data_6LVU # _entry.id 6LVU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6LVU pdb_00006lvu 10.2210/pdb6lvu/pdb WWPDB D_1300015584 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6LVU _pdbx_database_status.recvd_initial_deposition_date 2020-02-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lee, Y.' 1 0000-0002-9156-6477 'Lee, W.C.' 2 0000-0002-5500-9518 'Kim, Y.' 3 0000-0001-6438-4718 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Int J Mol Sci' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1422-0067 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 21 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural Characterization of an ACP fromThermotoga maritima: Insights into Hyperthermal Adaptation.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/ijms21072600 _citation.pdbx_database_id_PubMed 32283632 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lee, Y.' 1 ? primary 'Jang, A.' 2 ? primary 'Jeong, M.C.' 3 ? primary 'Park, N.' 4 ? primary 'Park, J.' 5 ? primary 'Lee, W.C.' 6 ? primary 'Cheong, C.' 7 ? primary 'Kim, Y.' 8 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6LVU _cell.details ? _cell.formula_units_Z ? _cell.length_a 23.834 _cell.length_a_esd ? _cell.length_b 61.955 _cell.length_b_esd ? _cell.length_c 95.724 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6LVU _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Acyl carrier protein' 8905.988 2 ? ? ACP ? 2 non-polymer syn 'ZINC ION' 65.409 9 ? ? ? ? 3 water nat water 18.015 17 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ACP # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MASREEIFSKVKSIISEKLGVDESQVTEEAKLIDDLGADSLDLVDLVMDFESEFGVKVDDADLEKISTVGDIVSYIEKKL G ; _entity_poly.pdbx_seq_one_letter_code_can ;MASREEIFSKVKSIISEKLGVDESQVTEEAKLIDDLGADSLDLVDLVMDFESEFGVKVDDADLEKISTVGDIVSYIEKKL G ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 SER n 1 4 ARG n 1 5 GLU n 1 6 GLU n 1 7 ILE n 1 8 PHE n 1 9 SER n 1 10 LYS n 1 11 VAL n 1 12 LYS n 1 13 SER n 1 14 ILE n 1 15 ILE n 1 16 SER n 1 17 GLU n 1 18 LYS n 1 19 LEU n 1 20 GLY n 1 21 VAL n 1 22 ASP n 1 23 GLU n 1 24 SER n 1 25 GLN n 1 26 VAL n 1 27 THR n 1 28 GLU n 1 29 GLU n 1 30 ALA n 1 31 LYS n 1 32 LEU n 1 33 ILE n 1 34 ASP n 1 35 ASP n 1 36 LEU n 1 37 GLY n 1 38 ALA n 1 39 ASP n 1 40 SER n 1 41 LEU n 1 42 ASP n 1 43 LEU n 1 44 VAL n 1 45 ASP n 1 46 LEU n 1 47 VAL n 1 48 MET n 1 49 ASP n 1 50 PHE n 1 51 GLU n 1 52 SER n 1 53 GLU n 1 54 PHE n 1 55 GLY n 1 56 VAL n 1 57 LYS n 1 58 VAL n 1 59 ASP n 1 60 ASP n 1 61 ALA n 1 62 ASP n 1 63 LEU n 1 64 GLU n 1 65 LYS n 1 66 ILE n 1 67 SER n 1 68 THR n 1 69 VAL n 1 70 GLY n 1 71 ASP n 1 72 ILE n 1 73 VAL n 1 74 SER n 1 75 TYR n 1 76 ILE n 1 77 GLU n 1 78 LYS n 1 79 LYS n 1 80 LEU n 1 81 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 81 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene acpP _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain MSB8 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermotoga maritima MSB8' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 243274 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 43589 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET11a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ACP_THEMA _struct_ref.pdbx_db_accession Q9WZD0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MASREEIFSKVKSIISEKLGVDESQVTEEAKLIDDLGADSLDLVDLVMDFESEFGVKVDDADLEKISTVGDIVSYIEKKL G ; _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6LVU A 1 ? 81 ? Q9WZD0 1 ? 81 ? 1 81 2 1 6LVU B 1 ? 81 ? Q9WZD0 1 ? 81 ? 1 81 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6LVU _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.98 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 38.00 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.4 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M zinc acetate dihydrate, 20% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 270' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-02-25 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 7A (6B, 6C1)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '7A (6B, 6C1)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate 20.070 _reflns.entry_id 6LVU _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.2940 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6764 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.300 _reflns.pdbx_Rmerge_I_obs 0.081 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 22.800 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 3.869 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.088 _reflns.pdbx_Rpim_I_all 0.032 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.300 2.380 ? ? ? ? ? ? 