data_6M3N # _entry.id 6M3N # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6M3N pdb_00006m3n 10.2210/pdb6m3n/pdb WWPDB D_1300015724 ? ? BMRB 36320 ? 10.13018/BMR36320 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-08-26 2 'Structure model' 1 1 2020-09-23 3 'Structure model' 1 2 2020-10-21 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 4 'Structure model' Other 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' struct_keywords 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' database_2 5 4 'Structure model' pdbx_database_status 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_struct_keywords.pdbx_keywords' 2 2 'Structure model' '_struct_keywords.text' 3 3 'Structure model' '_citation.country' 4 3 'Structure model' '_citation.journal_abbrev' 5 3 'Structure model' '_citation.journal_id_ASTM' 6 3 'Structure model' '_citation.journal_id_CSD' 7 3 'Structure model' '_citation.journal_id_ISSN' 8 3 'Structure model' '_citation.journal_volume' 9 3 'Structure model' '_citation.page_first' 10 3 'Structure model' '_citation.page_last' 11 3 'Structure model' '_citation.pdbx_database_id_DOI' 12 3 'Structure model' '_citation.pdbx_database_id_PubMed' 13 3 'Structure model' '_citation.title' 14 3 'Structure model' '_citation.year' 15 4 'Structure model' '_database_2.pdbx_DOI' 16 4 'Structure model' '_database_2.pdbx_database_accession' 17 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 18 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6M3N _pdbx_database_status.recvd_initial_deposition_date 2020-03-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type BMRB '28082 contains the same protein and chemical shifts list.' 28082 unspecified BMRB 'Solution structure of anti-CRISPR AcrIF7' 36320 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kim, I.' 1 ? 'An, S.Y.' 2 ? 'Koo, J.' 3 ? 'Bae, E.' 4 ? 'Suh, J.Y.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_id_ASTM NARHAD _citation.journal_id_CSD 0389 _citation.journal_id_ISSN 1362-4962 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 48 _citation.language ? _citation.page_first 9959 _citation.page_last 9968 _citation.title 'Structural and mechanistic insights into the CRISPR inhibition of AcrIF7.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1093/nar/gkaa690 _citation.pdbx_database_id_PubMed 32810226 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kim, I.' 1 ? primary 'Koo, J.' 2 ? primary 'An, S.Y.' 3 ? primary 'Hong, S.' 4 ? primary 'Ka, D.' 5 ? primary 'Kim, E.H.' 6 ? primary 'Bae, E.' 7 ? primary 'Suh, J.Y.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'anti-CRIPSR AcrIF7' _entity.formula_weight 7526.073 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GHMTTFTSIVTTNPDFGGFEFYVEAGQQFDDSAYEEAYGVSVPSAVVEEMNAKAAQLKDGEWLNVSHEA _entity_poly.pdbx_seq_one_letter_code_can GHMTTFTSIVTTNPDFGGFEFYVEAGQQFDDSAYEEAYGVSVPSAVVEEMNAKAAQLKDGEWLNVSHEA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 THR n 1 5 THR n 1 6 PHE n 1 7 THR n 1 8 SER n 1 9 ILE n 1 10 VAL n 1 11 THR n 1 12 THR n 1 13 ASN n 1 14 PRO n 1 15 ASP n 1 16 PHE n 1 17 GLY n 1 18 GLY n 1 19 PHE n 1 20 GLU n 1 21 PHE n 1 22 TYR n 1 23 VAL n 1 24 GLU n 1 25 ALA n 1 26 GLY n 1 27 GLN n 1 28 GLN n 1 29 PHE n 1 30 ASP n 1 31 ASP n 1 32 SER n 1 33 ALA n 1 34 TYR n 1 35 GLU n 1 36 GLU n 1 37 ALA n 1 38 TYR n 1 39 GLY n 1 40 VAL n 1 41 SER n 1 42 VAL n 1 43 PRO n 1 44 SER n 1 45 ALA n 1 46 VAL n 1 47 VAL n 1 48 GLU n 1 49 GLU n 1 50 MET n 1 51 ASN n 1 52 ALA n 1 53 LYS n 1 54 ALA n 1 55 ALA n 1 56 GLN n 1 57 LEU n 1 58 LYS n 1 59 ASP n 1 60 GLY n 1 61 GLU n 1 62 TRP n 1 63 LEU n 1 64 ASN n 1 65 VAL n 1 66 SER n 1 67 HIS n 1 68 GLU n 1 69 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 69 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene F3H14_03835 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 287 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 HIS 2 0 ? ? ? A . n A 1 3 MET 3 1 1 MET MET A . n A 1 4 THR 4 2 2 THR THR A . n A 1 5 THR 5 3 3 THR THR A . n A 1 6 PHE 6 4 4 PHE PHE A . n A 1 7 THR 7 5 5 THR THR A . n A 1 8 SER 8 6 6 SER SER A . n A 1 9 ILE 9 7 7 ILE ILE A . n A 1 10 VAL 10 8 8 VAL VAL A . n A 1 11 THR 11 9 9 THR THR A . n A 1 12 THR 12 10 10 THR THR A . n A 1 13 ASN 13 11 11 ASN ASN A . n A 1 14 PRO 14 12 12 PRO PRO A . n A 1 15 ASP 15 13 13 ASP ASP A . n A 1 16 PHE 16 14 14 PHE PHE A . n A 1 17 GLY 17 15 15 GLY GLY A . n A 1 18 GLY 18 16 16 GLY GLY A . n A 1 19 PHE 19 17 17 PHE PHE A . n A 1 20 GLU 20 18 18 GLU GLU A . n A 1 21 PHE 21 19 19 PHE PHE A . n A 1 22 TYR 22 20 20 TYR TYR A . n A 1 23 VAL 23 21 21 VAL VAL A . n A 1 24 GLU 24 22 22 GLU GLU A . n A 1 25 ALA 25 23 23 ALA ALA A . n A 1 26 GLY 26 24 24 GLY GLY A . n A 1 27 GLN 27 25 25 GLN GLN A . n A 1 28 GLN 28 26 26 GLN GLN A . n A 1 29 PHE 29 27 27 PHE PHE A . n A 1 30 ASP 30 28 28 ASP ASP A . n A 1 31 ASP 31 29 29 ASP ASP A . n A 1 32 SER 32 30 30 SER SER A . n A 1 33 ALA 33 31 31 ALA ALA A . n A 1 34 TYR 34 32 32 TYR TYR A . n A 1 35 GLU 35 33 33 GLU GLU A . n A 1 36 GLU 36 34 34 GLU GLU A . n A 1 37 ALA 37 35 35 ALA ALA A . n A 1 38 TYR 38 36 36 TYR TYR A . n A 1 39 GLY 39 37 37 GLY GLY A . n A 1 40 VAL 40 38 38 VAL VAL A . n A 1 41 SER 41 39 39 SER SER A . n A 1 42 VAL 42 40 40 VAL VAL A . n A 1 43 PRO 43 41 41 PRO PRO A . n A 1 44 SER 44 42 42 SER SER A . n A 1 45 ALA 45 43 43 ALA ALA A . n A 1 46 VAL 46 44 44 VAL VAL A . n A 1 47 VAL 47 45 45 VAL VAL A . n A 1 48 GLU 48 46 46 GLU GLU A . n A 1 49 GLU 49 47 47 GLU GLU A . n A 1 50 MET 50 48 48 MET MET A . n A 1 51 ASN 51 49 49 ASN ASN A . n A 1 52 ALA 52 50 50 ALA ALA A . n A 1 53 LYS 53 51 51 LYS LYS A . n A 1 54 ALA 54 52 52 ALA ALA A . n A 1 55 ALA 55 53 53 ALA ALA A . n A 1 56 GLN 56 54 54 GLN GLN A . n A 1 57 LEU 57 55 55 LEU LEU A . n A 1 58 LYS 58 56 56 LYS LYS A . n A 1 59 ASP 59 57 57 ASP ASP A . n A 1 60 GLY 60 58 58 GLY GLY A . n A 1 61 GLU 61 59 59 GLU GLU A . n A 1 62 TRP 62 60 60 TRP TRP A . n A 1 63 LEU 63 61 61 LEU LEU A . n A 1 64 ASN 64 62 62 ASN ASN A . n A 1 65 VAL 65 63 63 VAL VAL A . n A 1 66 SER 66 64 64 SER SER A . n A 1 67 HIS 67 65 65 HIS HIS A . n A 1 68 GLU 68 66 66 GLU GLU A . n A 1 69 ALA 69 67 67 ALA ALA A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6M3N _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6M3N _struct.title 'Solution structure of anti-CRISPR AcrIF7' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6M3N _struct_keywords.text 'anti-CRISPR inhibitor, Hydrolase Inhibitor' _struct_keywords.pdbx_keywords 'HYDROLASE INHIBITOR' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A5M6HB72_PSEAI _struct_ref.pdbx_db_accession A0A5M6HB72 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MTTFTSIVTTNPDFGGFEFYVEAGQQFDDSAYEEAYGVSVPSAVVEEMNAKAAQLKDGEWLNVSHEA _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6M3N _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 69 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A5M6HB72 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 67 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 67 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6M3N GLY A 1 ? UNP A0A5M6HB72 ? ? 'expression tag' -1 1 1 6M3N HIS A 2 ? UNP A0A5M6HB72 ? ? 'expression tag' 0 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 4620 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'gel filtration' ? 2 1 'light scattering' ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 30 ? GLY A 39 ? ASP A 28 GLY A 37 1 ? 10 HELX_P HELX_P2 AA2 PRO A 43 ? LEU A 57 ? PRO A 41 LEU A 55 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 5 ? THR A 7 ? THR A 3 THR A 5 AA1 2 TRP A 62 ? GLU A 68 ? TRP A 60 GLU A 66 AA1 3 PHE A 21 ? GLU A 24 ? PHE A 19 GLU A 22 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 5 ? N THR A 3 O GLU A 68 ? O GLU A 66 AA1 2 3 O VAL A 65 ? O VAL A 63 N PHE A 21 ? N PHE A 19 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 14 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ALA _pdbx_validate_close_contact.auth_seq_id_1 50 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OE1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GLN _pdbx_validate_close_contact.auth_seq_id_2 54 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 11 ? ? -161.83 44.50 2 2 ASN A 11 ? ? -161.77 44.08 3 2 PHE A 14 ? ? 70.57 -25.39 4 3 ASN A 11 ? ? -141.01 59.19 5 5 ASN A 11 ? ? -162.83 47.24 6 10 ASN A 11 ? ? -160.45 44.38 7 12 ASN A 11 ? ? -155.16 56.14 8 12 PRO A 12 ? ? -39.26 110.29 9 13 ASN A 11 ? ? -161.22 67.72 10 13 PRO A 12 ? ? -47.96 109.18 11 13 PHE A 14 ? ? 63.04 95.50 12 14 ASN A 11 ? ? -146.04 45.54 13 15 ASN A 11 ? ? -162.10 43.52 14 16 ASN A 11 ? ? -145.07 58.66 15 18 ASN A 11 ? ? -158.35 43.65 16 20 ASN A 11 ? ? -161.68 43.92 # _pdbx_nmr_ensemble.entry_id 6M3N _pdbx_nmr_ensemble.conformers_calculated_total_number 1000 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6M3N _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.6 mM [U-99% 13C; U-99% 15N] AcrIF7, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label '13C, 15N_sample' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component AcrIF7 _pdbx_nmr_exptl_sample.concentration 0.6 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-99% 13C; U-99% 15N]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 273 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength 200 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC' 1 isotropic 3 1 1 '3D CBCA(CO)NH' 1 isotropic 4 1 1 '3D HNCACB' 1 isotropic 5 1 1 '3D HBHA(CO)NH' 1 isotropic 7 1 1 '3D HNCO' 1 isotropic 11 1 1 '3D HCCH-TOCSY' 1 isotropic 6 1 1 '3D 1H-13C NOESY' 1 isotropic 9 1 1 '3D 1H-15N NOESY' 1 isotropic 8 1 1 '3D 1H-13C NOESY aromatic' 1 isotropic # _pdbx_nmr_refine.entry_id 6M3N _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 4 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 2 'chemical shift assignment' Sparky ? Goddard 3 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 4 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A HIS 0 ? A HIS 2 3 2 Y 1 A GLY -1 ? A GLY 1 4 2 Y 1 A HIS 0 ? A HIS 2 5 3 Y 1 A GLY -1 ? A GLY 1 6 3 Y 1 A HIS 0 ? A HIS 2 7 4 Y 1 A GLY -1 ? A GLY 1 8 4 Y 1 A HIS 0 ? A HIS 2 9 5 Y 1 A GLY -1 ? A GLY 1 10 5 Y 1 A HIS 0 ? A HIS 2 11 6 Y 1 A GLY -1 ? A GLY 1 12 6 Y 1 A HIS 0 ? A HIS 2 13 7 Y 1 A GLY -1 ? A GLY 1 14 7 Y 1 A HIS 0 ? A HIS 2 15 8 Y 1 A GLY -1 ? A GLY 1 16 8 Y 1 A HIS 0 ? A HIS 2 17 9 Y 1 A GLY -1 ? A GLY 1 18 9 Y 1 A HIS 0 ? A HIS 2 19 10 Y 1 A GLY -1 ? A GLY 1 20 10 Y 1 A HIS 0 ? A HIS 2 21 11 Y 1 A GLY -1 ? A GLY 1 22 11 Y 1 A HIS 0 ? A HIS 2 23 12 Y 1 A GLY -1 ? A GLY 1 24 12 Y 1 A HIS 0 ? A HIS 2 25 13 Y 1 A GLY -1 ? A GLY 1 26 13 Y 1 A HIS 0 ? A HIS 2 27 14 Y 1 A GLY -1 ? A GLY 1 28 14 Y 1 A HIS 0 ? A HIS 2 29 15 Y 1 A GLY -1 ? A GLY 1 30 15 Y 1 A HIS 0 ? A HIS 2 31 16 Y 1 A GLY -1 ? A GLY 1 32 16 Y 1 A HIS 0 ? A HIS 2 33 17 Y 1 A GLY -1 ? A GLY 1 34 17 Y 1 A HIS 0 ? A HIS 2 35 18 Y 1 A GLY -1 ? A GLY 1 36 18 Y 1 A HIS 0 ? A HIS 2 37 19 Y 1 A GLY -1 ? A GLY 1 38 19 Y 1 A HIS 0 ? A HIS 2 39 20 Y 1 A GLY -1 ? A GLY 1 40 20 Y 1 A HIS 0 ? A HIS 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 GLN N N N N 47 GLN CA C N S 48 GLN C C N N 49 GLN O O N N 50 GLN CB C N N 51 GLN CG C N N 52 GLN CD C N N 53 GLN OE1 O N N 54 GLN NE2 N N N 55 GLN OXT O N N 56 GLN H H N N 57 GLN H2 H N N 58 GLN HA H N N 59 GLN HB2 H N N 60 GLN HB3 H N N 61 GLN HG2 H N N 62 GLN HG3 H N N 63 GLN HE21 H N N 64 GLN HE22 H N N 65 GLN HXT H N N 66 GLU N N N N 67 GLU CA C N S 68 GLU C C N N 69 GLU O O N N 70 GLU CB C N N 71 GLU CG C N N 72 GLU CD C N N 73 GLU OE1 O N N 74 GLU OE2 O N N 75 GLU OXT O N N 76 GLU H H N N 77 GLU H2 H N N 78 GLU HA H N N 79 GLU HB2 H N N 80 GLU HB3 H N N 81 GLU HG2 H N N 82 GLU HG3 H N N 83 GLU HE2 H N N 84 GLU HXT H N N 85 GLY N N N N 86 GLY CA C N N 87 GLY C C N N 88 GLY O O N N 89 GLY OXT O N N 90 GLY H H N N 91 GLY H2 H N N 92 GLY HA2 H N N 93 GLY HA3 H N N 94 GLY HXT H N N 95 HIS N N N N 96 HIS CA C N S 97 HIS C C N N 98 HIS O O N N 99 HIS CB C N N 100 HIS CG C Y N 101 HIS ND1 N Y N 102 HIS CD2 C Y N 103 HIS CE1 C Y N 104 HIS NE2 N Y N 105 HIS OXT O N N 106 HIS H H N N 107 HIS H2 H N N 108 HIS HA H N N 109 HIS HB2 H N N 110 HIS HB3 H N N 111 HIS HD1 H N N 112 HIS HD2 H N N 113 HIS HE1 H N N 114 HIS HE2 H N N 115 HIS HXT H N N 116 ILE N N N N 117 ILE CA C N S 118 ILE C C N N 119 ILE O O N N 120 ILE CB C N S 121 ILE CG1 C N N 122 ILE CG2 C N N 123 ILE CD1 C N N 124 ILE OXT O N N 125 ILE H H N N 126 ILE H2 H N N 127 ILE HA H N N 128 ILE HB H N N 129 ILE HG12 H N N 130 ILE HG13 H N N 131 ILE HG21 H N N 132 ILE HG22 H N N 133 ILE HG23 H N N 134 ILE HD11 H N N 135 ILE HD12 H N N 136 ILE HD13 H N N 137 ILE HXT H N N 138 LEU N N N N 139 LEU CA C N S 140 LEU C C N N 141 LEU O O N N 142 LEU CB C N N 143 LEU CG C N N 144 LEU CD1 C N N 145 LEU CD2 C N N 146 LEU OXT O N N 147 LEU H H N N 148 LEU H2 H N N 149 LEU HA H N N 150 LEU HB2 H N N 151 LEU HB3 H N N 152 LEU HG H N N 153 LEU HD11 H N N 154 LEU HD12 H N N 155 LEU HD13 H N N 156 LEU HD21 H N N 157 LEU HD22 H N N 158 LEU HD23 H N N 159 LEU HXT H N N 160 LYS N N N N 161 LYS CA C N S 162 LYS C C N N 163 LYS O O N N 164 LYS CB C N N 165 LYS CG C N N 166 LYS CD C N N 167 LYS CE C N N 168 LYS NZ N N N 169 LYS OXT O N N 170 LYS H H N N 171 LYS H2 H N N 172 LYS HA H N N 173 LYS HB2 H N N 174 LYS HB3 H N N 175 LYS HG2 H N N 176 LYS HG3 H N N 177 LYS HD2 H N N 178 LYS HD3 H N N 179 LYS HE2 H N N 180 LYS HE3 H N N 181 LYS HZ1 H N N 182 LYS HZ2 H N N 183 LYS HZ3 H N N 184 LYS HXT H N N 185 MET N N N N 186 MET CA C N S 187 MET C C N N 188 MET O O N N 189 MET CB C N N 190 MET CG C N N 191 MET SD S N N 192 MET CE C N N 193 MET OXT O N N 194 MET H H N N 195 MET H2 H N N 196 MET HA H N N 197 MET HB2 H N N 198 MET HB3 H N N 199 MET HG2 H N N 200 MET HG3 H N N 201 MET HE1 H N N 202 MET HE2 H N N 203 MET HE3 H N N 204 MET HXT H N N 205 PHE N N N N 206 PHE CA C N S 207 PHE C C N N 208 PHE O O N N 209 PHE CB C N N 210 PHE CG C Y N 211 PHE CD1 C Y N 212 PHE CD2 C Y N 213 PHE CE1 C Y N 214 PHE CE2 C Y N 215 PHE CZ C Y N 216 PHE OXT O N N 217 PHE H H N N 218 PHE H2 H N N 219 PHE HA H N N 220 PHE HB2 H N N 221 PHE HB3 H N N 222 PHE HD1 H N N 223 PHE HD2 H N N 224 PHE HE1 H N N 225 PHE HE2 H N N 226 PHE HZ H N N 227 PHE HXT H N N 228 PRO N N N N 229 PRO CA C N S 230 PRO C C N N 231 PRO O O N N 232 PRO CB C N N 233 PRO CG C N N 234 PRO CD C N N 235 PRO OXT O N N 236 PRO H H N N 237 PRO HA H N N 238 PRO HB2 H N N 239 PRO HB3 H N N 240 PRO HG2 H N N 241 PRO HG3 H N N 242 PRO HD2 H N N 243 PRO HD3 H N N 244 PRO HXT H N N 245 SER N N N N 246 SER CA C N S 247 SER C C N N 248 SER O O N N 249 SER CB C N N 250 SER OG O N N 251 SER OXT O N N 252 SER H H N N 253 SER H2 H N N 254 SER HA H N N 255 SER HB2 H N N 256 SER HB3 H N N 257 SER HG H N N 258 SER HXT H N N 259 THR N N N N 260 THR CA C N S 261 THR C C N N 262 THR O O N N 263 THR CB C N R 264 THR OG1 O N N 265 THR CG2 C N N 266 THR OXT O N N 267 THR H H N N 268 THR H2 H N N 269 THR HA H N N 270 THR HB H N N 271 THR HG1 H N N 272 THR HG21 H N N 273 THR HG22 H N N 274 THR HG23 H N N 275 THR HXT H N N 276 TRP N N N N 277 TRP CA C N S 278 TRP C C N N 279 TRP O O N N 280 TRP CB C N N 281 TRP CG C Y N 282 TRP CD1 C Y N 283 TRP CD2 C Y N 284 TRP NE1 N Y N 285 TRP CE2 C Y N 286 TRP CE3 C Y N 287 TRP CZ2 C Y N 288 TRP CZ3 C Y N 289 TRP CH2 C Y N 290 TRP OXT O N N 291 TRP H H N N 292 TRP H2 H N N 293 TRP HA H N N 294 TRP HB2 H N N 295 TRP HB3 H N N 296 TRP HD1 H N N 297 TRP HE1 H N N 298 TRP HE3 H N N 299 TRP HZ2 H N N 300 TRP HZ3 H N N 301 TRP HH2 H N N 302 TRP HXT H N N 303 TYR N N N N 304 TYR CA C N S 305 TYR C C N N 306 TYR O O N N 307 TYR CB C N N 308 TYR CG C Y N 309 TYR CD1 C Y N 310 TYR CD2 C Y N 311 TYR CE1 C Y N 312 TYR CE2 C Y N 313 TYR CZ C Y N 314 TYR OH O N N 315 TYR OXT O N N 316 TYR H H N N 317 TYR H2 H N N 318 TYR HA H N N 319 TYR HB2 H N N 320 TYR HB3 H N N 321 TYR HD1 H N N 322 TYR HD2 H N N 323 TYR HE1 H N N 324 TYR HE2 H N N 325 TYR HH H N N 326 TYR HXT H N N 327 VAL N N N N 328 VAL CA C N S 329 VAL C C N N 330 VAL O O N N 331 VAL CB C N N 332 VAL CG1 C N N 333 VAL CG2 C N N 334 VAL OXT O N N 335 VAL H H N N 336 VAL H2 H N N 337 VAL HA H N N 338 VAL HB H N N 339 VAL HG11 H N N 340 VAL HG12 H N N 341 VAL HG13 H N N 342 VAL HG21 H N N 343 VAL HG22 H N N 344 VAL HG23 H N N 345 VAL HXT H N N 346 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 GLN N CA sing N N 44 GLN N H sing N N 45 GLN N H2 sing N N 46 GLN CA C sing N N 47 GLN CA CB sing N N 48 GLN CA HA sing N N 49 GLN C O doub N N 50 GLN C OXT sing N N 51 GLN CB CG sing N N 52 GLN CB HB2 sing N N 53 GLN CB HB3 sing N N 54 GLN CG CD sing N N 55 GLN CG HG2 sing N N 56 GLN CG HG3 sing N N 57 GLN CD OE1 doub N N 58 GLN CD NE2 sing N N 59 GLN NE2 HE21 sing N N 60 GLN NE2 HE22 sing N N 61 GLN OXT HXT sing N N 62 GLU N CA sing N N 63 GLU N H sing N N 64 GLU N H2 sing N N 65 GLU CA C sing N N 66 GLU CA CB sing N N 67 GLU CA HA sing N N 68 GLU C O doub N N 69 GLU C OXT sing N N 70 GLU CB CG sing N N 71 GLU CB HB2 sing N N 72 GLU CB HB3 sing N N 73 GLU CG CD sing N N 74 GLU CG HG2 sing N N 75 GLU CG HG3 sing N N 76 GLU CD OE1 doub N N 77 GLU CD OE2 sing N N 78 GLU OE2 HE2 sing N N 79 GLU OXT HXT sing N N 80 GLY N CA sing N N 81 GLY N H sing N N 82 GLY N H2 sing N N 83 GLY CA C sing N N 84 GLY CA HA2 sing N N 85 GLY CA HA3 sing N N 86 GLY C O doub N N 87 GLY C OXT sing N N 88 GLY OXT HXT sing N N 89 HIS N CA sing N N 90 HIS N H sing N N 91 HIS N H2 sing N N 92 HIS CA C sing N N 93 HIS CA CB sing N N 94 HIS CA HA sing N N 95 HIS C O doub N N 96 HIS C OXT sing N N 97 HIS CB CG sing N N 98 HIS CB HB2 sing N N 99 HIS CB HB3 sing N N 100 HIS CG ND1 sing Y N 101 HIS CG CD2 doub Y N 102 HIS ND1 CE1 doub Y N 103 HIS ND1 HD1 sing N N 104 HIS CD2 NE2 sing Y N 105 HIS CD2 HD2 sing N N 106 HIS CE1 NE2 sing Y N 107 HIS CE1 HE1 sing N N 108 HIS NE2 HE2 sing N N 109 HIS OXT HXT sing N N 110 ILE N CA sing N N 111 ILE N H sing N N 112 ILE N H2 sing N N 113 ILE CA C sing N N 114 ILE CA CB sing N N 115 ILE CA HA sing N N 116 ILE C O doub N N 117 ILE C OXT sing N N 118 ILE CB CG1 sing N N 119 ILE CB CG2 sing N N 120 ILE CB HB sing N N 121 ILE CG1 CD1 sing N N 122 ILE CG1 HG12 sing N N 123 ILE CG1 HG13 sing N N 124 ILE CG2 HG21 sing N N 125 ILE CG2 HG22 sing N N 126 ILE CG2 HG23 sing N N 127 ILE CD1 HD11 sing N N 128 ILE CD1 HD12 sing N N 129 ILE CD1 HD13 sing N N 130 ILE OXT HXT sing N N 131 LEU N CA sing N N 132 LEU N H sing N N 133 LEU N H2 sing N N 134 LEU CA C sing N N 135 LEU CA CB sing N N 136 LEU CA HA sing N N 137 LEU C O doub N N 138 LEU C OXT sing N N 139 LEU CB CG sing N N 140 LEU CB HB2 sing N N 141 LEU CB HB3 sing N N 142 LEU CG CD1 sing N N 143 LEU CG CD2 sing N N 144 LEU CG HG sing N N 145 LEU CD1 HD11 sing N N 146 LEU CD1 HD12 sing N N 147 LEU CD1 HD13 sing N N 148 LEU CD2 HD21 sing N N 149 LEU CD2 HD22 sing N N 150 LEU CD2 HD23 sing N N 151 LEU OXT HXT sing N N 152 LYS N CA sing N N 153 LYS N H sing N N 154 LYS N H2 sing N N 155 LYS CA C sing N N 156 LYS CA CB sing N N 157 LYS CA HA sing N N 158 LYS C O doub N N 159 LYS C OXT sing N N 160 LYS CB CG sing N N 161 LYS CB HB2 sing N N 162 LYS CB HB3 sing N N 163 LYS CG CD sing N N 164 LYS CG HG2 sing N N 165 LYS CG HG3 sing N N 166 LYS CD CE sing N N 167 LYS CD HD2 sing N N 168 LYS CD HD3 sing N N 169 LYS CE NZ sing N N 170 LYS CE HE2 sing N N 171 LYS CE HE3 sing N N 172 LYS NZ HZ1 sing N N 173 LYS NZ HZ2 sing N N 174 LYS NZ HZ3 sing N N 175 LYS OXT HXT sing N N 176 MET N CA sing N N 177 MET N H sing N N 178 MET N H2 sing N N 179 MET CA C sing N N 180 MET CA CB sing N N 181 MET CA HA sing N N 182 MET C O doub N N 183 MET C OXT sing N N 184 MET CB CG sing N N 185 MET CB HB2 sing N N 186 MET CB HB3 sing N N 187 MET CG SD sing N N 188 MET CG HG2 sing N N 189 MET CG HG3 sing N N 190 MET SD CE sing N N 191 MET CE HE1 sing N N 192 MET CE HE2 sing N N 193 MET CE HE3 sing N N 194 MET OXT HXT sing N N 195 PHE N CA sing N N 196 PHE N H sing N N 197 PHE N H2 sing N N 198 PHE CA C sing N N 199 PHE CA CB sing N N 200 PHE CA HA sing N N 201 PHE C O doub N N 202 PHE C OXT sing N N 203 PHE CB CG sing N N 204 PHE CB HB2 sing N N 205 PHE CB HB3 sing N N 206 PHE CG CD1 doub Y N 207 PHE CG CD2 sing Y N 208 PHE CD1 CE1 sing Y N 209 PHE CD1 HD1 sing N N 210 PHE CD2 CE2 doub Y N 211 PHE CD2 HD2 sing N N 212 PHE CE1 CZ doub Y N 213 PHE CE1 HE1 sing N N 214 PHE CE2 CZ sing Y N 215 PHE CE2 HE2 sing N N 216 PHE CZ HZ sing N N 217 PHE OXT HXT sing N N 218 PRO N CA sing N N 219 PRO N CD sing N N 220 PRO N H sing N N 221 PRO CA C sing N N 222 PRO CA CB sing N N 223 PRO CA HA sing N N 224 PRO C O doub N N 225 PRO C OXT sing N N 226 PRO CB CG sing N N 227 PRO CB HB2 sing N N 228 PRO CB HB3 sing N N 229 PRO CG CD sing N N 230 PRO CG HG2 sing N N 231 PRO CG HG3 sing N N 232 PRO CD HD2 sing N N 233 PRO CD HD3 sing N N 234 PRO OXT HXT sing N N 235 SER N CA sing N N 236 SER N H sing N N 237 SER N H2 sing N N 238 SER CA C sing N N 239 SER CA CB sing N N 240 SER CA HA sing N N 241 SER C O doub N N 242 SER C OXT sing N N 243 SER CB OG sing N N 244 SER CB HB2 sing N N 245 SER CB HB3 sing N N 246 SER OG HG sing N N 247 SER OXT HXT sing N N 248 THR N CA sing N N 249 THR N H sing N N 250 THR N H2 sing N N 251 THR CA C sing N N 252 THR CA CB sing N N 253 THR CA HA sing N N 254 THR C O doub N N 255 THR C OXT sing N N 256 THR CB OG1 sing N N 257 THR CB CG2 sing N N 258 THR CB HB sing N N 259 THR OG1 HG1 sing N N 260 THR CG2 HG21 sing N N 261 THR CG2 HG22 sing N N 262 THR CG2 HG23 sing N N 263 THR OXT HXT sing N N 264 TRP N CA sing N N 265 TRP N H sing N N 266 TRP N H2 sing N N 267 TRP CA C sing N N 268 TRP CA CB sing N N 269 TRP CA HA sing N N 270 TRP C O doub N N 271 TRP C OXT sing N N 272 TRP CB CG sing N N 273 TRP CB HB2 sing N N 274 TRP CB HB3 sing N N 275 TRP CG CD1 doub Y N 276 TRP CG CD2 sing Y N 277 TRP CD1 NE1 sing Y N 278 TRP CD1 HD1 sing N N 279 TRP CD2 CE2 doub Y N 280 TRP CD2 CE3 sing Y N 281 TRP NE1 CE2 sing Y N 282 TRP NE1 HE1 sing N N 283 TRP CE2 CZ2 sing Y N 284 TRP CE3 CZ3 doub Y N 285 TRP CE3 HE3 sing N N 286 TRP CZ2 CH2 doub Y N 287 TRP CZ2 HZ2 sing N N 288 TRP CZ3 CH2 sing Y N 289 TRP CZ3 HZ3 sing N N 290 TRP CH2 HH2 sing N N 291 TRP OXT HXT sing N N 292 TYR N CA sing N N 293 TYR N H sing N N 294 TYR N H2 sing N N 295 TYR CA C sing N N 296 TYR CA CB sing N N 297 TYR CA HA sing N N 298 TYR C O doub N N 299 TYR C OXT sing N N 300 TYR CB CG sing N N 301 TYR CB HB2 sing N N 302 TYR CB HB3 sing N N 303 TYR CG CD1 doub Y N 304 TYR CG CD2 sing Y N 305 TYR CD1 CE1 sing Y N 306 TYR CD1 HD1 sing N N 307 TYR CD2 CE2 doub Y N 308 TYR CD2 HD2 sing N N 309 TYR CE1 CZ doub Y N 310 TYR CE1 HE1 sing N N 311 TYR CE2 CZ sing Y N 312 TYR CE2 HE2 sing N N 313 TYR CZ OH sing N N 314 TYR OH HH sing N N 315 TYR OXT HXT sing N N 316 VAL N CA sing N N 317 VAL N H sing N N 318 VAL N H2 sing N N 319 VAL CA C sing N N 320 VAL CA CB sing N N 321 VAL CA HA sing N N 322 VAL C O doub N N 323 VAL C OXT sing N N 324 VAL CB CG1 sing N N 325 VAL CB CG2 sing N N 326 VAL CB HB sing N N 327 VAL CG1 HG11 sing N N 328 VAL CG1 HG12 sing N N 329 VAL CG1 HG13 sing N N 330 VAL CG2 HG21 sing N N 331 VAL CG2 HG22 sing N N 332 VAL CG2 HG23 sing N N 333 VAL OXT HXT sing N N 334 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Rural Development Administration' 'Korea, Republic Of' PJ013181 1 'National Research Foundation (NRF, Korea)' 'Korea, Republic Of' D39700 2 'National Research Foundation (NRF, Korea)' 'Korea, Republic Of' BK21plus 3 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 6M3N _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_