ? A SER 16 81 6 Y 1 A MET 35 ? A MET 1 82 6 Y 1 A HIS 36 ? A HIS 2 83 6 Y 1 A HIS 37 ? A HIS 3 84 6 Y 1 A HIS 38 ? A HIS 4 85 6 Y 1 A HIS 39 ? A HIS 5 86 6 Y 1 A HIS 40 ? A HIS 6 87 6 Y 1 A HIS 41 ? A HIS 7 88 6 Y 1 A SER 42 ? A SER 8 89 6 Y 1 A SER 43 ? A SER 9 90 6 Y 1 A GLY 44 ? A GLY 10 91 6 Y 1 A LEU 45 ? A LEU 11 92 6 Y 1 A VAL 46 ? A VAL 12 93 6 Y 1 A PRO 47 ? A PRO 13 94 6 Y 1 A ARG 48 ? A ARG 14 95 6 Y 1 A GLY 49 ? A GLY 15 96 6 Y 1 A SER 50 ? A SER 16 97 7 Y 1 A MET 35 ? A MET 1 98 7 Y 1 A HIS 36 ? A HIS 2 99 7 Y 1 A HIS 37 ? A HIS 3 100 7 Y 1 A HIS 38 ? A HIS 4 101 7 Y 1 A HIS 39 ? A HIS 5 102 7 Y 1 A HIS 40 ? A HIS 6 103 7 Y 1 A HIS 41 ? A HIS 7 104 7 Y 1 A SER 42 ? A SER 8 105 7 Y 1 A SER 43 ? A SER 9 106 7 Y 1 A GLY 44 ? A GLY 10 107 7 Y 1 A LEU 45 ? A LEU 11 108 7 Y 1 A VAL 46 ? A VAL 12 109 7 Y 1 A PRO 47 ? A PRO 13 110 7 Y 1 A ARG 48 ? A ARG 14 111 7 Y 1 A GLY 49 ? A GLY 15 112 7 Y 1 A SER 50 ? A SER 16 113 8 Y 1 A MET 35 ? A MET 1 114 8 Y 1 A HIS 36 ? A HIS 2 115 8 Y 1 A HIS 37 ? A HIS 3 116 8 Y 1 A HIS 38 ? A HIS 4 117 8 Y 1 A HIS 39 ? A HIS 5 118 8 Y 1 A HIS 40 ? A HIS 6 119 8 Y 1 A HIS 41 ? A HIS 7 120 8 Y 1 A SER 42 ? A SER 8 121 8 Y 1 A SER 43 ? A SER 9 122 8 Y 1 A GLY 44 ? A GLY 10 123 8 Y 1 A LEU 45 ? A LEU 11 124 8 Y 1 A VAL 46 ? A VAL 12 125 8 Y 1 A PRO 47 ? A PRO 13 126 8 Y 1 A ARG 48 ? A ARG 14 127 8 Y 1 A GLY 49 ? A GLY 15 128 8 Y 1 A SER 50 ? A SER 16 129 9 Y 1 A MET 35 ? A MET 1 130 9 Y 1 A HIS 36 ? A HIS 2 131 9 Y 1 A HIS 37 ? A HIS 3 132 9 Y 1 A HIS 38 ? A HIS 4 133 9 Y 1 A HIS 39 ? A HIS 5 134 9 Y 1 A HIS 40 ? A HIS 6 135 9 Y 1 A HIS 41 ? A HIS 7 136 9 Y 1 A SER 42 ? A SER 8 137 9 Y 1 A SER 43 ? A SER 9 138 9 Y 1 A GLY 44 ? A GLY 10 139 9 Y 1 A LEU 45 ? A LEU 11 140 9 Y 1 A VAL 46 ? A VAL 12 141 9 Y 1 A PRO 47 ? A PRO 13 142 9 Y 1 A ARG 48 ? A ARG 14 143 9 Y 1 A GLY 49 ? A GLY 15 144 9 Y 1 A SER 50 ? A SER 16 145 10 Y 1 A MET 35 ? A MET 1 146 10 Y 1 A HIS 36 ? A HIS 2 147 10 Y 1 A HIS 37 ? A HIS 3 148 10 Y 1 A HIS 38 ? A HIS 4 149 10 Y 1 A HIS 39 ? A HIS 5 150 10 Y 1 A HIS 40 ? A HIS 6 151 10 Y 1 A HIS 41 ? A HIS 7 152 10 Y 1 A SER 42 ? A SER 8 153 10 Y 1 A SER 43 ? A SER 9 154 10 Y 1 A GLY 44 ? A GLY 10 155 10 Y 1 A LEU 45 ? A LEU 11 156 10 Y 1 A VAL 46 ? A VAL 12 157 10 Y 1 A PRO 47 ? A PRO 13 158 10 Y 1 A ARG 48 ? A ARG 14 159 10 Y 1 A GLY 49 ? A GLY 15 160 10 Y 1 A SER 50 ? A SER 16 161 11 Y 1 A MET 35 ? A MET 1 162 11 Y 1 A HIS 36 ? A HIS 2 163 11 Y 1 A HIS 37 ? A HIS 3 164 11 Y 1 A HIS 38 ? A HIS 4 165 11 Y 