685 99.700 ? ? ? ? 0.201 ? ? ? ? ? ? ? ? 7.100 ? 3.183 ? ? 0.218 0.082 ? 1 1 0.992 ? ? 2.380 2.480 ? ? ? ? ? ? 635 100.000 ? ? ? ? 0.183 ? ? ? ? ? ? ? ? 7.900 ? 3.408 ? ? 0.196 0.070 ? 2 1 0.995 ? ? 2.480 2.590 ? ? ? ? ? ? 661 100.000 ? ? ? ? 0.147 ? ? ? ? ? ? ? ? 7.700 ? 3.396 ? ? 0.158 0.057 ? 3 1 0.995 ? ? 2.590 2.730 ? ? ? ? ? ? 662 99.500 ? ? ? ? 0.126 ? ? ? ? ? ? ? ? 7.700 ? 3.623 ? ? 0.135 0.049 ? 4 1 0.995 ? ? 2.730 2.900 ? ? ? ? ? ? 673 99.900 ? ? ? ? 0.111 ? ? ? ? ? ? ? ? 7.700 ? 3.716 ? ? 0.119 0.042 ? 5 1 0.997 ? ? 2.900 3.120 ? ? ? ? ? ? 666 99.900 ? ? ? ? 0.094 ? ? ? ? ? ? ? ? 7.700 ? 3.900 ? ? 0.100 0.035 ? 6 1 0.998 ? ? 3.120 3.440 ? ? ? ? ? ? 692 99.600 ? ? ? ? 0.074 ? ? ? ? ? ? ? ? 7.400 ? 4.186 ? ? 0.079 0.029 ? 7 1 0.997 ? ? 3.440 3.930 ? ? ? ? ? ? 681 99.900 ? ? ? ? 0.063 ? ? ? ? ? ? ? ? 7.200 ? 4.447 ? ? 0.068 0.025 ? 8 1 0.998 ? ? 3.930 4.950 ? ? ? ? ? ? 701 99.700 ? ? ? ? 0.056 ? ? ? ? ? ? ? ? 6.800 ? 4.438 ? ? 0.061 0.023 ? 9 1 0.998 ? ? 4.950 10 ? ? ? ? ? ? 708 92.400 ? ? ? ? 0.054 ? ? ? ? ? ? ? ? 6.100 ? 4.548 ? ? 0.058 0.022 ? 10 1 0.998 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 70.240 _refine.B_iso_mean 27.4444 _refine.B_iso_min 9.360 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6LVU _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.2940 _refine.ls_d_res_low 28.3670 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6697 _refine.ls_number_reflns_R_free 671 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.1800 _refine.ls_percent_reflns_R_free 10.0200 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2280 _refine.ls_R_factor_R_free 0.2841 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2217 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2EHS _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 33.5500 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2100 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.2940 _refine_hist.d_res_low 28.3670 _refine_hist.number_atoms_solvent 17 _refine_hist.number_atoms_total 1236 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 156 _refine_hist.pdbx_B_iso_mean_ligand 40.01 _refine_hist.pdbx_B_iso_mean_solvent 27.95 _refine_hist.pdbx_number_atoms_protein 1210 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 9 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 1216 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.086 ? 1632 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.054 ? 200 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 208 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 4.329 ? 758 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 738 9.023 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 738 9.023 ? 1 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2944 2.4714 . . 128 1154 97.0000 . . . 0.2762 0.0000 0.2104 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4714 2.7199 . . 132 1186 99.0000 . . . 0.2543 0.0000 0.2144 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7199 3.1131 . . 134 1198 99.0000 . . . 0.3461 0.0000 0.2378 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1131 3.9205 . . 139 1235 99.0000 . . . 0.2828 0.0000 0.2123 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.9205 10 . . 138 1253 96.0000 . . . 0.2709 0.0000 0.2286 . . . . . . . . . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 'chain A' 1 2 'chain B' # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A SER 3 . A LEU 80 . A SER 3 A LEU 80 ? 'chain A' 1 2 1 B SER 3 . B LEU 80 . B SER 3 B LEU 80 ? 'chain B' # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 6LVU _struct.title 'Crystal structure of apo acyl carrier protein from Thermotoga maritima' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6LVU _struct_keywords.text 'acyl carrier protein, BIOSYNTHETIC PROTEIN' _struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? I N N 2 ? J N N 2 ? K N N 2 ? L N N 3 ? M N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 3 ? GLY A 20 ? SER A 3 GLY A 20 1 ? 18 HELX_P HELX_P2 AA2 ASP A 22 ? VAL A 26 ? ASP A 22 VAL A 26 5 ? 5 HELX_P HELX_P3 AA3 LEU A 41 ? GLY A 55 ? LEU A 41 GLY A 55 1 ? 15 HELX_P HELX_P4 AA4 ASP A 60 ? GLU A 64 ? ASP A 60 GLU A 64 5 ? 5 HELX_P HELX_P5 AA5 THR A 68 ? LEU A 80 ? THR A 68 LEU A 80 1 ? 13 HELX_P HELX_P6 AA6 ARG B 4 ? GLY B 20 ? ARG B 4 GLY B 20 1 ? 17 HELX_P HELX_P7 AA7 ASP B 22 ? VAL B 26 ? ASP B 22 VAL B 26 5 ? 5 HELX_P HELX_P8 AA8 LEU B 41 ? GLY B 55 ? LEU B 41 GLY B 55 1 ? 15 HELX_P HELX_P9 AA9 ASP B 60 ? GLU B 64 ? ASP B 60 GLU B 64 5 ? 5 HELX_P HELX_P10 AB1 THR B 68 ? LEU B 80 ? THR B 68 LEU B 80 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A SER 3 OG ? ? ? 1_555 K ZN . ZN ? ? A SER 3 B ZN 105 1_655 ? ? ? ? ? ? ? 2.523 ? ? metalc2 metalc ? ? A GLU 5 OE2 ? ? ? 1_555 G ZN . ZN ? ? A GLU 5 B ZN 101 1_655 ? ? ? ? ? ? ? 2.187 ? ? metalc3 metalc ? ? A GLU 17 OE1 ? ? ? 1_555 D ZN . ZN ? ? A GLU 17 A ZN 102 1_555 ? ? ? ? ? ? ? 2.432 ? ? metalc4 metalc ? ? A GLU 17 OE2 ? ? ? 1_555 D ZN . ZN ? ? A GLU 17 A ZN 102 1_555 ? ? ? ? ? ? ? 2.007 ? ? metalc5 metalc ? ? A GLU 23 OE1 ? ? ? 1_555 F ZN . ZN ? ? A GLU 23 A ZN 104 1_555 ? ? ? ? ? ? ? 2.533 ? ? metalc6 metalc ? ? A ASP 39 OD2 ? ? ? 1_555 J ZN . ZN ? ? A ASP 39 B ZN 104 2_454 ? ? ? ? ? ? ? 2.037 ? ? metalc7 metalc ? ? A ASP 42 OD1 ? ? ? 1_555 J ZN . ZN ? ? A ASP 42 B ZN 104 2_454 ? ? ? ? ? ? ? 1.980 ? ? metalc8 metalc ? ? A ASP 45 OD2 ? ? ? 1_555 E ZN . ZN ? ? A ASP 45 A ZN 103 1_555 ? ? ? ? ? ? ? 2.489 ? ? metalc9 metalc ? ? A ASP 49 OD1 ? ? ? 1_555 E ZN . ZN ? ? A ASP 49 A ZN 103 1_555 ? ? ? ? ? ? ? 2.114 ? ? metalc10 metalc ? ? A GLU 53 OE1 ? ? ? 1_555 C ZN . ZN ? ? A GLU 53 A ZN 101 1_555 ? ? ? ? ? ? ? 2.093 ? ? metalc11 metalc ? ? A ASP 71 OD1 ? ? ? 1_555 D ZN . ZN ? ? A ASP 71 A ZN 102 1_655 ? ? ? ? ? ? ? 2.192 ? ? metalc12 metalc ? ? C ZN . ZN ? ? ? 1_555 L HOH . O ? ? A ZN 101 A HOH 208 1_555 ? ? ? ? ? ? ? 2.240 ? ? metalc13 metalc ? ? C ZN . ZN ? ? ? 1_555 B GLU 5 OE1 ? ? A ZN 101 B GLU 5 1_555 ? ? ? ? ? ? ? 2.162 ? ? metalc14 metalc ? ? D ZN . ZN ? ? ? 1_555 L HOH . O ? ? A ZN 102 A HOH 209 1_455 ? ? ? ? ? ? ? 2.643 ? ? metalc15 metalc ? ? E ZN . ZN ? ? ? 1_555 L HOH . O ? ? A ZN 103 A HOH 202 1_555 ? ? ? ? ? ? ? 2.301 ? ? metalc16 metalc ? ? F ZN . ZN ? ? ? 1_555 L HOH . O ? ? A ZN 104 A HOH 204 1_555 ? ? ? ? ? ? ? 2.504 ? ? metalc17 metalc ? ? F ZN . ZN ? ? ? 1_555 L HOH . O ? ? A ZN 104 A HOH 207 1_555 ? ? ? ? ? ? ? 2.285 ? ? metalc18 metalc ? ? F ZN . ZN ? ? ? 1_555 M HOH . O ? ? A ZN 104 B HOH 203 1_555 ? ? ? ? ? ? ? 2.118 ? ? metalc19 metalc ? ? L HOH . O ? ? ? 2_455 J ZN . ZN ? ? A HOH 201 B ZN 104 1_555 ? ? ? ? ? ? ? 2.414 ? ? metalc20 metalc ? ? L HOH . O ? ? ? 1_455 K ZN . ZN ? ? A HOH 203 B ZN 105 1_555 ? ? ? ? ? ? ? 2.155 ? ? metalc21 metalc ? ? L HOH . O ? ? ? 1_455 K ZN . ZN ? ? A HOH 206 B ZN 105 1_555 ? ? ? ? ? ? ? 2.259 ? ? metalc22 metalc ? ? B GLU 17 OE1 ? ? ? 1_555 H ZN . ZN ? ? B GLU 17 B ZN 102 1_555 ? ? ? ? ? ? ? 2.477 ? ? metalc23 metalc ? ? B GLU 17 OE2 ? ? ? 1_555 H ZN . ZN ? ? B GLU 17 B ZN 102 1_555 ? ? ? ? ? ? ? 2.067 ? ? metalc24 metalc ? ? B GLU 23 OE1 ? ? ? 1_555 K ZN . ZN ? ? B GLU 23 B ZN 105 1_555 ? ? ? ? ? ? ? 2.485 ? ? metalc25 metalc ? ? B ASP 39 OD2 ? ? ? 1_555 J ZN . ZN ? ? B ASP 39 B ZN 104 1_555 ? ? ? ? ? ? ? 2.174 ? ? metalc26 metalc ? ? B ASP 42 OD1 ? ? ? 1_555 J ZN . ZN ? ? B ASP 42 B ZN 104 1_555 ? ? ? ? ? ? ? 2.015 ? ? metalc27 metalc ? ? B ASP 45 OD1 ? ? ? 1_555 I ZN . ZN ? ? B ASP 45 B ZN 103 1_555 ? ? ? ? ? ? ? 2.536 ? ? metalc28 metalc ? ? B ASP 49 OD1 ? ? ? 1_555 I ZN . ZN ? ? B ASP 49 B ZN 103 1_555 ? ? ? ? ? ? ? 2.257 ? ? metalc29 metalc ? ? B GLU 53 OE1 ? ? ? 1_555 G ZN . ZN ? ? B GLU 53 B ZN 101 1_555 ? ? ? ? ? ? ? 2.170 ? ? metalc30 metalc ? ? B ASP 71 OD2 ? ? ? 1_555 H ZN . ZN ? ? B ASP 71 B ZN 102 1_655 ? ? ? ? ? ? ? 2.131 ? ? metalc31 metalc ? ? H ZN . ZN ? ? ? 1_555 M HOH . O ? ? B ZN 102 B HOH 204 1_455 ? ? ? ? ? ? ? 1.897 ? ? metalc32 metalc ? ? I ZN . ZN ? ? ? 1_555 M HOH . O ? ? B ZN 103 B HOH 202 1_555 ? ? ? ? ? ? ? 2.352 ? ? metalc33 metalc ? ? K ZN . ZN ? ? ? 1_555 M HOH . O ? ? B ZN 105 B HOH 201 1_555 ? ? ? ? ? ? ? 2.536 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 101 ? 4 'binding site for residue ZN A 101' AC2 Software A ZN 102 ? 3 'binding site for residue ZN A 102' AC3 Software A ZN 103 ? 3 'binding site for residue ZN A 103' AC4 Software A ZN 104 ? 4 'binding site for residue ZN A 104' AC5 Software B ZN 101 ? 3 'binding site for residue ZN B 101' AC6 Software B ZN 102 ? 4 'binding site for residue ZN B 102' AC7 Software B ZN 103 ? 3 'binding site for residue ZN B 103' AC8 Software B ZN 104 ? 5 'binding site for residue ZN B 104' AC9 Software B ZN 105 ? 6 'binding site for residue ZN B 105' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 GLU A 53 ? GLU A 53 . ? 1_555 ? 2 AC1 4 HOH L . ? HOH A 208 . ? 1_555 ? 3 AC1 4 HOH L . ? HOH A 209 . ? 1_455 ? 4 AC1 4 GLU B 5 ? GLU B 5 . ? 1_555 ? 5 AC2 3 GLU A 17 ? GLU A 17 . ? 1_555 ? 6 AC2 3 ASP A 71 ? ASP A 71 . ? 1_455 ? 7 AC2 3 HOH L . ? HOH A 209 . ? 1_455 ? 8 AC3 3 ASP A 45 ? ASP A 45 . ? 1_555 ? 9 AC3 3 ASP A 49 ? ASP A 49 . ? 1_555 ? 10 AC3 3 HOH L . ? HOH A 202 . ? 1_555 ? 11 AC4 4 GLU A 23 ? GLU A 23 . ? 1_555 ? 12 AC4 4 HOH L . ? HOH A 204 . ? 1_555 ? 13 AC4 4 HOH L . ? HOH A 207 . ? 1_555 ? 14 AC4 4 HOH M . ? HOH B 203 . ? 1_555 ? 15 AC5 3 GLU A 5 ? GLU A 5 . ? 1_455 ? 16 AC5 3 GLU B 53 ? GLU B 53 . ? 1_555 ? 17 AC5 3 HOH M . ? HOH B 208 . ? 1_455 ? 18 AC6 4 GLU B 17 ? GLU B 17 . ? 1_555 ? 19 AC6 4 ASP B 71 ? ASP B 71 . ? 1_455 ? 20 AC6 4 HOH M . ? HOH B 204 . ? 1_455 ? 21 AC6 4 HOH M . ? HOH B 208 . ? 1_455 ? 22 AC7 3 ASP B 45 ? ASP B 45 . ? 1_555 ? 23 AC7 3 ASP B 49 ? ASP B 49 . ? 1_555 ? 24 AC7 3 HOH M . ? HOH B 202 . ? 1_555 ? 25 AC8 5 ASP A 39 ? ASP A 39 . ? 2_455 ? 26 AC8 5 ASP A 42 ? ASP A 42 . ? 2_455 ? 27 AC8 5 HOH L . ? HOH A 201 . ? 2_455 ? 28 AC8 5 ASP B 39 ? ASP B 39 . ? 1_555 ? 29 AC8 5 ASP B 42 ? ASP B 42 . ? 1_555 ? 30 AC9 6 SER A 3 ? SER A 3 . ? 1_455 ? 31 AC9 6 HOH L . ? HOH A 203 . ? 1_455 ? 32 AC9 6 HOH L . ? HOH A 206 . ? 1_455 ? 33 AC9 6 LYS B 12 ? LYS B 12 . ? 1_555 ? 34 AC9 6 GLU B 23 ? GLU B 23 . ? 1_555 ? 35 AC9 6 HOH M . ? HOH B 201 . ? 1_555 ? # _atom_sites.entry_id 6LVU _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.041957 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016141 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010447 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 GLY 81 81 ? ? ? A . n B 1 1 MET 1 1 ? ? ? B . n B 1 2 ALA 2 2 ? ? ? B . n B 1 3 SER 3 3 3 SER SER B . n B 1 4 ARG 4 4 4 ARG ARG B . n B 1 5 GLU 5 5 5 GLU GLU B . n B 1 6 GLU 6 6 6 GLU GLU B . n B 1 7 ILE 7 7 7 ILE ILE B . n B 1 8 PHE 8 8 8 PHE PHE B . n B 1 9 SER 9 9 9 SER SER B . n B 1 10 LYS 10 10 10 LYS LYS B . n B 1 11 VAL 11 11 11 VAL VAL B . n B 1 12 LYS 12 12 12 LYS LYS B . n B 1 13 SER 13 13 13 SER SER B . n B 1 14 ILE 14 14 14 ILE ILE B . n B 1 15 ILE 15 15 15 ILE ILE B . n B 1 16 SER 16 16 16 SER SER B . n B 1 17 GLU 17 17 17 GLU GLU B . n B 1 18 LYS 18 18 18 LYS LYS B . n B 1 19 LEU 19 19 19 LEU LEU B . n B 1 20 GLY 20 20 20 GLY GLY B . n B 1 21 VAL 21 21 21 VAL VAL B . n B 1 22 ASP 22 22 22 ASP ASP B . n B 1 23 GLU 23 23 23 GLU GLU B . n B 1 24 SER 24 24 24 SER SER B . n B 1 25 GLN 25 25 25 GLN GLN B . n B 1 26 VAL 26 26 26 VAL VAL B . n B 1 27 THR 27 27 27 THR THR B . n B 1 28 GLU 28 28 28 GLU GLU B . n B 1 29 GLU 29 29 29 GLU GLU B . n B 1 30 ALA 30 30 30 ALA ALA B . n B 1 31 LYS 31 31 31 LYS LYS B . n B 1 32 LEU 32 32 32 LEU LEU B . n B 1 33 ILE 33 33 33 ILE ILE B . n B 1 34 ASP 34 34 34 ASP ASP B . n B 1 35 ASP 35 35 35 ASP ASP B . n B 1 36 LEU 36 36 36 LEU LEU B . n B 1 37 GLY 37 37 37 GLY GLY B . n B 1 38 ALA 38 38 38 ALA ALA B . n B 1 39 ASP 39 39 39 ASP ASP B . n B 1 40 SER 40 40 40 SER SER B . n B 1 41 LEU 41 41 41 LEU LEU B . n B 1 42 ASP 42 42 42 ASP ASP B . n B 1 43 LEU 43 43 43 LEU LEU B . n B 1 44 VAL 44 44 44 VAL VAL B . n B 1 45 ASP 45 45 45 ASP ASP B . n B 1 46 LEU 46 46 46 LEU LEU B . n B 1 47 VAL 47 47 47 VAL VAL B . n B 1 48 MET 48 48 48 MET MET B . n B 1 49 ASP 49 49 49 ASP ASP B . n B 1 50 PHE 50 50 50 PHE PHE B . n B 1 51 GLU 51 51 51 GLU GLU B . n B 1 52 SER 52 52 52 SER SER B . n B 1 53 GLU 53 53 53 GLU GLU B . n B 1 54 PHE 54 54 54 PHE PHE B . n B 1 55 GLY 55 55 55 GLY GLY B . n B 1 56 VAL 56 56 56 VAL VAL B . n B 1 57 LYS 57 57 57 LYS LYS B . n B 1 58 VAL 58 58 58 VAL VAL B . n B 1 59 ASP 59 59 59 ASP ASP B . n B 1 60 ASP 60 60 60 ASP ASP B . n B 1 61 ALA 61 61 61 ALA ALA B . n B 1 62 ASP 62 62 62 ASP ASP B . n B 1 63 LEU 63 63 63 LEU LEU B . n B 1 64 GLU 64 64 64 GLU GLU B . n B 1 65 LYS 65 65 65 LYS LYS B . n B 1 66 ILE 66 66 66 ILE ILE B . n B 1 67 SER 67 67 67 SER SER B . n B 1 68 THR 68 68 68 THR THR B . n B 1 69 VAL 69 69 69 VAL VAL B . n B 1 70 GLY 70 70 70 GLY GLY B . n B 1 71 ASP 71 71 71 ASP ASP B . n B 1 72 ILE 72 72 72 ILE ILE B . n B 1 73 VAL 73 73 73 VAL VAL B . n B 1 74 SER 74 74 74 SER SER B . n B 1 75 TYR 75 75 75 TYR TYR B . n B 1 76 ILE 76 76 76 ILE ILE B . n B 1 77 GLU 77 77 77 GLU GLU B . n B 1 78 LYS 78 78 78 LYS LYS B . n B 1 79 LYS 79 79 79 LYS LYS B . n B 1 80 LEU 80 80 80 LEU LEU B . n B 1 81 GLY 81 81 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 ZN 1 101 3 ZN ZN A . D 2 ZN 1 102 4 ZN ZN A . E 2 ZN 1 103 7 ZN ZN A . F 2 ZN 1 104 9 ZN ZN A . G 2 ZN 1 101 1 ZN ZN B . H 2 ZN 1 102 2 ZN ZN B . I 2 ZN 1 103 5 ZN ZN B . J 2 ZN 1 104 6 ZN ZN B . K 2 ZN 1 105 8 ZN ZN B . L 3 HOH 1 201 14 HOH HOH A . L 3 HOH 2 202 10 HOH HOH A . L 3 HOH 3 203 6 HOH HOH A . L 3 HOH 4 204 8 HOH HOH A . L 3 HOH 5 205 16 HOH HOH A . L 3 HOH 6 206 7 HOH HOH A . L 3 HOH 7 207 17 HOH HOH A . L 3 HOH 8 208 20 HOH HOH A . L 3 HOH 9 209 9 HOH HOH A . M 3 HOH 1 201 3 HOH HOH B . M 3 HOH 2 202 13 HOH HOH B . M 3 HOH 3 203 11 HOH HOH B . M 3 HOH 4 204 19 HOH HOH B . M 3 HOH 5 205 12 HOH HOH B . M 3 HOH 6 206 18 HOH HOH B . M 3 HOH 7 207 15 HOH HOH B . M 3 HOH 8 208 1 HOH HOH B . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 author_defined_assembly ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C,D,E,F,L 2 1 B,G,H,I,J,K,M # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OG ? A SER 3 ? A SER 3 ? 1_555 ZN ? K ZN . ? B ZN 105 ? 1_655 O ? L HOH . ? A HOH 203 ? 1_455 48.3 ? 2 OG ? A SER 3 ? A SER 3 ? 1_555 ZN ? K ZN . ? B ZN 105 ? 1_655 O ? L HOH . ? A HOH 206 ? 1_455 52.1 ? 3 O ? L HOH . ? A HOH 203 ? 1_455 ZN ? K ZN . ? B ZN 105 ? 1_655 O ? L HOH . ? A HOH 206 ? 1_455 3.9 ? 4 OG ? A SER 3 ? A SER 3 ? 1_555 ZN ? K ZN . ? B ZN 105 ? 1_655 OE1 ? B GLU 23 ? B GLU 23 ? 1_555 54.5 ? 5 O ? L HOH . ? A HOH 203 ? 1_455 ZN ? K ZN . ? B ZN 105 ? 1_655 OE1 ? B GLU 23 ? B GLU 23 ? 1_555 8.7 ? 6 O ? L HOH . ? A HOH 206 ? 1_455 ZN ? K ZN . ? B ZN 105 ? 1_655 OE1 ? B GLU 23 ? B GLU 23 ? 1_555 5.9 ? 7 OG ? A SER 3 ? A SER 3 ? 1_555 ZN ? K ZN . ? B ZN 105 ? 1_655 O ? M HOH . ? B HOH 201 ? 1_555 46.4 ? 8 O ? L HOH . ? A HOH 203 ? 1_455 ZN ? K ZN . ? B ZN 105 ? 1_655 O ? M HOH . ? B HOH 201 ? 1_555 7.8 ? 9 O ? L HOH . ? A HOH 206 ? 1_455 ZN ? K ZN . ? B ZN 105 ? 1_655 O ? M HOH . ? B HOH 201 ? 1_555 9.0 ? 10 OE1 ? B GLU 23 ? B GLU 23 ? 1_555 ZN ? K ZN . ? B ZN 105 ? 1_655 O ? M HOH . ? B HOH 201 ? 1_555 8.3 ? 11 OE2 ? A GLU 5 ? A GLU 5 ? 1_555 ZN ? G ZN . ? B ZN 101 ? 1_655 OE1 ? B GLU 53 ? B GLU 53 ? 1_555 104.0 ? 12 OE1 ? A GLU 17 ? A GLU 17 ? 1_555 ZN ? D ZN . ? A ZN 102 ? 1_555 OE2 ? A GLU 17 ? A GLU 17 ? 1_555 58.2 ? 13 OE1 ? A GLU 17 ? A GLU 17 ? 1_555 ZN ? D ZN . ? A ZN 102 ? 1_555 OD1 ? A ASP 71 ? A ASP 71 ? 1_555 98.6 ? 14 OE2 ? A GLU 17 ? A GLU 17 ? 1_555 ZN ? D ZN . ? A ZN 102 ? 1_555 OD1 ? A ASP 71 ? A ASP 71 ? 1_555 78.2 ? 15 OE1 ? A GLU 17 ? A GLU 17 ? 1_555 ZN ? D ZN . ? A ZN 102 ? 1_555 O ? L HOH . ? A HOH 209 ? 1_455 106.3 ? 16 OE2 ? A GLU 17 ? A GLU 17 ? 1_555 ZN ? D ZN . ? A ZN 102 ? 1_555 O ? L HOH . ? A HOH 209 ? 1_455 136.0 ? 17 OD1 ? A ASP 71 ? A ASP 71 ? 1_555 ZN ? D ZN . ? A ZN 102 ? 1_555 O ? L HOH . ? A HOH 209 ? 1_455 62.9 ? 18 OE1 ? A GLU 23 ? A GLU 23 ? 1_555 ZN ? F ZN . ? A ZN 104 ? 1_555 O ? L HOH . ? A HOH 204 ? 1_555 79.9 ? 19 OE1 ? A GLU 23 ? A GLU 23 ? 1_555 ZN ? F ZN . ? A ZN 104 ? 1_555 O ? L HOH . ? A HOH 207 ? 1_555 90.6 ? 20 O ? L HOH . ? A HOH 204 ? 1_555 ZN ? F ZN . ? A ZN 104 ? 1_555 O ? L HOH . ? A HOH 207 ? 1_555 164.5 ? 21 OE1 ? A GLU 23 ? A GLU 23 ? 1_555 ZN ? F ZN . ? A ZN 104 ? 1_555 O ? M HOH . ? B HOH 203 ? 1_555 106.5 ? 22 O ? L HOH . ? A HOH 204 ? 1_555 ZN ? F ZN . ? A ZN 104 ? 1_555 O ? M HOH . ? B HOH 203 ? 1_555 88.7 ? 23 O ? L HOH . ? A HOH 207 ? 1_555 ZN ? F ZN . ? A ZN 104 ? 1_555 O ? M HOH . ? B HOH 203 ? 1_555 105.9 ? 24 OD2 ? A ASP 39 ? A ASP 39 ? 1_555 ZN ? J ZN . ? B ZN 104 ? 2_454 OD1 ? A ASP 42 ? A ASP 42 ? 1_555 107.4 ? 25 OD2 ? A ASP 39 ? A ASP 39 ? 1_555 ZN ? J ZN . ? B ZN 104 ? 2_454 O ? L HOH . ? A HOH 201 ? 2_455 115.6 ? 26 OD1 ? A ASP 42 ? A ASP 42 ? 1_555 ZN ? J ZN . ? B ZN 104 ? 2_454 O ? L HOH . ? A HOH 201 ? 2_455 27.3 ? 27 OD2 ? A ASP 39 ? A ASP 39 ? 1_555 ZN ? J ZN . ? B ZN 104 ? 2_454 OD2 ? B ASP 39 ? B ASP 39 ? 1_555 113.5 ? 28 OD1 ? A ASP 42 ? A ASP 42 ? 1_555 ZN ? J ZN . ? B ZN 104 ? 2_454 OD2 ? B ASP 39 ? B ASP 39 ? 1_555 26.9 ? 29 O ? L HOH . ? A HOH 201 ? 2_455 ZN ? J ZN . ? B ZN 104 ? 2_454 OD2 ? B ASP 39 ? B ASP 39 ? 1_555 2.1 ? 30 OD2 ? A ASP 39 ? A ASP 39 ? 1_555 ZN ? J ZN . ? B ZN 104 ? 2_454 OD1 ? B ASP 42 ? B ASP 42 ? 1_555 114.2 ? 31 OD1 ? A ASP 42 ? A ASP 42 ? 1_555 ZN ? J ZN . ? B ZN 104 ? 2_454 OD1 ? B ASP 42 ? B ASP 42 ? 1_555 29.9 ? 32 O ? L HOH . ? A HOH 201 ? 2_455 ZN ? J ZN . ? B ZN 104 ? 2_454 OD1 ? B ASP 42 ? B ASP 42 ? 1_555 3.2 ? 33 OD2 ? B ASP 39 ? B ASP 39 ? 1_555 ZN ? J ZN . ? B ZN 104 ? 2_454 OD1 ? B ASP 42 ? B ASP 42 ? 1_555 3.1 ? 34 OD2 ? A ASP 45 ? A ASP 45 ? 1_555 ZN ? E ZN . ? A ZN 103 ? 1_555 OD1 ? A ASP 49 ? A ASP 49 ? 1_555 147.8 ? 35 OD2 ? A ASP 45 ? A ASP 45 ? 1_555 ZN ? E ZN . ? A ZN 103 ? 1_555 O ? L HOH . ? A HOH 202 ? 1_555 92.7 ? 36 OD1 ? A ASP 49 ? A ASP 49 ? 1_555 ZN ? E ZN . ? A ZN 103 ? 1_555 O ? L HOH . ? A HOH 202 ? 1_555 94.8 ? 37 OE1 ? A GLU 53 ? A GLU 53 ? 1_555 ZN ? C ZN . ? A ZN 101 ? 1_555 O ? L HOH . ? A HOH 208 ? 1_555 110.1 ? 38 OE1 ? A GLU 53 ? A GLU 53 ? 1_555 ZN ? C ZN . ? A ZN 101 ? 1_555 OE1 ? B GLU 5 ? B GLU 5 ? 1_555 81.2 ? 39 O ? L HOH . ? A HOH 208 ? 1_555 ZN ? C ZN . ? A ZN 101 ? 1_555 OE1 ? B GLU 5 ? B GLU 5 ? 1_555 123.1 ? 40 OE1 ? B GLU 17 ? B GLU 17 ? 1_555 ZN ? H ZN . ? B ZN 102 ? 1_555 OE2 ? B GLU 17 ? B GLU 17 ? 1_555 57.4 ? 41 OE1 ? B GLU 17 ? B GLU 17 ? 1_555 ZN ? H ZN . ? B ZN 102 ? 1_555 OD2 ? B ASP 71 ? B ASP 71 ? 1_555 97.4 ? 42 OE2 ? B GLU 17 ? B GLU 17 ? 1_555 ZN ? H ZN . ? B ZN 102 ? 1_555 OD2 ? B ASP 71 ? B ASP 71 ? 1_555 74.3 ? 43 OE1 ? B GLU 17 ? B GLU 17 ? 1_555 ZN ? H ZN . ? B ZN 102 ? 1_555 O ? M HOH . ? B HOH 204 ? 1_455 149.4 ? 44 OE2 ? B GLU 17 ? B GLU 17 ? 1_555 ZN ? H ZN . ? B ZN 102 ? 1_555 O ? M HOH . ? B HOH 204 ? 1_455 93.6 ? 45 OD2 ? B ASP 71 ? B ASP 71 ? 1_555 ZN ? H ZN . ? B ZN 102 ? 1_555 O ? M HOH . ? B HOH 204 ? 1_455 82.3 ? 46 OD1 ? B ASP 45 ? B ASP 45 ? 1_555 ZN ? I ZN . ? B ZN 103 ? 1_555 OD1 ? B ASP 49 ? B ASP 49 ? 1_555 139.2 ? 47 OD1 ? B ASP 45 ? B ASP 45 ? 1_555 ZN ? I ZN . ? B ZN 103 ? 1_555 O ? M HOH . ? B HOH 202 ? 1_555 100.5 ? 48 OD1 ? B ASP 49 ? B ASP 49 ? 1_555 ZN ? I ZN . ? B ZN 103 ? 1_555 O ? M HOH . ? B HOH 202 ? 1_555 98.1 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-04-22 2 'Structure model' 1 1 2020-04-29 3 'Structure model' 1 2 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model 7 3 'Structure model' pdbx_struct_conn_angle 8 3 'Structure model' struct_conn 9 3 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 2 'Structure model' '_citation_author.identifier_ORCID' 4 2 'Structure model' '_citation_author.name' 5 3 'Structure model' '_database_2.pdbx_DOI' 6 3 'Structure model' '_database_2.pdbx_database_accession' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_asym_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 17 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 18 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_symmetry' 19 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id' 20 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 21 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 22 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 23 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 24 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 25 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 26 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 27 3 'Structure model' '_pdbx_struct_conn_angle.value' 28 3 'Structure model' '_struct_conn.pdbx_dist_value' 29 3 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 30 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 31 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 32 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 33 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 34 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 35 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 36 3 'Structure model' '_struct_conn.ptnr1_symmetry' 37 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 38 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 39 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 40 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 41 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 42 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 43 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' 44 3 'Structure model' '_struct_conn.ptnr2_symmetry' 45 3 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 46 3 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 47 3 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 48 3 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 49 3 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 50 3 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 51 3 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 52 3 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1_2575 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 5 # _pdbx_entry_details.entry_id 6LVU _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD2 A ASP 39 ? ? O A HOH 201 ? ? 2.09 2 1 NZ B LYS 12 ? ? O B HOH 201 ? ? 2.09 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OD2 _pdbx_validate_symm_contact.auth_asym_id_1 B _pdbx_validate_symm_contact.auth_comp_id_1 ASP _pdbx_validate_symm_contact.auth_seq_id_1 39 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 201 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_455 _pdbx_validate_symm_contact.dist 2.09 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A GLY 81 ? A GLY 81 4 1 Y 1 B MET 1 ? B MET 1 5 1 Y 1 B ALA 2 ? B ALA 2 6 1 Y 1 B GLY 81 ? B GLY 81 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 GLN N N N N 57 GLN CA C N S 58 GLN C C N N 59 GLN O O N N 60 GLN CB C N N 61 GLN CG C N N 62 GLN CD C N N 63 GLN OE1 O N N 64 GLN NE2 N N N 65 GLN OXT O N N 66 GLN H H N N 67 GLN H2 H N N 68 GLN HA H N N 69 GLN HB2 H N N 70 GLN HB3 H N N 71 GLN HG2 H N N 72 GLN HG3 H N N 73 GLN HE21 H N N 74 GLN HE22 H N N 75 GLN HXT H N N 76 GLU N N N N 77 GLU CA C N S 78 GLU C C N N 79 GLU O O N N 80 GLU CB C N N 81 GLU CG C N N 82 GLU CD C N N 83 GLU OE1 O N N 84 GLU OE2 O N N 85 GLU OXT O N N 86 GLU H H N N 87 GLU H2 H N N 88 GLU HA H N N 89 GLU HB2 H N N 90 GLU HB3 H N N 91 GLU HG2 H N N 92 GLU HG3 H N N 93 GLU HE2 H N N 94 GLU HXT H N N 95 GLY N N N N 96 GLY CA C N N 97 GLY C C N N 98 GLY O O N N 99 GLY OXT O N N 100 GLY H H N N 101 GLY H2 H N N 102 GLY HA2 H N N 103 GLY HA3 H N N 104 GLY HXT H N N 105 HOH O O N N 106 HOH H1 H N N 107 HOH H2 H N N 108 ILE N N N N 109 ILE CA C N S 110 ILE C C N N 111 ILE O O N N 112 ILE CB C N S 113 ILE CG1 C N N 114 ILE CG2 C N N 115 ILE CD1 C N N 116 ILE OXT O N N 117 ILE H H N N 118 ILE H2 H N N 119 ILE HA H N N 120 ILE HB H N N 121 ILE HG12 H N N 122 ILE HG13 H N N 123 ILE HG21 H N N 124 ILE HG22 H N N 125 ILE HG23 H N N 126 ILE HD11 H N N 127 ILE HD12 H N N 128 ILE HD13 H N N 129 ILE HXT H N N 130 LEU N N N N 131 LEU CA C N S 132 LEU C C N N 133 LEU O O N N 134 LEU CB C N N 135 LEU CG C N N 136 LEU CD1 C N N 137 LEU CD2 C N N 138 LEU OXT O N N 139 LEU H H N N 140 LEU H2 H N N 141 LEU HA H N N 142 LEU HB2 H N N 143 LEU HB3 H N N 144 LEU HG H N N 145 LEU HD11 H N N 146 LEU HD12 H N N 147 LEU HD13 H N N 148 LEU HD21 H N N 149 LEU HD22 H N N 150 LEU HD23 H N N 151 LEU HXT H N N 152 LYS N N N N 153 LYS CA C N S 154 LYS C C N N 155 LYS O O N N 156 LYS CB C N N 157 LYS CG C N N 158 LYS CD C N N 159 LYS CE C N N 160 LYS NZ N N N 161 LYS OXT O N N 162 LYS H H N N 163 LYS H2 H N N 164 LYS HA H N N 165 LYS HB2 H N N 166 LYS HB3 H N N 167 LYS HG2 H N N 168 LYS HG3 H N N 169 LYS HD2 H N N 170 LYS HD3 H N N 171 LYS HE2 H N N 172 LYS HE3 H N N 173 LYS HZ1 H N N 174 LYS HZ2 H N N 175 LYS HZ3 H N N 176 LYS HXT H N N 177 MET N N N N 178 MET CA C N S 179 MET C C N N 180 MET O O N N 181 MET CB C N N 182 MET CG C N N 183 MET SD S N N 184 MET CE C N N 185 MET OXT O N N 186 MET H H N N 187 MET H2 H N N 188 MET HA H N N 189 MET HB2 H N N 190 MET HB3 H N N 191 MET HG2 H N N 192 MET HG3 H N N 193 MET HE1 H N N 194 MET HE2 H N N 195 MET HE3 H N N 196 MET HXT H N N 197 PHE N N N N 198 PHE CA C N S 199 PHE C C N N 200 PHE O O N N 201 PHE CB C N N 202 PHE CG C Y N 203 PHE CD1 C Y N 204 PHE CD2 C Y N 205 PHE CE1 C Y N 206 PHE CE2 C Y N 207 PHE CZ C Y N 208 PHE OXT O N N 209 PHE H H N N 210 PHE H2 H N N 211 PHE HA H N N 212 PHE HB2 H N N 213 PHE HB3 H N N 214 PHE HD1 H N N 215 PHE HD2 H N N 216 PHE HE1 H N N 217 PHE HE2 H N N 218 PHE HZ H N N 219 PHE HXT H N N 220 SER N N N N 221 SER CA C N S 222 SER C C N N 223 SER O O N N 224 SER CB C N N 225 SER OG O N N 226 SER OXT O N N 227 SER H H N N 228 SER H2 H N N 229 SER HA H N N 230 SER HB2 H N N 231 SER HB3 H N N 232 SER HG H N N 233 SER HXT H N N 234 THR N N N N 235 THR CA C N S 236 THR C C N N 237 THR O O N N 238 THR CB C N R 239 THR OG1 O N N 240 THR CG2 C N N 241 THR OXT O N N 242 THR H H N N 243 THR H2 H N N 244 THR HA H N N 245 THR HB H N N 246 THR HG1 H N N 247 THR HG21 H N N 248 THR HG22 H N N 249 THR HG23 H N N 250 THR HXT H N N 251 TYR N N N N 252 TYR CA C N S 253 TYR C C N N 254 TYR O O N N 255 TYR CB C N N 256 TYR CG C Y N 257 TYR CD1 C Y N 258 TYR CD2 C Y N 259 TYR CE1 C Y N 260 TYR CE2 C Y N 261 TYR CZ C Y N 262 TYR OH O N N 263 TYR OXT O N N 264 TYR H H N N 265 TYR H2 H N N 266 TYR HA H N N 267 TYR HB2 H N N 268 TYR HB3 H N N 269 TYR HD1 H N N 270 TYR HD2 H N N 271 TYR HE1 H N N 272 TYR HE2 H N N 273 TYR HH H N N 274 TYR HXT H N N 275 VAL N N N N 276 VAL CA C N S 277 VAL C C N N 278 VAL O O N N 279 VAL CB C N N 280 VAL CG1 C N N 281 VAL CG2 C N N 282 VAL OXT O N N 283 VAL H H N N 284 VAL H2 H N N 285 VAL HA H N N 286 VAL HB H N N 287 VAL HG11 H N N 288 VAL HG12 H N N 289 VAL HG13 H N N 290 VAL HG21 H N N 291 VAL HG22 H N N 292 VAL HG23 H N N 293 VAL HXT H N N 294 ZN ZN ZN N N 295 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 GLN N CA sing N N 54 GLN N H sing N N 55 GLN N H2 sing N N 56 GLN CA C sing N N 57 GLN CA CB sing N N 58 GLN CA HA sing N N 59 GLN C O doub N N 60 GLN C OXT sing N N 61 GLN CB CG sing N N 62 GLN CB HB2 sing N N 63 GLN CB HB3 sing N N 64 GLN CG CD sing N N 65 GLN CG HG2 sing N N 66 GLN CG HG3 sing N N 67 GLN CD OE1 doub N N 68 GLN CD NE2 sing N N 69 GLN NE2 HE21 sing N N 70 GLN NE2 HE22 sing N N 71 GLN OXT HXT sing N N 72 GLU N CA sing N N 73 GLU N H sing N N 74 GLU N H2 sing N N 75 GLU CA C sing N N 76 GLU CA CB sing N N 77 GLU CA HA sing N N 78 GLU C O doub N N 79 GLU C OXT sing N N 80 GLU CB CG sing N N 81 GLU CB HB2 sing N N 82 GLU CB HB3 sing N N 83 GLU CG CD sing N N 84 GLU CG HG2 sing N N 85 GLU CG HG3 sing N N 86 GLU CD OE1 doub N N 87 GLU CD OE2 sing N N 88 GLU OE2 HE2 sing N N 89 GLU OXT HXT sing N N 90 GLY N CA sing N N 91 GLY N H sing N N 92 GLY N H2 sing N N 93 GLY CA C sing N N 94 GLY CA HA2 sing N N 95 GLY CA HA3 sing N N 96 GLY C O doub N N 97 GLY C OXT sing N N 98 GLY OXT HXT sing N N 99 HOH O H1 sing N N 100 HOH O H2 sing N N 101 ILE N CA sing N N 102 ILE N H sing N N 103 ILE N H2 sing N N 104 ILE CA C sing N N 105 ILE CA CB sing N N 106 ILE CA HA sing N N 107 ILE C O doub N N 108 ILE C OXT sing N N 109 ILE CB CG1 sing N N 110 ILE CB CG2 sing N N 111 ILE CB HB sing N N 112 ILE CG1 CD1 sing N N 113 ILE CG1 HG12 sing N N 114 ILE CG1 HG13 sing N N 115 ILE CG2 HG21 sing N N 116 ILE CG2 HG22 sing N N 117 ILE CG2 HG23 sing N N 118 ILE CD1 HD11 sing N N 119 ILE CD1 HD12 sing N N 120 ILE CD1 HD13 sing N N 121 ILE OXT HXT sing N N 122 LEU N CA sing N N 123 LEU N H sing N N 124 LEU N H2 sing N N 125 LEU CA C sing N N 126 LEU CA CB sing N N 127 LEU CA HA sing N N 128 LEU C O doub N N 129 LEU C OXT sing N N 130 LEU CB CG sing N N 131 LEU CB HB2 sing N N 132 LEU CB HB3 sing N N 133 LEU CG CD1 sing N N 134 LEU CG CD2 sing N N 135 LEU CG HG sing N N 136 LEU CD1 HD11 sing N N 137 LEU CD1 HD12 sing N N 138 LEU CD1 HD13 sing N N 139 LEU CD2 HD21 sing N N 140 LEU CD2 HD22 sing N N 141 LEU CD2 HD23 sing N N 142 LEU OXT HXT sing N N 143 LYS N CA sing N N 144 LYS N H sing N N 145 LYS N H2 sing N N 146 LYS CA C sing N N 147 LYS CA CB sing N N 148 LYS CA HA sing N N 149 LYS C O doub N N 150 LYS C OXT sing N N 151 LYS CB CG sing N N 152 LYS CB HB2 sing N N 153 LYS CB HB3 sing N N 154 LYS CG CD sing N N 155 LYS CG HG2 sing N N 156 LYS CG HG3 sing N N 157 LYS CD CE sing N N 158 LYS CD HD2 sing N N 159 LYS CD HD3 sing N N 160 LYS CE NZ sing N N 161 LYS CE HE2 sing N N 162 LYS CE HE3 sing N N 163 LYS NZ HZ1 sing N N 164 LYS NZ HZ2 sing N N 165 LYS NZ HZ3 sing N N 166 LYS OXT HXT sing N N 167 MET N CA sing N N 168 MET N H sing N N 169 MET N H2 sing N N 170 MET CA C sing N N 171 MET CA CB sing N N 172 MET CA HA sing N N 173 MET C O doub N N 174 MET C OXT sing N N 175 MET CB CG sing N N 176 MET CB HB2 sing N N 177 MET CB HB3 sing N N 178 MET CG SD sing N N 179 MET CG HG2 sing N N 180 MET CG HG3 sing N N 181 MET SD CE sing N N 182 MET CE HE1 sing N N 183 MET CE HE2 sing N N 184 MET CE HE3 sing N N 185 MET OXT HXT sing N N 186 PHE N CA sing N N 187 PHE N H sing N N 188 PHE N H2 sing N N 189 PHE CA C sing N N 190 PHE CA CB sing N N 191 PHE CA HA sing N N 192 PHE C O doub N N 193 PHE C OXT sing N N 194 PHE CB CG sing N N 195 PHE CB HB2 sing N N 196 PHE CB HB3 sing N N 197 PHE CG CD1 doub Y N 198 PHE CG CD2 sing Y N 199 PHE CD1 CE1 sing Y N 200 PHE CD1 HD1 sing N N 201 PHE CD2 CE2 doub Y N 202 PHE CD2 HD2 sing N N 203 PHE CE1 CZ doub Y N 204 PHE CE1 HE1 sing N N 205 PHE CE2 CZ sing Y N 206 PHE CE2 HE2 sing N N 207 PHE CZ HZ sing N N 208 PHE OXT HXT sing N N 209 SER N CA sing N N 210 SER N H sing N N 211 SER N H2 sing N N 212 SER CA C sing N N 213 SER CA CB sing N N 214 SER CA HA sing N N 215 SER C O doub N N 216 SER C OXT sing N N 217 SER CB OG sing N N 218 SER CB HB2 sing N N 219 SER CB HB3 sing N N 220 SER OG HG sing N N 221 SER OXT HXT sing N N 222 THR N CA sing N N 223 THR N H sing N N 224 THR N H2 sing N N 225 THR CA C sing N N 226 THR CA CB sing N N 227 THR CA HA sing N N 228 THR C O doub N N 229 THR C OXT sing N N 230 THR CB OG1 sing N N 231 THR CB CG2 sing N N 232 THR CB HB sing N N 233 THR OG1 HG1 sing N N 234 THR CG2 HG21 sing N N 235 THR CG2 HG22 sing N N 236 THR CG2 HG23 sing N N 237 THR OXT HXT sing N N 238 TYR N CA sing N N 239 TYR N H sing N N 240 TYR N H2 sing N N 241 TYR CA C sing N N 242 TYR CA CB sing N N 243 TYR CA HA sing N N 244 TYR C O doub N N 245 TYR C OXT sing N N 246 TYR CB CG sing N N 247 TYR CB HB2 sing N N 248 TYR CB HB3 sing N N 249 TYR CG CD1 doub Y N 250 TYR CG CD2 sing Y N 251 TYR CD1 CE1 sing Y N 252 TYR CD1 HD1 sing N N 253 TYR CD2 CE2 doub Y N 254 TYR CD2 HD2 sing N N 255 TYR CE1 CZ doub Y N 256 TYR CE1 HE1 sing N N 257 TYR CE2 CZ sing Y N 258 TYR CE2 HE2 sing N N 259 TYR CZ OH sing N N 260 TYR OH HH sing N N 261 TYR OXT HXT sing N N 262 VAL N CA sing N N 263 VAL N H sing N N 264 VAL N H2 sing N N 265 VAL CA C sing N N 266 VAL CA CB sing N N 267 VAL CA HA sing N N 268 VAL C O doub N N 269 VAL C OXT sing N N 270 VAL CB CG1 sing N N 271 VAL CB CG2 sing N N 272 VAL CB HB sing N N 273 VAL CG1 HG11 sing N N 274 VAL CG1 HG12 sing N N 275 VAL CG1 HG13 sing N N 276 VAL CG2 HG21 sing N N 277 VAL CG2 HG22 sing N N 278 VAL CG2 HG23 sing N N 279 VAL OXT HXT sing N N 280 # _pdbx_audit_support.funding_organization 'National Research Foundation (NRF, Korea)' _pdbx_audit_support.country 'Korea, Republic Of' _pdbx_audit_support.grant_number S201903S00006 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2EHS _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #