data_6LVT # _entry.id 6LVT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6LVT pdb_00006lvt 10.2210/pdb6lvt/pdb WWPDB D_1300015583 ? ? BMRB 36242 ? 10.13018/BMR36242 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-12-09 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' Other 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6LVT _pdbx_database_status.recvd_initial_deposition_date 2020-02-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 36242 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lee, Y.' 1 0000-0002-9156-6477 'Kim, Y.' 2 0000-0001-6438-4718 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Int J Mol Sci' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1422-0067 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 21 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural Characterization of an ACP from Thermotoga maritima : Insights into Hyperthermal Adaptation.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/ijms21072600 _citation.pdbx_database_id_PubMed 32283632 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lee, Y.' 1 ? primary 'Jang, A.' 2 ? primary 'Jeong, M.C.' 3 ? primary 'Park, N.' 4 ? primary 'Park, J.' 5 ? primary 'Lee, W.C.' 6 ? primary 'Cheong, C.' 7 ? primary 'Kim, Y.' 8 0000-0001-6438-4718 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Acyl carrier protein' _entity.formula_weight 8905.988 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ACP # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MASREEIFSKVKSIISEKLGVDESQVTEEAKLIDDLGADSLDLVDLVMDFESEFGVKVDDADLEKISTVGDIVSYIEKKL G ; _entity_poly.pdbx_seq_one_letter_code_can ;MASREEIFSKVKSIISEKLGVDESQVTEEAKLIDDLGADSLDLVDLVMDFESEFGVKVDDADLEKISTVGDIVSYIEKKL G ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 SER n 1 4 ARG n 1 5 GLU n 1 6 GLU n 1 7 ILE n 1 8 PHE n 1 9 SER n 1 10 LYS n 1 11 VAL n 1 12 LYS n 1 13 SER n 1 14 ILE n 1 15 ILE n 1 16 SER n 1 17 GLU n 1 18 LYS n 1 19 LEU n 1 20 GLY n 1 21 VAL n 1 22 ASP n 1 23 GLU n 1 24 SER n 1 25 GLN n 1 26 VAL n 1 27 THR n 1 28 GLU n 1 29 GLU n 1 30 ALA n 1 31 LYS n 1 32 LEU n 1 33 ILE n 1 34 ASP n 1 35 ASP n 1 36 LEU n 1 37 GLY n 1 38 ALA n 1 39 ASP n 1 40 SER n 1 41 LEU n 1 42 ASP n 1 43 LEU n 1 44 VAL n 1 45 ASP n 1 46 LEU n 1 47 VAL n 1 48 MET n 1 49 ASP n 1 50 PHE n 1 51 GLU n 1 52 SER n 1 53 GLU n 1 54 PHE n 1 55 GLY n 1 56 VAL n 1 57 LYS n 1 58 VAL n 1 59 ASP n 1 60 ASP n 1 61 ALA n 1 62 ASP n 1 63 LEU n 1 64 GLU n 1 65 LYS n 1 66 ILE n 1 67 SER n 1 68 THR n 1 69 VAL n 1 70 GLY n 1 71 ASP n 1 72 ILE n 1 73 VAL n 1 74 SER n 1 75 TYR n 1 76 ILE n 1 77 GLU n 1 78 LYS n 1 79 LYS n 1 80 LEU n 1 81 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 81 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene acpP _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain MSB8 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermotoga maritima MSB8' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 243274 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET11a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 GLY 81 81 81 GLY GLY A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6LVT _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6LVT _struct.title 'Solution structure of holo acyl carrier protein from Thermotoga maritima' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6LVT _struct_keywords.text 'acyl carrier protein, BIOSYNTHETIC PROTEIN' _struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ACP_THEMA _struct_ref.pdbx_db_accession Q9WZD0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MASREEIFSKVKSIISEKLGVDESQVTEEAKLIDDLGADSLDLVDLVMDFESEFGVKVDDADLEKISTVGDIVSYIEKKL G ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6LVT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 81 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9WZD0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 81 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 81 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 4910 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 3 ? GLY A 20 ? SER A 3 GLY A 20 1 ? 18 HELX_P HELX_P2 AA2 ASP A 39 ? PHE A 54 ? ASP A 39 PHE A 54 1 ? 16 HELX_P HELX_P3 AA3 ASP A 59 ? ILE A 66 ? ASP A 59 ILE A 66 1 ? 8 HELX_P HELX_P4 AA4 THR A 68 ? LEU A 80 ? THR A 68 LEU A 80 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 23 ? ? -45.68 -16.55 2 2 GLU A 23 ? ? -37.39 -28.78 3 3 GLU A 23 ? ? -45.81 -16.77 4 3 SER A 67 ? ? -109.42 -61.16 5 4 GLU A 23 ? ? -44.53 -18.50 6 5 GLU A 23 ? ? -36.83 -28.23 7 6 GLU A 23 ? ? -46.69 -15.88 8 7 GLU A 23 ? ? -38.20 -26.97 9 8 GLU A 23 ? ? -38.65 -25.83 10 9 GLU A 23 ? ? -44.90 -18.71 11 9 SER A 67 ? ? -121.29 -53.05 12 10 GLU A 23 ? ? -39.13 -24.97 13 10 SER A 67 ? ? 176.15 -69.01 14 11 GLU A 23 ? ? -46.16 -16.28 15 12 ALA A 2 ? ? 54.76 96.28 16 12 GLU A 23 ? ? -37.30 -27.16 17 13 GLU A 23 ? ? -45.25 -16.77 18 14 GLU A 23 ? ? -37.89 -27.19 19 14 SER A 67 ? ? -120.00 -50.28 20 15 ALA A 2 ? ? 55.82 86.56 21 15 GLU A 23 ? ? -38.17 -26.95 22 16 GLU A 23 ? ? -38.11 -26.62 23 17 GLU A 23 ? ? -46.52 -17.05 24 18 GLU A 23 ? ? -45.86 -15.81 25 19 GLU A 23 ? ? -37.68 -27.59 26 20 GLU A 23 ? ? -45.52 -16.60 # _pdbx_nmr_ensemble.entry_id 6LVT _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'all calculated structures submitted' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6LVT _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.5 mM ACP, 90% H2O/10% D2O' '90% H2O/10% D2O' 'non-labeled sample' solution ? 2 '0.5 mM [U-99% 15N] ACP, 90% H2O/10% D2O' '90% H2O/10% D2O' '15N sample' solution ? 3 '0.5 mM [U-99% 13C; U-99% 15N] ACP, 90% H2O/10% D2O' '90% H2O/10% D2O' '13C/15N sample' solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 ACP 0.5 ? mM 'natural abundance' 2 ACP 0.5 ? mM '[U-99% 15N]' 3 ACP 0.5 ? mM '[U-99% 13C; U-99% 15N]' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298 atm 1 6.1 . '25mM MES, 5mM CaCl2, 5mM DTT, 50nM DSS, 0.5mg/mL NaN3' ? 'Not defined' buffer ? pH ? ? K 2 298 atm 1 6.1 . '5% acrylamide, 25mM MES, 5mM CaCl2, 5mM DTT, 50nM DSS, 0.5mg/mL NaN3' ? 'Not defined' 'polyacrylamide gel' ? pH ? ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 3 '2D 1H-15N HSQC' 1 isotropic 2 1 3 '2D 1H-13C HSQC' 1 isotropic 3 1 3 '3D HNCACB' 1 isotropic 4 1 3 '3D CBCA(CO)NH' 1 isotropic 5 1 3 '3D HNCO' 1 isotropic 6 1 3 '3D C(CO)NH' 1 isotropic 7 1 3 '3D HBHA(CO)NH' 1 isotropic 8 1 3 '3D H(CCO)NH' 1 isotropic 9 1 1 '2D 1H-1H TOCSY' 1 isotropic 10 1 1 '2D 1H-1H NOESY' 1 isotropic 11 1 3 '3D 1H-15N NOESY' 1 isotropic 12 1 3 '3D 1H-13C NOESY aliphatic' 1 isotropic 13 1 3 '3D 1H-13C NOESY aromatic' 1 isotropic 14 1 2 '2D HSQC-DSSE(IPAP)' 1 isotropic 15 2 2 '2D HSQC-DSSE(IPAP)' 1 anisotropic # _pdbx_nmr_refine.entry_id 6LVT _pdbx_nmr_refine.method na _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 6 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 3 'peak picking' NMRFAM-SPARKY ? 'Lee, Tonelli and Markley' 4 'chemical shift assignment' NMRFAM-SPARKY ? 'Lee, Tonelli and Markley' 5 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 6 refinement PONDEROSA-C/S ? 'Lee, Cornilescu, Dashti, Eghbalnia, Tonelli, Westler, Butcher, Wildman-Henzler and Markley' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 GLN N N N N 57 GLN CA C N S 58 GLN C C N N 59 GLN O O N N 60 GLN CB C N N 61 GLN CG C N N 62 GLN CD C N N 63 GLN OE1 O N N 64 GLN NE2 N N N 65 GLN OXT O N N 66 GLN H H N N 67 GLN H2 H N N 68 GLN HA H N N 69 GLN HB2 H N N 70 GLN HB3 H N N 71 GLN HG2 H N N 72 GLN HG3 H N N 73 GLN HE21 H N N 74 GLN HE22 H N N 75 GLN HXT H N N 76 GLU N N N N 77 GLU CA C N S 78 GLU C C N N 79 GLU O O N N 80 GLU CB C N N 81 GLU CG C N N 82 GLU CD C N N 83 GLU OE1 O N N 84 GLU OE2 O N N 85 GLU OXT O N N 86 GLU H H N N 87 GLU H2 H N N 88 GLU HA H N N 89 GLU HB2 H N N 90 GLU HB3 H N N 91 GLU HG2 H N N 92 GLU HG3 H N N 93 GLU HE2 H N N 94 GLU HXT H N N 95 GLY N N N N 96 GLY CA C N N 97 GLY C C N N 98 GLY O O N N 99 GLY OXT O N N 100 GLY H H N N 101 GLY H2 H N N 102 GLY HA2 H N N 103 GLY HA3 H N N 104 GLY HXT H N N 105 ILE N N N N 106 ILE CA C N S 107 ILE C C N N 108 ILE O O N N 109 ILE CB C N S 110 ILE CG1 C N N 111 ILE CG2 C N N 112 ILE CD1 C N N 113 ILE OXT O N N 114 ILE H H N N 115 ILE H2 H N N 116 ILE HA H N N 117 ILE HB H N N 118 ILE HG12 H N N 119 ILE HG13 H N N 120 ILE HG21 H N N 121 ILE HG22 H N N 122 ILE HG23 H N N 123 ILE HD11 H N N 124 ILE HD12 H N N 125 ILE HD13 H N N 126 ILE HXT H N N 127 LEU N N N N 128 LEU CA C N S 129 LEU C C N N 130 LEU O O N N 131 LEU CB C N N 132 LEU CG C N N 133 LEU CD1 C N N 134 LEU CD2 C N N 135 LEU OXT O N N 136 LEU H H N N 137 LEU H2 H N N 138 LEU HA H N N 139 LEU HB2 H N N 140 LEU HB3 H N N 141 LEU HG H N N 142 LEU HD11 H N N 143 LEU HD12 H N N 144 LEU HD13 H N N 145 LEU HD21 H N N 146 LEU HD22 H N N 147 LEU HD23 H N N 148 LEU HXT H N N 149 LYS N N N N 150 LYS CA C N S 151 LYS C C N N 152 LYS O O N N 153 LYS CB C N N 154 LYS CG C N N 155 LYS CD C N N 156 LYS CE C N N 157 LYS NZ N N N 158 LYS OXT O N N 159 LYS H H N N 160 LYS H2 H N N 161 LYS HA H N N 162 LYS HB2 H N N 163 LYS HB3 H N N 164 LYS HG2 H N N 165 LYS HG3 H N N 166 LYS HD2 H N N 167 LYS HD3 H N N 168 LYS HE2 H N N 169 LYS HE3 H N N 170 LYS HZ1 H N N 171 LYS HZ2 H N N 172 LYS HZ3 H N N 173 LYS HXT H N N 174 MET N N N N 175 MET CA C N S 176 MET C C N N 177 MET O O N N 178 MET CB C N N 179 MET CG C N N 180 MET SD S N N 181 MET CE C N N 182 MET OXT O N N 183 MET H H N N 184 MET H2 H N N 185 MET HA H N N 186 MET HB2 H N N 187 MET HB3 H N N 188 MET HG2 H N N 189 MET HG3 H N N 190 MET HE1 H N N 191 MET HE2 H N N 192 MET HE3 H N N 193 MET HXT H N N 194 PHE N N N N 195 PHE CA C N S 196 PHE C C N N 197 PHE O O N N 198 PHE CB C N N 199 PHE CG C Y N 200 PHE CD1 C Y N 201 PHE CD2 C Y N 202 PHE CE1 C Y N 203 PHE CE2 C Y N 204 PHE CZ C Y N 205 PHE OXT O N N 206 PHE H H N N 207 PHE H2 H N N 208 PHE HA H N N 209 PHE HB2 H N N 210 PHE HB3 H N N 211 PHE HD1 H N N 212 PHE HD2 H N N 213 PHE HE1 H N N 214 PHE HE2 H N N 215 PHE HZ H N N 216 PHE HXT H N N 217 SER N N N N 218 SER CA C N S 219 SER C C N N 220 SER O O N N 221 SER CB C N N 222 SER OG O N N 223 SER OXT O N N 224 SER H H N N 225 SER H2 H N N 226 SER HA H N N 227 SER HB2 H N N 228 SER HB3 H N N 229 SER HG H N N 230 SER HXT H N N 231 THR N N N N 232 THR CA C N S 233 THR C C N N 234 THR O O N N 235 THR CB C N R 236 THR OG1 O N N 237 THR CG2 C N N 238 THR OXT O N N 239 THR H H N N 240 THR H2 H N N 241 THR HA H N N 242 THR HB H N N 243 THR HG1 H N N 244 THR HG21 H N N 245 THR HG22 H N N 246 THR HG23 H N N 247 THR HXT H N N 248 TYR N N N N 249 TYR CA C N S 250 TYR C C N N 251 TYR O O N N 252 TYR CB C N N 253 TYR CG C Y N 254 TYR CD1 C Y N 255 TYR CD2 C Y N 256 TYR CE1 C Y N 257 TYR CE2 C Y N 258 TYR CZ C Y N 259 TYR OH O N N 260 TYR OXT O N N 261 TYR H H N N 262 TYR H2 H N N 263 TYR HA H N N 264 TYR HB2 H N N 265 TYR HB3 H N N 266 TYR HD1 H N N 267 TYR HD2 H N N 268 TYR HE1 H N N 269 TYR HE2 H N N 270 TYR HH H N N 271 TYR HXT H N N 272 VAL N N N N 273 VAL CA C N S 274 VAL C C N N 275 VAL O O N N 276 VAL CB C N N 277 VAL CG1 C N N 278 VAL CG2 C N N 279 VAL OXT O N N 280 VAL H H N N 281 VAL H2 H N N 282 VAL HA H N N 283 VAL HB H N N 284 VAL HG11 H N N 285 VAL HG12 H N N 286 VAL HG13 H N N 287 VAL HG21 H N N 288 VAL HG22 H N N 289 VAL HG23 H N N 290 VAL HXT H N N 291 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 GLN N CA sing N N 54 GLN N H sing N N 55 GLN N H2 sing N N 56 GLN CA C sing N N 57 GLN CA CB sing N N 58 GLN CA HA sing N N 59 GLN C O doub N N 60 GLN C OXT sing N N 61 GLN CB CG sing N N 62 GLN CB HB2 sing N N 63 GLN CB HB3 sing N N 64 GLN CG CD sing N N 65 GLN CG HG2 sing N N 66 GLN CG HG3 sing N N 67 GLN CD OE1 doub N N 68 GLN CD NE2 sing N N 69 GLN NE2 HE21 sing N N 70 GLN NE2 HE22 sing N N 71 GLN OXT HXT sing N N 72 GLU N CA sing N N 73 GLU N H sing N N 74 GLU N H2 sing N N 75 GLU CA C sing N N 76 GLU CA CB sing N N 77 GLU CA HA sing N N 78 GLU C O doub N N 79 GLU C OXT sing N N 80 GLU CB CG sing N N 81 GLU CB HB2 sing N N 82 GLU CB HB3 sing N N 83 GLU CG CD sing N N 84 GLU CG HG2 sing N N 85 GLU CG HG3 sing N N 86 GLU CD OE1 doub N N 87 GLU CD OE2 sing N N 88 GLU OE2 HE2 sing N N 89 GLU OXT HXT sing N N 90 GLY N CA sing N N 91 GLY N H sing N N 92 GLY N H2 sing N N 93 GLY CA C sing N N 94 GLY CA HA2 sing N N 95 GLY CA HA3 sing N N 96 GLY C O doub N N 97 GLY C OXT sing N N 98 GLY OXT HXT sing N N 99 ILE N CA sing N N 100 ILE N H sing N N 101 ILE N H2 sing N N 102 ILE CA C sing N N 103 ILE CA CB sing N N 104 ILE CA HA sing N N 105 ILE C O doub N N 106 ILE C OXT sing N N 107 ILE CB CG1 sing N N 108 ILE CB CG2 sing N N 109 ILE CB HB sing N N 110 ILE CG1 CD1 sing N N 111 ILE CG1 HG12 sing N N 112 ILE CG1 HG13 sing N N 113 ILE CG2 HG21 sing N N 114 ILE CG2 HG22 sing N N 115 ILE CG2 HG23 sing N N 116 ILE CD1 HD11 sing N N 117 ILE CD1 HD12 sing N N 118 ILE CD1 HD13 sing N N 119 ILE OXT HXT sing N N 120 LEU N CA sing N N 121 LEU N H sing N N 122 LEU N H2 sing N N 123 LEU CA C sing N N 124 LEU CA CB sing N N 125 LEU CA HA sing N N 126 LEU C O doub N N 127 LEU C OXT sing N N 128 LEU CB CG sing N N 129 LEU CB HB2 sing N N 130 LEU CB HB3 sing N N 131 LEU CG CD1 sing N N 132 LEU CG CD2 sing N N 133 LEU CG HG sing N N 134 LEU CD1 HD11 sing N N 135 LEU CD1 HD12 sing N N 136 LEU CD1 HD13 sing N N 137 LEU CD2 HD21 sing N N 138 LEU CD2 HD22 sing N N 139 LEU CD2 HD23 sing N N 140 LEU OXT HXT sing N N 141 LYS N CA sing N N 142 LYS N H sing N N 143 LYS N H2 sing N N 144 LYS CA C sing N N 145 LYS CA CB sing N N 146 LYS CA HA sing N N 147 LYS C O doub N N 148 LYS C OXT sing N N 149 LYS CB CG sing N N 150 LYS CB HB2 sing N N 151 LYS CB HB3 sing N N 152 LYS CG CD sing N N 153 LYS CG HG2 sing N N 154 LYS CG HG3 sing N N 155 LYS CD CE sing N N 156 LYS CD HD2 sing N N 157 LYS CD HD3 sing N N 158 LYS CE NZ sing N N 159 LYS CE HE2 sing N N 160 LYS CE HE3 sing N N 161 LYS NZ HZ1 sing N N 162 LYS NZ HZ2 sing N N 163 LYS NZ HZ3 sing N N 164 LYS OXT HXT sing N N 165 MET N CA sing N N 166 MET N H sing N N 167 MET N H2 sing N N 168 MET CA C sing N N 169 MET CA CB sing N N 170 MET CA HA sing N N 171 MET C O doub N N 172 MET C OXT sing N N 173 MET CB CG sing N N 174 MET CB HB2 sing N N 175 MET CB HB3 sing N N 176 MET CG SD sing N N 177 MET CG HG2 sing N N 178 MET CG HG3 sing N N 179 MET SD CE sing N N 180 MET CE HE1 sing N N 181 MET CE HE2 sing N N 182 MET CE HE3 sing N N 183 MET OXT HXT sing N N 184 PHE N CA sing N N 185 PHE N H sing N N 186 PHE N H2 sing N N 187 PHE CA C sing N N 188 PHE CA CB sing N N 189 PHE CA HA sing N N 190 PHE C O doub N N 191 PHE C OXT sing N N 192 PHE CB CG sing N N 193 PHE CB HB2 sing N N 194 PHE CB HB3 sing N N 195 PHE CG CD1 doub Y N 196 PHE CG CD2 sing Y N 197 PHE CD1 CE1 sing Y N 198 PHE CD1 HD1 sing N N 199 PHE CD2 CE2 doub Y N 200 PHE CD2 HD2 sing N N 201 PHE CE1 CZ doub Y N 202 PHE CE1 HE1 sing N N 203 PHE CE2 CZ sing Y N 204 PHE CE2 HE2 sing N N 205 PHE CZ HZ sing N N 206 PHE OXT HXT sing N N 207 SER N CA sing N N 208 SER N H sing N N 209 SER N H2 sing N N 210 SER CA C sing N N 211 SER CA CB sing N N 212 SER CA HA sing N N 213 SER C O doub N N 214 SER C OXT sing N N 215 SER CB OG sing N N 216 SER CB HB2 sing N N 217 SER CB HB3 sing N N 218 SER OG HG sing N N 219 SER OXT HXT sing N N 220 THR N CA sing N N 221 THR N H sing N N 222 THR N H2 sing N N 223 THR CA C sing N N 224 THR CA CB sing N N 225 THR CA HA sing N N 226 THR C O doub N N 227 THR C OXT sing N N 228 THR CB OG1 sing N N 229 THR CB CG2 sing N N 230 THR CB HB sing N N 231 THR OG1 HG1 sing N N 232 THR CG2 HG21 sing N N 233 THR CG2 HG22 sing N N 234 THR CG2 HG23 sing N N 235 THR OXT HXT sing N N 236 TYR N CA sing N N 237 TYR N H sing N N 238 TYR N H2 sing N N 239 TYR CA C sing N N 240 TYR CA CB sing N N 241 TYR CA HA sing N N 242 TYR C O doub N N 243 TYR C OXT sing N N 244 TYR CB CG sing N N 245 TYR CB HB2 sing N N 246 TYR CB HB3 sing N N 247 TYR CG CD1 doub Y N 248 TYR CG CD2 sing Y N 249 TYR CD1 CE1 sing Y N 250 TYR CD1 HD1 sing N N 251 TYR CD2 CE2 doub Y N 252 TYR CD2 HD2 sing N N 253 TYR CE1 CZ doub Y N 254 TYR CE1 HE1 sing N N 255 TYR CE2 CZ sing Y N 256 TYR CE2 HE2 sing N N 257 TYR CZ OH sing N N 258 TYR OH HH sing N N 259 TYR OXT HXT sing N N 260 VAL N CA sing N N 261 VAL N H sing N N 262 VAL N H2 sing N N 263 VAL CA C sing N N 264 VAL CA CB sing N N 265 VAL CA HA sing N N 266 VAL C O doub N N 267 VAL C OXT sing N N 268 VAL CB CG1 sing N N 269 VAL CB CG2 sing N N 270 VAL CB HB sing N N 271 VAL CG1 HG11 sing N N 272 VAL CG1 HG12 sing N N 273 VAL CG1 HG13 sing N N 274 VAL CG2 HG21 sing N N 275 VAL CG2 HG22 sing N N 276 VAL CG2 HG23 sing N N 277 VAL OXT HXT sing N N 278 # _pdbx_audit_support.funding_organization 'National Research Foundation (NRF, Korea)' _pdbx_audit_support.country 'Korea, Republic Of' _pdbx_audit_support.grant_number S201903S00006 _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 6LVT _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_