1 A HIS 39 ? A HIS 5 166 11 Y 1 A HIS 40 ? A HIS 6 167 11 Y 1 A HIS 41 ? A HIS 7 168 11 Y 1 A SER 42 ? A SER 8 169 11 Y 1 A SER 43 ? A SER 9 170 11 Y 1 A GLY 44 ? A GLY 10 171 11 Y 1 A LEU 45 ? A LEU 11 172 11 Y 1 A VAL 46 ? A VAL 12 173 11 Y 1 A PRO 47 ? A PRO 13 174 11 Y 1 A ARG 48 ? A ARG 14 175 11 Y 1 A GLY 49 ? A GLY 15 176 11 Y 1 A SER 50 ? A SER 16 177 12 Y 1 A MET 35 ? A MET 1 178 12 Y 1 A HIS 36 ? A HIS 2 179 12 Y 1 A HIS 37 ? A HIS 3 180 12 Y 1 A HIS 38 ? A HIS 4 181 12 Y 1 A HIS 39 ? A HIS 5 182 12 Y 1 A HIS 40 ? A HIS 6 183 12 Y 1 A HIS 41 ? A HIS 7 184 12 Y 1 A SER 42 ? A SER 8 185 12 Y 1 A SER 43 ? A SER 9 186 12 Y 1 A GLY 44 ? A GLY 10 187 12 Y 1 A LEU 45 ? A LEU 11 188 12 Y 1 A VAL 46 ? A VAL 12 189 12 Y 1 A PRO 47 ? A PRO 13 190 12 Y 1 A ARG 48 ? A ARG 14 191 12 Y 1 A GLY 49 ? A GLY 15 192 12 Y 1 A SER 50 ? A SER 16 193 13 Y 1 A MET 35 ? A MET 1 194 13 Y 1 A HIS 36 ? A HIS 2 195 13 Y 1 A HIS 37 ? A HIS 3 196 13 Y 1 A HIS 38 ? A HIS 4 197 13 Y 1 A HIS 39 ? A HIS 5 198 13 Y 1 A HIS 40 ? A HIS 6 199 13 Y 1 A HIS 41 ? A HIS 7 200 13 Y 1 A SER 42 ? A SER 8 201 13 Y 1 A SER 43 ? A SER 9 202 13 Y 1 A GLY 44 ? A GLY 10 203 13 Y 1 A LEU 45 ? A LEU 11 204 13 Y 1 A VAL 46 ? A VAL 12 205 13 Y 1 A PRO 47 ? A PRO 13 206 13 Y 1 A ARG 48 ? A ARG 14 207 13 Y 1 A GLY 49 ? A GLY 15 208 13 Y 1 A SER 50 ? A SER 16 209 14 Y 1 A MET 35 ? A MET 1 210 14 Y 1 A HIS 36 ? A HIS 2 211 14 Y 1 A HIS 37 ? A HIS 3 212 14 Y 1 A HIS 38 ? A HIS 4 213 14 Y 1 A HIS 39 ? A HIS 5 214 14 Y 1 A HIS 40 ? A HIS 6 215 14 Y 1 A HIS 41 ? A HIS 7 216 14 Y 1 A SER 42 ? A SER 8 217 14 Y 1 A SER 43 ? A SER 9 218 14 Y 1 A GLY 44 ? A GLY 10 219 14 Y 1 A LEU 45 ? A LEU 11 220 14 Y 1 A VAL 46 ? A VAL 12 221 14 Y 1 A PRO 47 ? A PRO 13 222 14 Y 1 A ARG 48 ? A ARG 14 223 14 Y 1 A GLY 49 ? A GLY 15 224 14 Y 1 A SER 50 ? A SER 16 225 15 Y 1 A MET 35 ? A MET 1 226 15 Y 1 A HIS 36 ? A HIS 2 227 15 Y 1 A HIS 37 ? A HIS 3 228 15 Y 1 A HIS 38 ? A HIS 4 229 15 Y 1 A HIS 39 ? A HIS 5 230 15 Y 1 A HIS 40 ? A HIS 6 231 15 Y 1 A HIS 41 ? A HIS 7 232 15 Y 1 A SER 42 ? A SER 8 233 15 Y 1 A SER 43 ? A SER 9 234 15 Y 1 A GLY 44 ? A GLY 10 235 15 Y 1 A LEU 45 ? A LEU 11 236 15 Y 1 A VAL 46 ? A VAL 12 237 15 Y 1 A PRO 47 ? A PRO 13 238 15 Y 1 A ARG 48 ? A ARG 14 239 15 Y 1 A GLY 49 ? A GLY 15 240 15 Y 1 A SER 50 ? A SER 16 241 16 Y 1 A MET 35 ? A MET 1 242 16 Y 1 A HIS 36 ? A HIS 2 243 16 Y 1 A HIS 37 ? A HIS 3 244 16 Y 1 A HIS 38 ? A HIS 4 245 16 Y 1 A HIS 39 ? A HIS 5 246 16 Y 1 A HIS 40 ? A HIS 6 247 16 Y 1 A HIS 41 ? A HIS 7 248 16 Y 1 A SER 42 ? A SER 8 249 16 Y 1 A SER 43 ? A SER 9 250 16 Y 1 A GLY 44 ? A GLY 10 251 16 Y 1 A LEU 45 ? A LEU 11 252 16 Y 1 A VAL 46 ? A VAL 12 253 16 Y 1 A PRO 47 ? A PRO 13 254 16 Y 1 A ARG 48 ? A ARG 14 255 16 Y 1 A GLY 49 ? A GLY 15 256 16 Y 1 A SER 50 ? A SER 16 257 17 Y 1 A MET 35 ? A MET 1 258 17 Y 1 A HIS 36 ? A HIS 2 259 17 Y 1 A HIS 37 ? A HIS 3 260 17 Y 1 A HIS 38 ? A HIS 4 261 17 Y 1 A HIS 39 ? A HIS 5 262 17 Y 1 A HIS 40 ? A HIS 6 263 17 Y 1 A HIS 41 ? A HIS 7 264 17 Y 1 A SER 42 ? A SER 8 265 17 Y 1 A SER 43 ? A SER 9 266 17 Y 1 A GLY 44 ? A GLY 10 267 17 Y 1 A LEU 45 ? A LEU 11 268 17 Y 1 A VAL 46 ? A VAL 12 269 17 Y 1 A PRO 47 ? A PRO 13 270 17 Y 1 A ARG 48 ? A ARG 14 271 17 Y 1 A GLY 49 ? A GLY 15 272 17 Y 1 A SER 50 ? A SER 16 273 18 Y 1 A MET 35 ? A MET 1 274 18 Y 1 A HIS 36 ? A HIS 2 275 18 Y 1 A HIS 37 ? A HIS 3 276 18 Y 1 A HIS 38 ? A HIS 4 277 18 Y 1 A HIS 39 ? A HIS 5 278 18 Y 1 A HIS 40 ? A HIS 6 279 18 Y 1 A HIS 41 ? A HIS 7 280 18 Y 1 A SER 42 ? A SER 8 281 18 Y 1 A SER 43 ? A SER 9 282 18 Y 1 A GLY 44 ? A GLY 10 283 18 Y 1 A LEU 45 ? A LEU 11 284 18 Y 1 A VAL 46 ? A VAL 12 285 18 Y 1 A PRO 47 ? A PRO 13 286 18 Y 1 A ARG 48 ? A ARG 14 287 18 Y 1 A GLY 49 ? A GLY 15 288 18 Y 1 A SER 50 ? A SER 16 289 19 Y 1 A MET 35 ? A MET 1 290 19 Y 1 A HIS 36 ? A HIS 2 291 19 Y 1 A HIS 37 ? A HIS 3 292 19 Y 1 A HIS 38 ? A HIS 4 293 19 Y 1 A HIS 39 ? A HIS 5 294 19 Y 1 A HIS 40 ? A HIS 6 295 19 Y 1 A HIS 41 ? A HIS 7 296 19 Y 1 A SER 42 ? A SER 8 297 19 Y 1 A SER 43 ? A SER 9 298 19 Y 1 A GLY 44 ? A GLY 10 299 19 Y 1 A LEU 45 ? A LEU 11 300 19 Y 1 A VAL 46 ? A VAL 12 301 19 Y 1 A PRO 47 ? A PRO 13 302 19 Y 1 A ARG 48 ? A ARG 14 303 19 Y 1 A GLY 49 ? A GLY 15 304 19 Y 1 A SER 50 ? A SER 16 305 20 Y 1 A MET 35 ? A MET 1 306 20 Y 1 A HIS 36 ? A HIS 2 307 20 Y 1 A HIS 37 ? A HIS 3 308 20 Y 1 A HIS 38 ? A HIS 4 309 20 Y 1 A HIS 39 ? A HIS 5 310 20 Y 1 A HIS 40 ? A HIS 6 311 20 Y 1 A HIS 41 ? A HIS 7 312 20 Y 1 A SER 42 ? A SER 8 313 20 Y 1 A SER 43 ? A SER 9 314 20 Y 1 A GLY 44 ? A GLY 10 315 20 Y 1 A LEU 45 ? A LEU 11 316 20 Y 1 A VAL 46 ? A VAL 12 317 20 Y 1 A PRO 47 ? A PRO 13 318 20 Y 1 A ARG 48 ? A ARG 14 319 20 Y 1 A GLY 49 ? A GLY 15 320 20 Y 1 A SER 50 ? A SER 16 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 21735007 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 AVANCE ? Bruker 600 ? 2 AVANCE ? Bruker 800 ? # _atom_sites.entry_id 6LMS _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #