data_6M6F # _entry.id 6M6F # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6M6F pdb_00006m6f 10.2210/pdb6m6f/pdb WWPDB D_1300016174 ? ? BMRB 36324 ? 10.13018/BMR36324 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-01-20 2 'Structure model' 1 1 2021-03-03 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' database_2 3 3 'Structure model' pdbx_database_status 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_entry_details 8 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.year' 3 3 'Structure model' '_database_2.pdbx_DOI' 4 3 'Structure model' '_database_2.pdbx_database_accession' 5 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 6 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6M6F _pdbx_database_status.recvd_initial_deposition_date 2020-03-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 6M6E unspecified BMRB 'Solution structure of disulfide bond mutaion of the core domain of Fibroblast growth factor 21 (FGF21)' 36324 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhu, L.' 1 0000-0001-5003-9059 'Zhao, H.' 2 0000-0002-5265-0238 'Wang, J.' 3 0000-0002-9608-6851 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Embo Rep.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1469-3178 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 22 _citation.language ? _citation.page_first e51352 _citation.page_last e51352 _citation.title 'Dynamic folding modulation generates FGF21 variant against diabetes.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.15252/embr.202051352 _citation.pdbx_database_id_PubMed 33295692 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhu, L.' 1 0000-0001-5003-9059 primary 'Zhao, H.' 2 ? primary 'Liu, J.' 3 ? primary 'Cai, H.' 4 ? primary 'Wu, B.' 5 ? primary 'Liu, Z.' 6 ? primary 'Zhou, S.' 7 ? primary 'Liu, Q.' 8 ? primary 'Li, X.' 9 ? primary 'Bao, B.' 10 ? primary 'Liu, J.' 11 0000-0002-3220-1240 primary 'Dai, H.' 12 0000-0001-9234-8386 primary 'Wang, J.' 13 0000-0002-9608-6851 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Fibroblast growth factor 21' _entity.formula_weight 14103.977 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'D23S, D24G, A25P, Q26H, Q28L, T29S, E30S, A31C, G43C' _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name FGF-21 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GQVRQRYLYTSGPHGLSSCHLEIREDGTVGCAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEA CSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPG ; _entity_poly.pdbx_seq_one_letter_code_can ;GQVRQRYLYTSGPHGLSSCHLEIREDGTVGCAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEA CSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLN n 1 3 VAL n 1 4 ARG n 1 5 GLN n 1 6 ARG n 1 7 TYR n 1 8 LEU n 1 9 TYR n 1 10 THR n 1 11 SER n 1 12 GLY n 1 13 PRO n 1 14 HIS n 1 15 GLY n 1 16 LEU n 1 17 SER n 1 18 SER n 1 19 CYS n 1 20 HIS n 1 21 LEU n 1 22 GLU n 1 23 ILE n 1 24 ARG n 1 25 GLU n 1 26 ASP n 1 27 GLY n 1 28 THR n 1 29 VAL n 1 30 GLY n 1 31 CYS n 1 32 ALA n 1 33 ALA n 1 34 ASP n 1 35 GLN n 1 36 SER n 1 37 PRO n 1 38 GLU n 1 39 SER n 1 40 LEU n 1 41 LEU n 1 42 GLN n 1 43 LEU n 1 44 LYS n 1 45 ALA n 1 46 LEU n 1 47 LYS n 1 48 PRO n 1 49 GLY n 1 50 VAL n 1 51 ILE n 1 52 GLN n 1 53 ILE n 1 54 LEU n 1 55 GLY n 1 56 VAL n 1 57 LYS n 1 58 THR n 1 59 SER n 1 60 ARG n 1 61 PHE n 1 62 LEU n 1 63 CYS n 1 64 GLN n 1 65 ARG n 1 66 PRO n 1 67 ASP n 1 68 GLY n 1 69 ALA n 1 70 LEU n 1 71 TYR n 1 72 GLY n 1 73 SER n 1 74 LEU n 1 75 HIS n 1 76 PHE n 1 77 ASP n 1 78 PRO n 1 79 GLU n 1 80 ALA n 1 81 CYS n 1 82 SER n 1 83 PHE n 1 84 ARG n 1 85 GLU n 1 86 LEU n 1 87 LEU n 1 88 LEU n 1 89 GLU n 1 90 ASP n 1 91 GLY n 1 92 TYR n 1 93 ASN n 1 94 VAL n 1 95 TYR n 1 96 GLN n 1 97 SER n 1 98 GLU n 1 99 ALA n 1 100 HIS n 1 101 GLY n 1 102 LEU n 1 103 PRO n 1 104 LEU n 1 105 HIS n 1 106 LEU n 1 107 PRO n 1 108 GLY n 1 109 ASN n 1 110 LYS n 1 111 SER n 1 112 PRO n 1 113 HIS n 1 114 ARG n 1 115 ASP n 1 116 PRO n 1 117 ALA n 1 118 PRO n 1 119 ARG n 1 120 GLY n 1 121 PRO n 1 122 ALA n 1 123 ARG n 1 124 PHE n 1 125 LEU n 1 126 PRO n 1 127 LEU n 1 128 PRO n 1 129 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 129 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene FGF21 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli K-12' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 83333 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain K-12 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 13 13 GLY GLY A . n A 1 2 GLN 2 14 14 GLN GLN A . n A 1 3 VAL 3 15 15 VAL VAL A . n A 1 4 ARG 4 16 16 ARG ARG A . n A 1 5 GLN 5 17 17 GLN GLN A . n A 1 6 ARG 6 18 18 ARG ARG A . n A 1 7 TYR 7 19 19 TYR TYR A . n A 1 8 LEU 8 20 20 LEU LEU A . n A 1 9 TYR 9 21 21 TYR TYR A . n A 1 10 THR 10 22 22 THR THR A . n A 1 11 SER 11 23 23 SER SER A . n A 1 12 GLY 12 24 24 GLY GLY A . n A 1 13 PRO 13 25 25 PRO PRO A . n A 1 14 HIS 14 26 26 HIS HIS A . n A 1 15 GLY 15 27 27 GLY GLY A . n A 1 16 LEU 16 28 28 LEU LEU A . n A 1 17 SER 17 29 29 SER SER A . n A 1 18 SER 18 30 30 SER SER A . n A 1 19 CYS 19 31 31 CYS CYS A . n A 1 20 HIS 20 32 32 HIS HIS A . n A 1 21 LEU 21 33 33 LEU LEU A . n A 1 22 GLU 22 34 34 GLU GLU A . n A 1 23 ILE 23 35 35 ILE ILE A . n A 1 24 ARG 24 36 36 ARG ARG A . n A 1 25 GLU 25 37 37 GLU GLU A . n A 1 26 ASP 26 38 38 ASP ASP A . n A 1 27 GLY 27 39 39 GLY GLY A . n A 1 28 THR 28 40 40 THR THR A . n A 1 29 VAL 29 41 41 VAL VAL A . n A 1 30 GLY 30 42 42 GLY GLY A . n A 1 31 CYS 31 43 43 CYS CYS A . n A 1 32 ALA 32 44 44 ALA ALA A . n A 1 33 ALA 33 45 45 ALA ALA A . n A 1 34 ASP 34 46 46 ASP ASP A . n A 1 35 GLN 35 47 47 GLN GLN A . n A 1 36 SER 36 48 48 SER SER A . n A 1 37 PRO 37 49 49 PRO PRO A . n A 1 38 GLU 38 50 50 GLU GLU A . n A 1 39 SER 39 51 51 SER SER A . n A 1 40 LEU 40 52 52 LEU LEU A . n A 1 41 LEU 41 53 53 LEU LEU A . n A 1 42 GLN 42 54 54 GLN GLN A . n A 1 43 LEU 43 55 55 LEU LEU A . n A 1 44 LYS 44 56 56 LYS LYS A . n A 1 45 ALA 45 57 57 ALA ALA A . n A 1 46 LEU 46 58 58 LEU LEU A . n A 1 47 LYS 47 59 59 LYS LYS A . n A 1 48 PRO 48 60 60 PRO PRO A . n A 1 49 GLY 49 61 61 GLY GLY A . n A 1 50 VAL 50 62 62 VAL VAL A . n A 1 51 ILE 51 63 63 ILE ILE A . n A 1 52 GLN 52 64 64 GLN GLN A . n A 1 53 ILE 53 65 65 ILE ILE A . n A 1 54 LEU 54 66 66 LEU LEU A . n A 1 55 GLY 55 67 67 GLY GLY A . n A 1 56 VAL 56 68 68 VAL VAL A . n A 1 57 LYS 57 69 69 LYS LYS A . n A 1 58 THR 58 70 70 THR THR A . n A 1 59 SER 59 71 71 SER SER A . n A 1 60 ARG 60 72 72 ARG ARG A . n A 1 61 PHE 61 73 73 PHE PHE A . n A 1 62 LEU 62 74 74 LEU LEU A . n A 1 63 CYS 63 75 75 CYS CYS A . n A 1 64 GLN 64 76 76 GLN GLN A . n A 1 65 ARG 65 77 77 ARG ARG A . n A 1 66 PRO 66 78 78 PRO PRO A . n A 1 67 ASP 67 79 79 ASP ASP A . n A 1 68 GLY 68 80 80 GLY GLY A . n A 1 69 ALA 69 81 81 ALA ALA A . n A 1 70 LEU 70 82 82 LEU LEU A . n A 1 71 TYR 71 83 83 TYR TYR A . n A 1 72 GLY 72 84 84 GLY GLY A . n A 1 73 SER 73 85 85 SER SER A . n A 1 74 LEU 74 86 86 LEU LEU A . n A 1 75 HIS 75 87 87 HIS HIS A . n A 1 76 PHE 76 88 88 PHE PHE A . n A 1 77 ASP 77 89 89 ASP ASP A . n A 1 78 PRO 78 90 90 PRO PRO A . n A 1 79 GLU 79 91 91 GLU GLU A . n A 1 80 ALA 80 92 92 ALA ALA A . n A 1 81 CYS 81 93 93 CYS CYS A . n A 1 82 SER 82 94 94 SER SER A . n A 1 83 PHE 83 95 95 PHE PHE A . n A 1 84 ARG 84 96 96 ARG ARG A . n A 1 85 GLU 85 97 97 GLU GLU A . n A 1 86 LEU 86 98 98 LEU LEU A . n A 1 87 LEU 87 99 99 LEU LEU A . n A 1 88 LEU 88 100 100 LEU LEU A . n A 1 89 GLU 89 101 101 GLU GLU A . n A 1 90 ASP 90 102 102 ASP ASP A . n A 1 91 GLY 91 103 103 GLY GLY A . n A 1 92 TYR 92 104 104 TYR TYR A . n A 1 93 ASN 93 105 105 ASN ASN A . n A 1 94 VAL 94 106 106 VAL VAL A . n A 1 95 TYR 95 107 107 TYR TYR A . n A 1 96 GLN 96 108 108 GLN GLN A . n A 1 97 SER 97 109 109 SER SER A . n A 1 98 GLU 98 110 110 GLU GLU A . n A 1 99 ALA 99 111 111 ALA ALA A . n A 1 100 HIS 100 112 112 HIS HIS A . n A 1 101 GLY 101 113 113 GLY GLY A . n A 1 102 LEU 102 114 114 LEU LEU A . n A 1 103 PRO 103 115 115 PRO PRO A . n A 1 104 LEU 104 116 116 LEU LEU A . n A 1 105 HIS 105 117 117 HIS HIS A . n A 1 106 LEU 106 118 118 LEU LEU A . n A 1 107 PRO 107 119 119 PRO PRO A . n A 1 108 GLY 108 120 120 GLY GLY A . n A 1 109 ASN 109 121 121 ASN ASN A . n A 1 110 LYS 110 122 122 LYS LYS A . n A 1 111 SER 111 123 123 SER SER A . n A 1 112 PRO 112 124 124 PRO PRO A . n A 1 113 HIS 113 125 125 HIS HIS A . n A 1 114 ARG 114 126 126 ARG ARG A . n A 1 115 ASP 115 127 127 ASP ASP A . n A 1 116 PRO 116 128 128 PRO PRO A . n A 1 117 ALA 117 129 129 ALA ALA A . n A 1 118 PRO 118 130 130 PRO PRO A . n A 1 119 ARG 119 131 131 ARG ARG A . n A 1 120 GLY 120 132 132 GLY GLY A . n A 1 121 PRO 121 133 133 PRO PRO A . n A 1 122 ALA 122 134 134 ALA ALA A . n A 1 123 ARG 123 135 135 ARG ARG A . n A 1 124 PHE 124 136 136 PHE PHE A . n A 1 125 LEU 125 137 137 LEU LEU A . n A 1 126 PRO 126 138 138 PRO PRO A . n A 1 127 LEU 127 139 139 LEU LEU A . n A 1 128 PRO 128 140 140 PRO PRO A . n A 1 129 GLY 129 141 141 GLY GLY A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6M6F _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6M6F _struct.title 'Solution structure of disulfide bond mutaion of the core domain of Fibroblast growth factor 21 (FGF21)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6M6F _struct_keywords.text 'Disulfide bond mutaion, beta-trefoil conformation, beta-klotho binding, Metabolic regulator, HORMONE' _struct_keywords.pdbx_keywords HORMONE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FGF21_HUMAN _struct_ref.pdbx_db_accession Q9NSA1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEAC SFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARF ; _struct_ref.pdbx_align_begin 42 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6M6F _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 124 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9NSA1 _struct_ref_seq.db_align_beg 42 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 164 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 13 _struct_ref_seq.pdbx_auth_seq_align_end 136 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6M6F SER A 11 ? UNP Q9NSA1 ASP 52 'engineered mutation' 23 1 1 6M6F GLY A 12 ? UNP Q9NSA1 ASP 53 'engineered mutation' 24 2 1 6M6F PRO A 13 ? UNP Q9NSA1 ALA 54 'engineered mutation' 25 3 1 6M6F HIS A 14 ? UNP Q9NSA1 GLN 55 'engineered mutation' 26 4 1 6M6F GLY A 15 ? UNP Q9NSA1 ? ? insertion 27 5 1 6M6F LEU A 16 ? UNP Q9NSA1 GLN 56 'engineered mutation' 28 6 1 6M6F SER A 17 ? UNP Q9NSA1 THR 57 'engineered mutation' 29 7 1 6M6F SER A 18 ? UNP Q9NSA1 GLU 58 'engineered mutation' 30 8 1 6M6F CYS A 19 ? UNP Q9NSA1 ALA 59 'engineered mutation' 31 9 1 6M6F CYS A 31 ? UNP Q9NSA1 GLY 71 'engineered mutation' 43 10 1 6M6F LEU A 125 ? UNP Q9NSA1 ? ? 'expression tag' 137 11 1 6M6F PRO A 126 ? UNP Q9NSA1 ? ? 'expression tag' 138 12 1 6M6F LEU A 127 ? UNP Q9NSA1 ? ? 'expression tag' 139 13 1 6M6F PRO A 128 ? UNP Q9NSA1 ? ? 'expression tag' 140 14 1 6M6F GLY A 129 ? UNP Q9NSA1 ? ? 'expression tag' 141 15 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 7970 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 36 ? GLU A 38 ? SER A 48 GLU A 50 5 ? 3 HELX_P HELX_P2 AA2 ASP A 77 ? SER A 82 ? ASP A 89 SER A 94 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 19 SG ? ? ? 1_555 A CYS 31 SG ? ? A CYS 31 A CYS 43 1_555 ? ? ? ? ? ? ? 2.025 ? ? disulf2 disulf ? ? A CYS 63 SG ? ? ? 1_555 A CYS 81 SG ? ? A CYS 75 A CYS 93 1_555 ? ? ? ? ? ? ? 2.023 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 19 ? CYS A 31 ? CYS A 31 ? 1_555 CYS A 43 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 63 ? CYS A 81 ? CYS A 75 ? 1_555 CYS A 93 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASN A 93 ? SER A 97 ? ASN A 105 SER A 109 AA1 2 PHE A 83 ? LEU A 87 ? PHE A 95 LEU A 99 AA1 3 VAL A 50 ? GLY A 55 ? VAL A 62 GLY A 67 AA1 4 LEU A 40 ? LYS A 47 ? LEU A 52 LYS A 59 AA1 5 VAL A 3 ? TYR A 9 ? VAL A 15 TYR A 21 AA1 6 LEU A 125 ? PRO A 128 ? LEU A 137 PRO A 140 AA2 1 HIS A 20 ? ILE A 23 ? HIS A 32 ILE A 35 AA2 2 VAL A 29 ? ALA A 32 ? VAL A 41 ALA A 44 AA3 1 PHE A 61 ? GLN A 64 ? PHE A 73 GLN A 76 AA3 2 LEU A 70 ? SER A 73 ? LEU A 82 SER A 85 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLN A 96 ? O GLN A 108 N ARG A 84 ? N ARG A 96 AA1 2 3 O PHE A 83 ? O PHE A 95 N ILE A 51 ? N ILE A 63 AA1 3 4 O GLN A 52 ? O GLN A 64 N LYS A 44 ? N LYS A 56 AA1 4 5 O LEU A 43 ? O LEU A 55 N ARG A 4 ? N ARG A 16 AA1 5 6 N TYR A 9 ? N TYR A 21 O LEU A 125 ? O LEU A 137 AA2 1 2 N GLU A 22 ? N GLU A 34 O GLY A 30 ? O GLY A 42 AA3 1 2 N PHE A 61 ? N PHE A 73 O SER A 73 ? O SER A 85 # _pdbx_entry_details.entry_id 6M6F _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ASP 89 ? ? H A CYS 93 ? ? 1.58 2 2 H A ARG 77 ? ? O A ALA 81 ? ? 1.55 3 3 O A ASP 89 ? ? H A CYS 93 ? ? 1.59 4 4 HE2 A HIS 32 ? ? HE21 A GLN 47 ? ? 1.25 5 4 O A PRO 49 ? ? H A LEU 52 ? ? 1.60 6 5 HG A SER 30 ? ? HE2 A HIS 32 ? ? 1.27 7 5 O A ARG 77 ? ? H A GLY 80 ? ? 1.58 8 5 H A ARG 77 ? ? O A ALA 81 ? ? 1.58 9 6 O A ASP 89 ? ? H A CYS 93 ? ? 1.57 10 8 O A TYR 21 ? ? H A LEU 137 ? ? 1.54 11 8 O A ASP 89 ? ? H A CYS 93 ? ? 1.55 12 8 O A PRO 49 ? ? H A LEU 52 ? ? 1.59 13 9 H A ARG 96 ? ? O A GLN 108 ? ? 1.56 14 10 O A ASP 89 ? ? H A CYS 93 ? ? 1.57 15 10 O A LYS 59 ? ? H A VAL 62 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 29 ? ? -168.51 -164.28 2 1 GLN A 47 ? ? 39.80 92.22 3 1 ALA A 92 ? ? -136.61 -34.77 4 1 LYS A 122 ? ? 44.70 98.90 5 1 SER A 123 ? ? -179.61 -59.63 6 1 ALA A 129 ? ? 64.03 110.66 7 2 HIS A 26 ? ? -66.65 7.98 8 2 LEU A 28 ? ? -142.07 -89.58 9 2 GLN A 47 ? ? 42.05 97.67 10 2 LEU A 58 ? ? -73.26 -71.47 11 2 ALA A 92 ? ? -131.53 -31.04 12 2 LYS A 122 ? ? 49.11 92.80 13 2 SER A 123 ? ? 33.59 72.17 14 2 ARG A 126 ? ? 38.10 88.83 15 2 ASP A 127 ? ? -29.06 93.89 16 3 HIS A 26 ? ? 72.80 49.56 17 3 SER A 30 ? ? -39.09 135.23 18 3 GLN A 47 ? ? 42.15 92.43 19 3 LEU A 58 ? ? -74.48 -70.60 20 3 ALA A 92 ? ? -138.12 -32.61 21 3 LYS A 122 ? ? 41.94 -168.14 22 3 ASP A 127 ? ? -43.44 163.09 23 3 ALA A 129 ? ? 175.04 -39.98 24 4 GLN A 14 ? ? -100.16 53.56 25 4 LEU A 28 ? ? 60.77 -69.77 26 4 GLN A 47 ? ? 43.47 98.95 27 4 PRO A 60 ? ? -43.17 109.92 28 4 ALA A 92 ? ? -140.14 -32.34 29 4 ASN A 121 ? ? 41.33 -166.85 30 4 LYS A 122 ? ? 68.43 -22.93 31 5 HIS A 26 ? ? -162.30 -68.75 32 5 LEU A 28 ? ? 70.69 -61.52 33 5 GLN A 47 ? ? 37.47 91.49 34 5 ASP A 127 ? ? -52.85 172.71 35 5 ARG A 131 ? ? 68.75 87.00 36 6 LEU A 28 ? ? 66.08 -71.45 37 6 GLN A 47 ? ? 46.70 99.69 38 6 ARG A 131 ? ? -58.40 109.89 39 7 LEU A 28 ? ? -145.67 -143.29 40 7 GLN A 47 ? ? 46.66 97.39 41 7 LEU A 58 ? ? -72.71 -73.10 42 7 ASN A 121 ? ? 68.04 -36.83 43 7 ARG A 126 ? ? -155.72 -76.85 44 7 ALA A 129 ? ? -171.47 146.53 45 7 ARG A 131 ? ? 39.60 82.13 46 8 GLN A 14 ? ? 59.47 -69.75 47 8 LEU A 28 ? ? -80.00 -107.83 48 8 GLN A 47 ? ? 46.26 90.05 49 8 ASN A 121 ? ? 40.51 -119.21 50 8 SER A 123 ? ? 164.32 -63.24 51 8 ASP A 127 ? ? -45.06 159.53 52 8 ALA A 129 ? ? -174.66 62.96 53 9 HIS A 26 ? ? 38.76 31.64 54 9 SER A 29 ? ? -166.56 -168.49 55 9 GLN A 47 ? ? 45.95 99.10 56 9 LYS A 122 ? ? -170.03 -34.51 57 9 SER A 123 ? ? -174.09 57.88 58 9 ASP A 127 ? ? -37.11 148.39 59 9 ALA A 129 ? ? 67.34 66.79 60 10 LEU A 28 ? ? -126.16 -89.58 61 10 GLN A 47 ? ? 42.91 95.88 62 10 HIS A 125 ? ? -44.90 160.39 63 10 ARG A 131 ? ? 35.64 -114.39 # _pdbx_nmr_ensemble.entry_id 6M6F _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6M6F _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.5 mM [U-99% 15N] FGF21SS, 20 mM sodium phosphate, 100 mM sodium chloride, 0.2 % w/v sodium azide, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N_sample solution ? 2 '0.5 mM [U-99% 13C; U-99% 15N] FGF21SS, 20 mM sodium phosphate, 100 mM sodium chloride, 0.2 % w/v sodium azide, 90% H2O/10% D2O' '90% H2O/10% D2O' 13C_15N_sample solution ? 3 '0.5 mM [U-99% 13C; U-99% 15N] FGF21SS, 20 mM sodium phosphate, 100 mM sodium chloride, 0.2 % w/v sodium azide, 100% D2O' '100% D2O' '13C_15N_sample in D2O' solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 FGF21SS 0.5 ? mM '[U-99% 15N]' 1 'sodium phosphate' 20 ? mM 'natural abundance' 1 'sodium chloride' 100 ? mM 'natural abundance' 1 'sodium azide' 0.2 ? '% w/v' 'natural abundance' 2 FGF21SS 0.5 ? mM '[U-99% 13C; U-99% 15N]' 2 'sodium phosphate' 20 ? mM 'natural abundance' 2 'sodium chloride' 100 ? mM 'natural abundance' 2 'sodium azide' 0.2 ? '% w/v' 'natural abundance' 3 FGF21SS 0.5 ? mM '[U-99% 13C; U-99% 15N]' 3 'sodium phosphate' 20 ? mM 'natural abundance' 3 'sodium chloride' 100 ? mM 'natural abundance' 3 'sodium azide' 0.2 ? '% w/v' 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 160 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 2 '2D 1H-15N HSQC' 1 isotropic 3 1 3 '2D 1H-15N HSQC' 1 isotropic 4 1 2 '3D CBCA(CO)NH' 2 isotropic 5 1 2 '3D HNCO' 2 isotropic 6 1 2 '3D HNCA' 2 isotropic 7 1 2 '3D HNCACB' 2 isotropic 8 1 2 '3D HBHA(CO)NH' 2 isotropic 9 1 2 '3D HN(CO)CA' 2 isotropic 10 1 2 '3D HN(CA)CO' 2 isotropic 11 1 2 '3D 1H-13C NOESY' 2 isotropic 12 1 1 '3D 1H-15N NOESY' 1 isotropic 13 1 3 '3D HCCH-TOCSY' 1 isotropic 14 1 3 '3D HCCH-COSY' 1 isotropic 15 1 3 '3D 1H-13C NOESY' 2 isotropic # _pdbx_nmr_refine.entry_id 6M6F _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 5 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 3 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 4 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 5 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 PHE N N N N 227 PHE CA C N S 228 PHE C C N N 229 PHE O O N N 230 PHE CB C N N 231 PHE CG C Y N 232 PHE CD1 C Y N 233 PHE CD2 C Y N 234 PHE CE1 C Y N 235 PHE CE2 C Y N 236 PHE CZ C Y N 237 PHE OXT O N N 238 PHE H H N N 239 PHE H2 H N N 240 PHE HA H N N 241 PHE HB2 H N N 242 PHE HB3 H N N 243 PHE HD1 H N N 244 PHE HD2 H N N 245 PHE HE1 H N N 246 PHE HE2 H N N 247 PHE HZ H N N 248 PHE HXT H N N 249 PRO N N N N 250 PRO CA C N S 251 PRO C C N N 252 PRO O O N N 253 PRO CB C N N 254 PRO CG C N N 255 PRO CD C N N 256 PRO OXT O N N 257 PRO H H N N 258 PRO HA H N N 259 PRO HB2 H N N 260 PRO HB3 H N N 261 PRO HG2 H N N 262 PRO HG3 H N N 263 PRO HD2 H N N 264 PRO HD3 H N N 265 PRO HXT H N N 266 SER N N N N 267 SER CA C N S 268 SER C C N N 269 SER O O N N 270 SER CB C N N 271 SER OG O N N 272 SER OXT O N N 273 SER H H N N 274 SER H2 H N N 275 SER HA H N N 276 SER HB2 H N N 277 SER HB3 H N N 278 SER HG H N N 279 SER HXT H N N 280 THR N N N N 281 THR CA C N S 282 THR C C N N 283 THR O O N N 284 THR CB C N R 285 THR OG1 O N N 286 THR CG2 C N N 287 THR OXT O N N 288 THR H H N N 289 THR H2 H N N 290 THR HA H N N 291 THR HB H N N 292 THR HG1 H N N 293 THR HG21 H N N 294 THR HG22 H N N 295 THR HG23 H N N 296 THR HXT H N N 297 TYR N N N N 298 TYR CA C N S 299 TYR C C N N 300 TYR O O N N 301 TYR CB C N N 302 TYR CG C Y N 303 TYR CD1 C Y N 304 TYR CD2 C Y N 305 TYR CE1 C Y N 306 TYR CE2 C Y N 307 TYR CZ C Y N 308 TYR OH O N N 309 TYR OXT O N N 310 TYR H H N N 311 TYR H2 H N N 312 TYR HA H N N 313 TYR HB2 H N N 314 TYR HB3 H N N 315 TYR HD1 H N N 316 TYR HD2 H N N 317 TYR HE1 H N N 318 TYR HE2 H N N 319 TYR HH H N N 320 TYR HXT H N N 321 VAL N N N N 322 VAL CA C N S 323 VAL C C N N 324 VAL O O N N 325 VAL CB C N N 326 VAL CG1 C N N 327 VAL CG2 C N N 328 VAL OXT O N N 329 VAL H H N N 330 VAL H2 H N N 331 VAL HA H N N 332 VAL HB H N N 333 VAL HG11 H N N 334 VAL HG12 H N N 335 VAL HG13 H N N 336 VAL HG21 H N N 337 VAL HG22 H N N 338 VAL HG23 H N N 339 VAL HXT H N N 340 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 PHE N CA sing N N 216 PHE N H sing N N 217 PHE N H2 sing N N 218 PHE CA C sing N N 219 PHE CA CB sing N N 220 PHE CA HA sing N N 221 PHE C O doub N N 222 PHE C OXT sing N N 223 PHE CB CG sing N N 224 PHE CB HB2 sing N N 225 PHE CB HB3 sing N N 226 PHE CG CD1 doub Y N 227 PHE CG CD2 sing Y N 228 PHE CD1 CE1 sing Y N 229 PHE CD1 HD1 sing N N 230 PHE CD2 CE2 doub Y N 231 PHE CD2 HD2 sing N N 232 PHE CE1 CZ doub Y N 233 PHE CE1 HE1 sing N N 234 PHE CE2 CZ sing Y N 235 PHE CE2 HE2 sing N N 236 PHE CZ HZ sing N N 237 PHE OXT HXT sing N N 238 PRO N CA sing N N 239 PRO N CD sing N N 240 PRO N H sing N N 241 PRO CA C sing N N 242 PRO CA CB sing N N 243 PRO CA HA sing N N 244 PRO C O doub N N 245 PRO C OXT sing N N 246 PRO CB CG sing N N 247 PRO CB HB2 sing N N 248 PRO CB HB3 sing N N 249 PRO CG CD sing N N 250 PRO CG HG2 sing N N 251 PRO CG HG3 sing N N 252 PRO CD HD2 sing N N 253 PRO CD HD3 sing N N 254 PRO OXT HXT sing N N 255 SER N CA sing N N 256 SER N H sing N N 257 SER N H2 sing N N 258 SER CA C sing N N 259 SER CA CB sing N N 260 SER CA HA sing N N 261 SER C O doub N N 262 SER C OXT sing N N 263 SER CB OG sing N N 264 SER CB HB2 sing N N 265 SER CB HB3 sing N N 266 SER OG HG sing N N 267 SER OXT HXT sing N N 268 THR N CA sing N N 269 THR N H sing N N 270 THR N H2 sing N N 271 THR CA C sing N N 272 THR CA CB sing N N 273 THR CA HA sing N N 274 THR C O doub N N 275 THR C OXT sing N N 276 THR CB OG1 sing N N 277 THR CB CG2 sing N N 278 THR CB HB sing N N 279 THR OG1 HG1 sing N N 280 THR CG2 HG21 sing N N 281 THR CG2 HG22 sing N N 282 THR CG2 HG23 sing N N 283 THR OXT HXT sing N N 284 TYR N CA sing N N 285 TYR N H sing N N 286 TYR N H2 sing N N 287 TYR CA C sing N N 288 TYR CA CB sing N N 289 TYR CA HA sing N N 290 TYR C O doub N N 291 TYR C OXT sing N N 292 TYR CB CG sing N N 293 TYR CB HB2 sing N N 294 TYR CB HB3 sing N N 295 TYR CG CD1 doub Y N 296 TYR CG CD2 sing Y N 297 TYR CD1 CE1 sing Y N 298 TYR CD1 HD1 sing N N 299 TYR CD2 CE2 doub Y N 300 TYR CD2 HD2 sing N N 301 TYR CE1 CZ doub Y N 302 TYR CE1 HE1 sing N N 303 TYR CE2 CZ sing Y N 304 TYR CE2 HE2 sing N N 305 TYR CZ OH sing N N 306 TYR OH HH sing N N 307 TYR OXT HXT sing N N 308 VAL N CA sing N N 309 VAL N H sing N N 310 VAL N H2 sing N N 311 VAL CA C sing N N 312 VAL CA CB sing N N 313 VAL CA HA sing N N 314 VAL C O doub N N 315 VAL C OXT sing N N 316 VAL CB CG1 sing N N 317 VAL CB CG2 sing N N 318 VAL CB HB sing N N 319 VAL CG1 HG11 sing N N 320 VAL CG1 HG12 sing N N 321 VAL CG1 HG13 sing N N 322 VAL CG2 HG21 sing N N 323 VAL CG2 HG22 sing N N 324 VAL CG2 HG23 sing N N 325 VAL OXT HXT sing N N 326 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Natural Science Foundation of China (NSFC)' China U1532269 1 'National Natural Science Foundation of China (NSFC)' China 31100539 2 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 600 ? 2 'AVANCE III' ? Bruker 850 ? # _atom_sites.entry_id 6M6F _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_