data_6M8F
# 
_entry.id   6M8F 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.379 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   6M8F         pdb_00006m8f 10.2210/pdb6m8f/pdb 
WWPDB D_1000236303 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6M8F 
_pdbx_database_status.recvd_initial_deposition_date   2018-08-21 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bacik, J.P.' 1 0000-0001-9315-5332 
'Ando, N.'    2 0000-0001-7062-1644 
'Fasan, R.'   3 0000-0003-4636-9578 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Acs Catalysis' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2155-5435 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            9 
_citation.language                  ? 
_citation.page_first                1514 
_citation.page_last                 1524 
_citation.title                     
'Origin of high stereocontrol in olefin cyclopropanation catalyzed by an engineered carbene transferase.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acscatal.8b04073 
_citation.pdbx_database_id_PubMed   31134138 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Tinoco, A.'      1 ? 
primary 'Wei, Y.'         2 ? 
primary 'Bacik, J.P.'     3 ? 
primary 'Carminati, D.M.' 4 ? 
primary 'Moore, E.J.'     5 ? 
primary 'Ando, N.'        6 ? 
primary 'Zhang, Y.'       7 ? 
primary 'Fasan, R.'       8 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6M8F 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     90.780 
_cell.length_a_esd                 ? 
_cell.length_b                     90.780 
_cell.length_b_esd                 ? 
_cell.length_c                     45.580 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6M8F 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                168 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 6' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Myoglobin                                           17298.094 1   ? ? ? ? 
2 branched    man 'beta-D-fructofuranose-(2-1)-alpha-D-glucopyranose' 342.297   1   ? ? ? ? 
3 non-polymer syn 'SULFATE ION'                                       96.063    3   ? ? ? ? 
4 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE'                   616.487   1   ? ? ? ? 
5 water       nat water                                               18.015    224 ? ? ? ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        sucrose 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKVGVTALTALGAILKKK
GHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKVGVTALTALGAILKKK
GHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   VAL n 
1 3   LEU n 
1 4   SER n 
1 5   GLU n 
1 6   GLY n 
1 7   GLU n 
1 8   TRP n 
1 9   GLN n 
1 10  LEU n 
1 11  VAL n 
1 12  LEU n 
1 13  HIS n 
1 14  VAL n 
1 15  TRP n 
1 16  ALA n 
1 17  LYS n 
1 18  VAL n 
1 19  GLU n 
1 20  ALA n 
1 21  ASP n 
1 22  VAL n 
1 23  ALA n 
1 24  GLY n 
1 25  HIS n 
1 26  GLY n 
1 27  GLN n 
1 28  ASP n 
1 29  ILE n 
1 30  LEU n 
1 31  ILE n 
1 32  ARG n 
1 33  LEU n 
1 34  PHE n 
1 35  LYS n 
1 36  SER n 
1 37  HIS n 
1 38  PRO n 
1 39  GLU n 
1 40  THR n 
1 41  LEU n 
1 42  GLU n 
1 43  LYS n 
1 44  PHE n 
1 45  ASP n 
1 46  ARG n 
1 47  PHE n 
1 48  LYS n 
1 49  HIS n 
1 50  LEU n 
1 51  LYS n 
1 52  THR n 
1 53  GLU n 
1 54  ALA n 
1 55  GLU n 
1 56  MET n 
1 57  LYS n 
1 58  ALA n 
1 59  SER n 
1 60  GLU n 
1 61  ASP n 
1 62  LEU n 
1 63  LYS n 
1 64  LYS n 
1 65  VAL n 
1 66  GLY n 
1 67  VAL n 
1 68  THR n 
1 69  ALA n 
1 70  LEU n 
1 71  THR n 
1 72  ALA n 
1 73  LEU n 
1 74  GLY n 
1 75  ALA n 
1 76  ILE n 
1 77  LEU n 
1 78  LYS n 
1 79  LYS n 
1 80  LYS n 
1 81  GLY n 
1 82  HIS n 
1 83  HIS n 
1 84  GLU n 
1 85  ALA n 
1 86  GLU n 
1 87  LEU n 
1 88  LYS n 
1 89  PRO n 
1 90  LEU n 
1 91  ALA n 
1 92  GLN n 
1 93  SER n 
1 94  HIS n 
1 95  ALA n 
1 96  THR n 
1 97  LYS n 
1 98  HIS n 
1 99  LYS n 
1 100 ILE n 
1 101 PRO n 
1 102 ILE n 
1 103 LYS n 
1 104 TYR n 
1 105 LEU n 
1 106 GLU n 
1 107 PHE n 
1 108 ILE n 
1 109 SER n 
1 110 GLU n 
1 111 ALA n 
1 112 ILE n 
1 113 ILE n 
1 114 HIS n 
1 115 VAL n 
1 116 LEU n 
1 117 HIS n 
1 118 SER n 
1 119 ARG n 
1 120 HIS n 
1 121 PRO n 
1 122 GLY n 
1 123 ASN n 
1 124 PHE n 
1 125 GLY n 
1 126 ALA n 
1 127 ASP n 
1 128 ALA n 
1 129 GLN n 
1 130 GLY n 
1 131 ALA n 
1 132 MET n 
1 133 ASN n 
1 134 LYS n 
1 135 ALA n 
1 136 LEU n 
1 137 GLU n 
1 138 LEU n 
1 139 PHE n 
1 140 ARG n 
1 141 LYS n 
1 142 ASP n 
1 143 ILE n 
1 144 ALA n 
1 145 ALA n 
1 146 LYS n 
1 147 TYR n 
1 148 LYS n 
1 149 GLU n 
1 150 LEU n 
1 151 GLY n 
1 152 TYR n 
1 153 GLN n 
1 154 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   154 
_entity_src_gen.gene_src_common_name               'Sperm whale' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 MB 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Physeter catodon' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9755 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MYG_PHYCD 
_struct_ref.pdbx_db_accession          P02185 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKK
GHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6M8F 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 154 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P02185 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  154 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       0 
_struct_ref_seq.pdbx_auth_seq_align_end       153 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6M8F VAL A 65  ? UNP P02185 HIS 65  conflict 64  1 
1 6M8F ALA A 69  ? UNP P02185 VAL 69  conflict 68  2 
1 6M8F ASN A 123 ? UNP P02185 ASP 123 conflict 122 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                           ?                                       'C3 H7 N O2'       
89.093  
ARG 'L-peptide linking'           y ARGININE                          ?                                       'C6 H15 N4 O2 1'   
175.209 
ASN 'L-peptide linking'           y ASPARAGINE                        ?                                       'C4 H8 N2 O3'      
132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                   ?                                       'C4 H7 N O4'       
133.103 
FRU 'D-saccharide, beta linking'  . beta-D-fructofuranose             'beta-D-fructose; D-fructose; fructose' 'C6 H12 O6'        
180.156 
GLC 'D-saccharide, alpha linking' . alpha-D-glucopyranose             'alpha-D-glucose; D-glucose; glucose'   'C6 H12 O6'        
180.156 
GLN 'L-peptide linking'           y GLUTAMINE                         ?                                       'C5 H10 N2 O3'     
146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                   ?                                       'C5 H9 N O4'       
147.129 
GLY 'peptide linking'             y GLYCINE                           ?                                       'C2 H5 N O2'       
75.067  
HEM non-polymer                   . 'PROTOPORPHYRIN IX CONTAINING FE' HEME                                    'C34 H32 Fe N4 O4' 
616.487 
HIS 'L-peptide linking'           y HISTIDINE                         ?                                       'C6 H10 N3 O2 1'   
156.162 
HOH non-polymer                   . WATER                             ?                                       'H2 O'             
18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                        ?                                       'C6 H13 N O2'      
131.173 
LEU 'L-peptide linking'           y LEUCINE                           ?                                       'C6 H13 N O2'      
131.173 
LYS 'L-peptide linking'           y LYSINE                            ?                                       'C6 H15 N2 O2 1'   
147.195 
MET 'L-peptide linking'           y METHIONINE                        ?                                       'C5 H11 N O2 S'    
149.211 
PHE 'L-peptide linking'           y PHENYLALANINE                     ?                                       'C9 H11 N O2'      
165.189 
PRO 'L-peptide linking'           y PROLINE                           ?                                       'C5 H9 N O2'       
115.130 
SER 'L-peptide linking'           y SERINE                            ?                                       'C3 H7 N O3'       
105.093 
SO4 non-polymer                   . 'SULFATE ION'                     ?                                       'O4 S -2'          
96.063  
THR 'L-peptide linking'           y THREONINE                         ?                                       'C4 H9 N O3'       
119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                        ?                                       'C11 H12 N2 O2'    
204.225 
TYR 'L-peptide linking'           y TYROSINE                          ?                                       'C9 H11 N O3'      
181.189 
VAL 'L-peptide linking'           y VALINE                            ?                                       'C5 H11 N O2'      
117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6M8F 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.13 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         60.76 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            296 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;A crystal was grown by mixing 1 ul of reservoir buffer (2 M ammonium sulfate, 0.2 M Tris pH 8.6) with 1 ul of protein in buffer (20 mM Tris pH 8.0, 1 mM EDTA). The crystal was cryoprotected by soaking it in a drop containing reservoir buffer supplemented with 25% sucrose for 5 minutes prior to being flash-cooled in liquid nitrogen
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-06-21 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9768 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9768 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_synchrotron_site       CHESS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6M8F 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.10 
_reflns.d_resolution_low                 39.43 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       76057 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             87.7 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.3 
_reflns.pdbx_Rmerge_I_obs                0.051 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            13.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.025 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.999 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.10 
_reflns_shell.d_res_low                   1.16 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           5028 
_reflns_shell.percent_possible_all        40.4 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.448 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             1.4 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             0.407 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.617 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6M8F 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.100 
_refine.ls_d_res_low                             32.163 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     76038 
_refine.ls_number_reflns_R_free                  3765 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    87.53 
_refine.ls_percent_reflns_R_free                 4.95 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1273 
_refine.ls_R_factor_R_free                       0.1458 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1263 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1JW8 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 14.27 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.07 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1216 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         81 
_refine_hist.number_atoms_solvent             224 
_refine_hist.number_atoms_total               1521 
_refine_hist.d_res_high                       1.100 
_refine_hist.d_res_low                        32.163 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.008  ? 1408 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.134  ? 1919 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 29.707 ? 524  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.076  ? 203  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.006  ? 230  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.1000 1.1139  . . 35  595  20.00  . . . 0.3356 . 0.3220 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.1139 1.1286  . . 48  1107 36.00  . . . 0.3029 . 0.2753 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.1286 1.1441  . . 67  1433 47.00  . . . 0.2604 . 0.2685 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.1441 1.1604  . . 97  1735 58.00  . . . 0.2407 . 0.2331 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.1604 1.1777  . . 125 2072 68.00  . . . 0.2374 . 0.2130 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.1777 1.1961  . . 115 2286 75.00  . . . 0.2226 . 0.1954 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.1961 1.2157  . . 111 2479 82.00  . . . 0.2123 . 0.1877 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.2157 1.2367  . . 145 2667 87.00  . . . 0.2217 . 0.1717 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.2367 1.2592  . . 171 2840 94.00  . . . 0.2009 . 0.1569 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.2592 1.2834  . . 159 2978 98.00  . . . 0.1482 . 0.1352 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.2834 1.3096  . . 134 2989 98.00  . . . 0.1589 . 0.1275 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.3096 1.3381  . . 165 3059 100.00 . . . 0.1485 . 0.1179 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.3381 1.3692  . . 156 3040 100.00 . . . 0.1224 . 0.1107 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.3692 1.4035  . . 127 3069 100.00 . . . 0.1375 . 0.1112 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.4035 1.4414  . . 141 3072 100.00 . . . 0.1181 . 0.1128 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.4414 1.4838  . . 149 3047 100.00 . . . 0.1132 . 0.1066 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.4838 1.5317  . . 161 3072 100.00 . . . 0.1426 . 0.0990 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.5317 1.5865  . . 139 3082 100.00 . . . 0.1158 . 0.1006 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.5865 1.6500  . . 190 3012 100.00 . . . 0.1169 . 0.1084 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.6500 1.7251  . . 148 3065 100.00 . . . 0.1381 . 0.1068 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7251 1.8160  . . 150 3098 100.00 . . . 0.1461 . 0.1104 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8160 1.9298  . . 159 3042 100.00 . . . 0.1221 . 0.1105 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9298 2.0788  . . 172 3063 100.00 . . . 0.1207 . 0.1149 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0788 2.2879  . . 151 3077 100.00 . . . 0.1247 . 0.1059 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2879 2.6188  . . 183 3056 100.00 . . . 0.1311 . 0.1131 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6188 3.2989  . . 209 3063 100.00 . . . 0.1513 . 0.1291 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2989 32.1765 . . 158 3175 100.00 . . . 0.1612 . 0.1434 . . . . . . . . . . 
# 
_struct.entry_id                     6M8F 
_struct.title                        'Engineered sperm whale myoglobin-based carbene transferase' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6M8F 
_struct_keywords.text            'Metalloprotein, myoglobin, carbene transferase, cyclopropanation, heme, TRANSFERASE' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 3 ? 
F N N 3 ? 
G N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 SER A 4   ? GLU A 19  ? SER A 3   GLU A 18  1 ? 16 
HELX_P HELX_P2 AA2 ASP A 21  ? HIS A 37  ? ASP A 20  HIS A 36  1 ? 17 
HELX_P HELX_P3 AA3 PRO A 38  ? PHE A 44  ? PRO A 37  PHE A 43  5 ? 7  
HELX_P HELX_P4 AA4 THR A 52  ? SER A 59  ? THR A 51  SER A 58  1 ? 8  
HELX_P HELX_P5 AA5 SER A 59  ? LYS A 79  ? SER A 58  LYS A 78  1 ? 21 
HELX_P HELX_P6 AA6 HIS A 83  ? LYS A 97  ? HIS A 82  LYS A 96  1 ? 15 
HELX_P HELX_P7 AA7 PRO A 101 ? HIS A 120 ? PRO A 100 HIS A 119 1 ? 20 
HELX_P HELX_P8 AA8 PRO A 121 ? PHE A 124 ? PRO A 120 PHE A 123 5 ? 4  
HELX_P HELX_P9 AA9 GLY A 125 ? LEU A 150 ? GLY A 124 LEU A 149 1 ? 26 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? B GLC .  C1  ? ? ? 1_555 B FRU . O2 ? ? B GLC 1   B FRU 2   1_555 ? ? ? ? ? ? ? 1.422 sing ? 
metalc1 metalc ?    ? A HIS 94 NE2 ? ? ? 1_555 D HEM . FE ? ? A HIS 93  A HEM 202 1_555 ? ? ? ? ? ? ? 2.112 ?    ? 
metalc2 metalc ?    ? D HEM .  FE  ? ? ? 1_555 G HOH . O  ? ? A HEM 202 A HOH 395 1_555 ? ? ? ? ? ? ? 2.164 ?    ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
_atom_sites.entry_id                    6M8F 
_atom_sites.fract_transf_matrix[1][1]   0.011016 
_atom_sites.fract_transf_matrix[1][2]   0.006360 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012720 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.021939 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
H  
N  
O  
S  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   0   0   MET MET A . n 
A 1 2   VAL 2   1   1   VAL VAL A . n 
A 1 3   LEU 3   2   2   LEU LEU A . n 
A 1 4   SER 4   3   3   SER SER A . n 
A 1 5   GLU 5   4   4   GLU GLU A . n 
A 1 6   GLY 6   5   5   GLY GLY A . n 
A 1 7   GLU 7   6   6   GLU GLU A . n 
A 1 8   TRP 8   7   7   TRP TRP A . n 
A 1 9   GLN 9   8   8   GLN GLN A . n 
A 1 10  LEU 10  9   9   LEU LEU A . n 
A 1 11  VAL 11  10  10  VAL VAL A . n 
A 1 12  LEU 12  11  11  LEU LEU A . n 
A 1 13  HIS 13  12  12  HIS HIS A . n 
A 1 14  VAL 14  13  13  VAL VAL A . n 
A 1 15  TRP 15  14  14  TRP TRP A . n 
A 1 16  ALA 16  15  15  ALA ALA A . n 
A 1 17  LYS 17  16  16  LYS LYS A . n 
A 1 18  VAL 18  17  17  VAL VAL A . n 
A 1 19  GLU 19  18  18  GLU GLU A . n 
A 1 20  ALA 20  19  19  ALA ALA A . n 
A 1 21  ASP 21  20  20  ASP ASP A . n 
A 1 22  VAL 22  21  21  VAL VAL A . n 
A 1 23  ALA 23  22  22  ALA ALA A . n 
A 1 24  GLY 24  23  23  GLY GLY A . n 
A 1 25  HIS 25  24  24  HIS HIS A . n 
A 1 26  GLY 26  25  25  GLY GLY A . n 
A 1 27  GLN 27  26  26  GLN GLN A . n 
A 1 28  ASP 28  27  27  ASP ASP A . n 
A 1 29  ILE 29  28  28  ILE ILE A . n 
A 1 30  LEU 30  29  29  LEU LEU A . n 
A 1 31  ILE 31  30  30  ILE ILE A . n 
A 1 32  ARG 32  31  31  ARG ARG A . n 
A 1 33  LEU 33  32  32  LEU LEU A . n 
A 1 34  PHE 34  33  33  PHE PHE A . n 
A 1 35  LYS 35  34  34  LYS LYS A . n 
A 1 36  SER 36  35  35  SER SER A . n 
A 1 37  HIS 37  36  36  HIS HIS A . n 
A 1 38  PRO 38  37  37  PRO PRO A . n 
A 1 39  GLU 39  38  38  GLU GLU A . n 
A 1 40  THR 40  39  39  THR THR A . n 
A 1 41  LEU 41  40  40  LEU LEU A . n 
A 1 42  GLU 42  41  41  GLU GLU A . n 
A 1 43  LYS 43  42  42  LYS LYS A . n 
A 1 44  PHE 44  43  43  PHE PHE A . n 
A 1 45  ASP 45  44  44  ASP ASP A . n 
A 1 46  ARG 46  45  45  ARG ARG A . n 
A 1 47  PHE 47  46  46  PHE PHE A . n 
A 1 48  LYS 48  47  47  LYS LYS A . n 
A 1 49  HIS 49  48  48  HIS HIS A . n 
A 1 50  LEU 50  49  49  LEU LEU A . n 
A 1 51  LYS 51  50  50  LYS LYS A . n 
A 1 52  THR 52  51  51  THR THR A . n 
A 1 53  GLU 53  52  52  GLU GLU A . n 
A 1 54  ALA 54  53  53  ALA ALA A . n 
A 1 55  GLU 55  54  54  GLU GLU A . n 
A 1 56  MET 56  55  55  MET MET A . n 
A 1 57  LYS 57  56  56  LYS LYS A . n 
A 1 58  ALA 58  57  57  ALA ALA A . n 
A 1 59  SER 59  58  58  SER SER A . n 
A 1 60  GLU 60  59  59  GLU GLU A . n 
A 1 61  ASP 61  60  60  ASP ASP A . n 
A 1 62  LEU 62  61  61  LEU LEU A . n 
A 1 63  LYS 63  62  62  LYS LYS A . n 
A 1 64  LYS 64  63  63  LYS LYS A . n 
A 1 65  VAL 65  64  64  VAL VAL A . n 
A 1 66  GLY 66  65  65  GLY GLY A . n 
A 1 67  VAL 67  66  66  VAL VAL A . n 
A 1 68  THR 68  67  67  THR THR A . n 
A 1 69  ALA 69  68  68  ALA ALA A . n 
A 1 70  LEU 70  69  69  LEU LEU A . n 
A 1 71  THR 71  70  70  THR THR A . n 
A 1 72  ALA 72  71  71  ALA ALA A . n 
A 1 73  LEU 73  72  72  LEU LEU A . n 
A 1 74  GLY 74  73  73  GLY GLY A . n 
A 1 75  ALA 75  74  74  ALA ALA A . n 
A 1 76  ILE 76  75  75  ILE ILE A . n 
A 1 77  LEU 77  76  76  LEU LEU A . n 
A 1 78  LYS 78  77  77  LYS LYS A . n 
A 1 79  LYS 79  78  78  LYS LYS A . n 
A 1 80  LYS 80  79  79  LYS LYS A . n 
A 1 81  GLY 81  80  80  GLY GLY A . n 
A 1 82  HIS 82  81  81  HIS HIS A . n 
A 1 83  HIS 83  82  82  HIS HIS A . n 
A 1 84  GLU 84  83  83  GLU GLU A . n 
A 1 85  ALA 85  84  84  ALA ALA A . n 
A 1 86  GLU 86  85  85  GLU GLU A . n 
A 1 87  LEU 87  86  86  LEU LEU A . n 
A 1 88  LYS 88  87  87  LYS LYS A . n 
A 1 89  PRO 89  88  88  PRO PRO A . n 
A 1 90  LEU 90  89  89  LEU LEU A . n 
A 1 91  ALA 91  90  90  ALA ALA A . n 
A 1 92  GLN 92  91  91  GLN GLN A . n 
A 1 93  SER 93  92  92  SER SER A . n 
A 1 94  HIS 94  93  93  HIS HIS A . n 
A 1 95  ALA 95  94  94  ALA ALA A . n 
A 1 96  THR 96  95  95  THR THR A . n 
A 1 97  LYS 97  96  96  LYS LYS A . n 
A 1 98  HIS 98  97  97  HIS HIS A . n 
A 1 99  LYS 99  98  98  LYS LYS A . n 
A 1 100 ILE 100 99  99  ILE ILE A . n 
A 1 101 PRO 101 100 100 PRO PRO A . n 
A 1 102 ILE 102 101 101 ILE ILE A . n 
A 1 103 LYS 103 102 102 LYS LYS A . n 
A 1 104 TYR 104 103 103 TYR TYR A . n 
A 1 105 LEU 105 104 104 LEU LEU A . n 
A 1 106 GLU 106 105 105 GLU GLU A . n 
A 1 107 PHE 107 106 106 PHE PHE A . n 
A 1 108 ILE 108 107 107 ILE ILE A . n 
A 1 109 SER 109 108 108 SER SER A . n 
A 1 110 GLU 110 109 109 GLU GLU A . n 
A 1 111 ALA 111 110 110 ALA ALA A . n 
A 1 112 ILE 112 111 111 ILE ILE A . n 
A 1 113 ILE 113 112 112 ILE ILE A . n 
A 1 114 HIS 114 113 113 HIS HIS A . n 
A 1 115 VAL 115 114 114 VAL VAL A . n 
A 1 116 LEU 116 115 115 LEU LEU A . n 
A 1 117 HIS 117 116 116 HIS HIS A . n 
A 1 118 SER 118 117 117 SER SER A . n 
A 1 119 ARG 119 118 118 ARG ARG A . n 
A 1 120 HIS 120 119 119 HIS HIS A . n 
A 1 121 PRO 121 120 120 PRO PRO A . n 
A 1 122 GLY 122 121 121 GLY GLY A . n 
A 1 123 ASN 123 122 122 ASN ASN A . n 
A 1 124 PHE 124 123 123 PHE PHE A . n 
A 1 125 GLY 125 124 124 GLY GLY A . n 
A 1 126 ALA 126 125 125 ALA ALA A . n 
A 1 127 ASP 127 126 126 ASP ASP A . n 
A 1 128 ALA 128 127 127 ALA ALA A . n 
A 1 129 GLN 129 128 128 GLN GLN A . n 
A 1 130 GLY 130 129 129 GLY GLY A . n 
A 1 131 ALA 131 130 130 ALA ALA A . n 
A 1 132 MET 132 131 131 MET MET A . n 
A 1 133 ASN 133 132 132 ASN ASN A . n 
A 1 134 LYS 134 133 133 LYS LYS A . n 
A 1 135 ALA 135 134 134 ALA ALA A . n 
A 1 136 LEU 136 135 135 LEU LEU A . n 
A 1 137 GLU 137 136 136 GLU GLU A . n 
A 1 138 LEU 138 137 137 LEU LEU A . n 
A 1 139 PHE 139 138 138 PHE PHE A . n 
A 1 140 ARG 140 139 139 ARG ARG A . n 
A 1 141 LYS 141 140 140 LYS LYS A . n 
A 1 142 ASP 142 141 141 ASP ASP A . n 
A 1 143 ILE 143 142 142 ILE ILE A . n 
A 1 144 ALA 144 143 143 ALA ALA A . n 
A 1 145 ALA 145 144 144 ALA ALA A . n 
A 1 146 LYS 146 145 145 LYS LYS A . n 
A 1 147 TYR 147 146 146 TYR TYR A . n 
A 1 148 LYS 148 147 147 LYS LYS A . n 
A 1 149 GLU 149 148 148 GLU GLU A . n 
A 1 150 LEU 150 149 149 LEU LEU A . n 
A 1 151 GLY 151 150 150 GLY GLY A . n 
A 1 152 TYR 152 151 151 TYR TYR A . n 
A 1 153 GLN 153 152 152 GLN GLN A . n 
A 1 154 GLY 154 153 153 GLY GLY A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 SO4 1   201 159 SO4 SO4 A . 
D 4 HEM 1   202 155 HEM HEM A . 
E 3 SO4 1   203 1   SO4 SO4 A . 
F 3 SO4 1   204 2   SO4 SO4 A . 
G 5 HOH 1   301 165 HOH HOH A . 
G 5 HOH 2   302 98  HOH HOH A . 
G 5 HOH 3   303 179 HOH HOH A . 
G 5 HOH 4   304 142 HOH HOH A . 
G 5 HOH 5   305 118 HOH HOH A . 
G 5 HOH 6   306 102 HOH HOH A . 
G 5 HOH 7   307 174 HOH HOH A . 
G 5 HOH 8   308 175 HOH HOH A . 
G 5 HOH 9   309 256 HOH HOH A . 
G 5 HOH 10  310 187 HOH HOH A . 
G 5 HOH 11  311 152 HOH HOH A . 
G 5 HOH 12  312 81  HOH HOH A . 
G 5 HOH 13  313 111 HOH HOH A . 
G 5 HOH 14  314 129 HOH HOH A . 
G 5 HOH 15  315 74  HOH HOH A . 
G 5 HOH 16  316 36  HOH HOH A . 
G 5 HOH 17  317 154 HOH HOH A . 
G 5 HOH 18  318 92  HOH HOH A . 
G 5 HOH 19  319 257 HOH HOH A . 
G 5 HOH 20  320 114 HOH HOH A . 
G 5 HOH 21  321 236 HOH HOH A . 
G 5 HOH 22  322 181 HOH HOH A . 
G 5 HOH 23  323 69  HOH HOH A . 
G 5 HOH 24  324 76  HOH HOH A . 
G 5 HOH 25  325 93  HOH HOH A . 
G 5 HOH 26  326 26  HOH HOH A . 
G 5 HOH 27  327 124 HOH HOH A . 
G 5 HOH 28  328 75  HOH HOH A . 
G 5 HOH 29  329 198 HOH HOH A . 
G 5 HOH 30  330 97  HOH HOH A . 
G 5 HOH 31  331 4   HOH HOH A . 
G 5 HOH 32  332 131 HOH HOH A . 
G 5 HOH 33  333 91  HOH HOH A . 
G 5 HOH 34  334 251 HOH HOH A . 
G 5 HOH 35  335 186 HOH HOH A . 
G 5 HOH 36  336 40  HOH HOH A . 
G 5 HOH 37  337 21  HOH HOH A . 
G 5 HOH 38  338 45  HOH HOH A . 
G 5 HOH 39  339 29  HOH HOH A . 
G 5 HOH 40  340 15  HOH HOH A . 
G 5 HOH 41  341 116 HOH HOH A . 
G 5 HOH 42  342 77  HOH HOH A . 
G 5 HOH 43  343 79  HOH HOH A . 
G 5 HOH 44  344 57  HOH HOH A . 
G 5 HOH 45  345 155 HOH HOH A . 
G 5 HOH 46  346 18  HOH HOH A . 
G 5 HOH 47  347 32  HOH HOH A . 
G 5 HOH 48  348 163 HOH HOH A . 
G 5 HOH 49  349 240 HOH HOH A . 
G 5 HOH 50  350 218 HOH HOH A . 
G 5 HOH 51  351 41  HOH HOH A . 
G 5 HOH 52  352 246 HOH HOH A . 
G 5 HOH 53  353 43  HOH HOH A . 
G 5 HOH 54  354 46  HOH HOH A . 
G 5 HOH 55  355 90  HOH HOH A . 
G 5 HOH 56  356 51  HOH HOH A . 
G 5 HOH 57  357 137 HOH HOH A . 
G 5 HOH 58  358 8   HOH HOH A . 
G 5 HOH 59  359 19  HOH HOH A . 
G 5 HOH 60  360 1   HOH HOH A . 
G 5 HOH 61  361 11  HOH HOH A . 
G 5 HOH 62  362 20  HOH HOH A . 
G 5 HOH 63  363 67  HOH HOH A . 
G 5 HOH 64  364 33  HOH HOH A . 
G 5 HOH 65  365 192 HOH HOH A . 
G 5 HOH 66  366 6   HOH HOH A . 
G 5 HOH 67  367 133 HOH HOH A . 
G 5 HOH 68  368 31  HOH HOH A . 
G 5 HOH 69  369 48  HOH HOH A . 
G 5 HOH 70  370 103 HOH HOH A . 
G 5 HOH 71  371 65  HOH HOH A . 
G 5 HOH 72  372 7   HOH HOH A . 
G 5 HOH 73  373 5   HOH HOH A . 
G 5 HOH 74  374 2   HOH HOH A . 
G 5 HOH 75  375 37  HOH HOH A . 
G 5 HOH 76  376 22  HOH HOH A . 
G 5 HOH 77  377 54  HOH HOH A . 
G 5 HOH 78  378 86  HOH HOH A . 
G 5 HOH 79  379 60  HOH HOH A . 
G 5 HOH 80  380 139 HOH HOH A . 
G 5 HOH 81  381 55  HOH HOH A . 
G 5 HOH 82  382 71  HOH HOH A . 
G 5 HOH 83  383 144 HOH HOH A . 
G 5 HOH 84  384 39  HOH HOH A . 
G 5 HOH 85  385 127 HOH HOH A . 
G 5 HOH 86  386 184 HOH HOH A . 
G 5 HOH 87  387 53  HOH HOH A . 
G 5 HOH 88  388 85  HOH HOH A . 
G 5 HOH 89  389 151 HOH HOH A . 
G 5 HOH 90  390 206 HOH HOH A . 
G 5 HOH 91  391 101 HOH HOH A . 
G 5 HOH 92  392 231 HOH HOH A . 
G 5 HOH 93  393 58  HOH HOH A . 
G 5 HOH 94  394 12  HOH HOH A . 
G 5 HOH 95  395 158 HOH HOH A . 
G 5 HOH 96  396 100 HOH HOH A . 
G 5 HOH 97  397 113 HOH HOH A . 
G 5 HOH 98  398 159 HOH HOH A . 
G 5 HOH 99  399 66  HOH HOH A . 
G 5 HOH 100 400 125 HOH HOH A . 
G 5 HOH 101 401 14  HOH HOH A . 
G 5 HOH 102 402 24  HOH HOH A . 
G 5 HOH 103 403 132 HOH HOH A . 
G 5 HOH 104 404 225 HOH HOH A . 
G 5 HOH 105 405 89  HOH HOH A . 
G 5 HOH 106 406 255 HOH HOH A . 
G 5 HOH 107 407 3   HOH HOH A . 
G 5 HOH 108 408 188 HOH HOH A . 
G 5 HOH 109 409 112 HOH HOH A . 
G 5 HOH 110 410 25  HOH HOH A . 
G 5 HOH 111 411 42  HOH HOH A . 
G 5 HOH 112 412 172 HOH HOH A . 
G 5 HOH 113 413 83  HOH HOH A . 
G 5 HOH 114 414 195 HOH HOH A . 
G 5 HOH 115 415 99  HOH HOH A . 
G 5 HOH 116 416 84  HOH HOH A . 
G 5 HOH 117 417 135 HOH HOH A . 
G 5 HOH 118 418 44  HOH HOH A . 
G 5 HOH 119 419 205 HOH HOH A . 
G 5 HOH 120 420 52  HOH HOH A . 
G 5 HOH 121 421 35  HOH HOH A . 
G 5 HOH 122 422 73  HOH HOH A . 
G 5 HOH 123 423 34  HOH HOH A . 
G 5 HOH 124 424 62  HOH HOH A . 
G 5 HOH 125 425 50  HOH HOH A . 
G 5 HOH 126 426 180 HOH HOH A . 
G 5 HOH 127 427 68  HOH HOH A . 
G 5 HOH 128 428 87  HOH HOH A . 
G 5 HOH 129 429 59  HOH HOH A . 
G 5 HOH 130 430 238 HOH HOH A . 
G 5 HOH 131 431 252 HOH HOH A . 
G 5 HOH 132 432 220 HOH HOH A . 
G 5 HOH 133 433 204 HOH HOH A . 
G 5 HOH 134 434 123 HOH HOH A . 
G 5 HOH 135 435 161 HOH HOH A . 
G 5 HOH 136 436 190 HOH HOH A . 
G 5 HOH 137 437 10  HOH HOH A . 
G 5 HOH 138 438 221 HOH HOH A . 
G 5 HOH 139 439 226 HOH HOH A . 
G 5 HOH 140 440 177 HOH HOH A . 
G 5 HOH 141 441 223 HOH HOH A . 
G 5 HOH 142 442 183 HOH HOH A . 
G 5 HOH 143 443 17  HOH HOH A . 
G 5 HOH 144 444 27  HOH HOH A . 
G 5 HOH 145 445 185 HOH HOH A . 
G 5 HOH 146 446 234 HOH HOH A . 
G 5 HOH 147 447 241 HOH HOH A . 
G 5 HOH 148 448 217 HOH HOH A . 
G 5 HOH 149 449 107 HOH HOH A . 
G 5 HOH 150 450 104 HOH HOH A . 
G 5 HOH 151 451 134 HOH HOH A . 
G 5 HOH 152 452 13  HOH HOH A . 
G 5 HOH 153 453 143 HOH HOH A . 
G 5 HOH 154 454 227 HOH HOH A . 
G 5 HOH 155 455 250 HOH HOH A . 
G 5 HOH 156 456 122 HOH HOH A . 
G 5 HOH 157 457 64  HOH HOH A . 
G 5 HOH 158 458 237 HOH HOH A . 
G 5 HOH 159 459 56  HOH HOH A . 
G 5 HOH 160 460 167 HOH HOH A . 
G 5 HOH 161 461 168 HOH HOH A . 
G 5 HOH 162 462 202 HOH HOH A . 
G 5 HOH 163 463 191 HOH HOH A . 
G 5 HOH 164 464 9   HOH HOH A . 
G 5 HOH 165 465 16  HOH HOH A . 
G 5 HOH 166 466 30  HOH HOH A . 
G 5 HOH 167 467 88  HOH HOH A . 
G 5 HOH 168 468 128 HOH HOH A . 
G 5 HOH 169 469 208 HOH HOH A . 
G 5 HOH 170 470 119 HOH HOH A . 
G 5 HOH 171 471 229 HOH HOH A . 
G 5 HOH 172 472 150 HOH HOH A . 
G 5 HOH 173 473 193 HOH HOH A . 
G 5 HOH 174 474 244 HOH HOH A . 
G 5 HOH 175 475 61  HOH HOH A . 
G 5 HOH 176 476 157 HOH HOH A . 
G 5 HOH 177 477 115 HOH HOH A . 
G 5 HOH 178 478 199 HOH HOH A . 
G 5 HOH 179 479 47  HOH HOH A . 
G 5 HOH 180 480 160 HOH HOH A . 
G 5 HOH 181 481 72  HOH HOH A . 
G 5 HOH 182 482 23  HOH HOH A . 
G 5 HOH 183 483 149 HOH HOH A . 
G 5 HOH 184 484 239 HOH HOH A . 
G 5 HOH 185 485 121 HOH HOH A . 
G 5 HOH 186 486 216 HOH HOH A . 
G 5 HOH 187 487 153 HOH HOH A . 
G 5 HOH 188 488 106 HOH HOH A . 
G 5 HOH 189 489 138 HOH HOH A . 
G 5 HOH 190 490 228 HOH HOH A . 
G 5 HOH 191 491 207 HOH HOH A . 
G 5 HOH 192 492 254 HOH HOH A . 
G 5 HOH 193 493 70  HOH HOH A . 
G 5 HOH 194 494 164 HOH HOH A . 
G 5 HOH 195 495 110 HOH HOH A . 
G 5 HOH 196 496 200 HOH HOH A . 
G 5 HOH 197 497 49  HOH HOH A . 
G 5 HOH 198 498 80  HOH HOH A . 
G 5 HOH 199 499 210 HOH HOH A . 
G 5 HOH 200 500 156 HOH HOH A . 
G 5 HOH 201 501 245 HOH HOH A . 
G 5 HOH 202 502 197 HOH HOH A . 
G 5 HOH 203 503 130 HOH HOH A . 
G 5 HOH 204 504 222 HOH HOH A . 
G 5 HOH 205 505 194 HOH HOH A . 
G 5 HOH 206 506 147 HOH HOH A . 
G 5 HOH 207 507 219 HOH HOH A . 
G 5 HOH 208 508 201 HOH HOH A . 
G 5 HOH 209 509 242 HOH HOH A . 
G 5 HOH 210 510 253 HOH HOH A . 
G 5 HOH 211 511 209 HOH HOH A . 
G 5 HOH 212 512 109 HOH HOH A . 
G 5 HOH 213 513 105 HOH HOH A . 
G 5 HOH 214 514 196 HOH HOH A . 
G 5 HOH 215 515 95  HOH HOH A . 
G 5 HOH 216 516 182 HOH HOH A . 
G 5 HOH 217 517 141 HOH HOH A . 
G 5 HOH 218 518 78  HOH HOH A . 
G 5 HOH 219 519 117 HOH HOH A . 
G 5 HOH 220 520 38  HOH HOH A . 
G 5 HOH 221 521 214 HOH HOH A . 
G 5 HOH 222 522 213 HOH HOH A . 
G 5 HOH 223 523 96  HOH HOH A . 
G 5 HOH 224 524 146 HOH HOH A . 
# 
_pdbx_molecule_features.prd_id    PRD_900003 
_pdbx_molecule_features.name      sucrose 
_pdbx_molecule_features.type      Oligosaccharide 
_pdbx_molecule_features.class     Nutrient 
_pdbx_molecule_features.details   'oligosaccharide with reducing-end-to-reducing-end glycosidic bond' 
# 
_pdbx_molecule.instance_id   1 
_pdbx_molecule.prd_id        PRD_900003 
_pdbx_molecule.asym_id       B 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     492 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   G 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 94 ? A HIS 93  ? 1_555 FE ? D HEM . ? A HEM 202 ? 1_555 NA ? D HEM . ? A HEM 202 ? 1_555 90.3  ? 
2  NE2 ? A HIS 94 ? A HIS 93  ? 1_555 FE ? D HEM . ? A HEM 202 ? 1_555 NB ? D HEM . ? A HEM 202 ? 1_555 91.2  ? 
3  NA  ? D HEM .  ? A HEM 202 ? 1_555 FE ? D HEM . ? A HEM 202 ? 1_555 NB ? D HEM . ? A HEM 202 ? 1_555 89.5  ? 
4  NE2 ? A HIS 94 ? A HIS 93  ? 1_555 FE ? D HEM . ? A HEM 202 ? 1_555 NC ? D HEM . ? A HEM 202 ? 1_555 94.3  ? 
5  NA  ? D HEM .  ? A HEM 202 ? 1_555 FE ? D HEM . ? A HEM 202 ? 1_555 NC ? D HEM . ? A HEM 202 ? 1_555 175.4 ? 
6  NB  ? D HEM .  ? A HEM 202 ? 1_555 FE ? D HEM . ? A HEM 202 ? 1_555 NC ? D HEM . ? A HEM 202 ? 1_555 89.9  ? 
7  NE2 ? A HIS 94 ? A HIS 93  ? 1_555 FE ? D HEM . ? A HEM 202 ? 1_555 ND ? D HEM . ? A HEM 202 ? 1_555 93.6  ? 
8  NA  ? D HEM .  ? A HEM 202 ? 1_555 FE ? D HEM . ? A HEM 202 ? 1_555 ND ? D HEM . ? A HEM 202 ? 1_555 90.4  ? 
9  NB  ? D HEM .  ? A HEM 202 ? 1_555 FE ? D HEM . ? A HEM 202 ? 1_555 ND ? D HEM . ? A HEM 202 ? 1_555 175.1 ? 
10 NC  ? D HEM .  ? A HEM 202 ? 1_555 FE ? D HEM . ? A HEM 202 ? 1_555 ND ? D HEM . ? A HEM 202 ? 1_555 89.8  ? 
11 NE2 ? A HIS 94 ? A HIS 93  ? 1_555 FE ? D HEM . ? A HEM 202 ? 1_555 O  ? G HOH . ? A HOH 395 ? 1_555 176.8 ? 
12 NA  ? D HEM .  ? A HEM 202 ? 1_555 FE ? D HEM . ? A HEM 202 ? 1_555 O  ? G HOH . ? A HOH 395 ? 1_555 86.5  ? 
13 NB  ? D HEM .  ? A HEM 202 ? 1_555 FE ? D HEM . ? A HEM 202 ? 1_555 O  ? G HOH . ? A HOH 395 ? 1_555 89.4  ? 
14 NC  ? D HEM .  ? A HEM 202 ? 1_555 FE ? D HEM . ? A HEM 202 ? 1_555 O  ? G HOH . ? A HOH 395 ? 1_555 88.9  ? 
15 ND  ? D HEM .  ? A HEM 202 ? 1_555 FE ? D HEM . ? A HEM 202 ? 1_555 O  ? G HOH . ? A HOH 395 ? 1_555 85.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2019-01-23 
2 'Structure model' 1 1 2019-06-12 
3 'Structure model' 2 0 2020-07-29 
4 'Structure model' 2 1 2023-10-11 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 3 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Data collection'         
2  2 'Structure model' 'Database references'     
3  3 'Structure model' 'Atomic model'            
4  3 'Structure model' 'Data collection'         
5  3 'Structure model' 'Derived calculations'    
6  3 'Structure model' 'Non-polymer description' 
7  3 'Structure model' 'Structure summary'       
8  4 'Structure model' 'Data collection'         
9  4 'Structure model' 'Database references'     
10 4 'Structure model' 'Refinement description'  
11 4 'Structure model' 'Structure summary'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  2 'Structure model' citation                      
2  3 'Structure model' atom_site                     
3  3 'Structure model' atom_site_anisotrop           
4  3 'Structure model' chem_comp                     
5  3 'Structure model' entity                        
6  3 'Structure model' entity_name_com               
7  3 'Structure model' pdbx_branch_scheme            
8  3 'Structure model' pdbx_chem_comp_identifier     
9  3 'Structure model' pdbx_entity_branch            
10 3 'Structure model' pdbx_entity_branch_descriptor 
11 3 'Structure model' pdbx_entity_branch_link       
12 3 'Structure model' pdbx_entity_branch_list       
13 3 'Structure model' pdbx_entity_nonpoly           
14 3 'Structure model' pdbx_molecule_features        
15 3 'Structure model' pdbx_nonpoly_scheme           
16 3 'Structure model' pdbx_struct_conn_angle        
17 3 'Structure model' struct_asym                   
18 3 'Structure model' struct_conn                   
19 3 'Structure model' struct_conn_type              
20 3 'Structure model' struct_site                   
21 3 'Structure model' struct_site_gen               
22 4 'Structure model' chem_comp                     
23 4 'Structure model' chem_comp_atom                
24 4 'Structure model' chem_comp_bond                
25 4 'Structure model' database_2                    
26 4 'Structure model' pdbx_initial_refinement_model 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                           
2  2 'Structure model' '_citation.journal_abbrev'                    
3  2 'Structure model' '_citation.journal_id_CSD'                    
4  2 'Structure model' '_citation.journal_id_ISSN'                   
5  2 'Structure model' '_citation.journal_volume'                    
6  2 'Structure model' '_citation.page_first'                        
7  2 'Structure model' '_citation.page_last'                         
8  2 'Structure model' '_citation.pdbx_database_id_DOI'              
9  2 'Structure model' '_citation.pdbx_database_id_PubMed'           
10 2 'Structure model' '_citation.title'                             
11 2 'Structure model' '_citation.year'                              
12 3 'Structure model' '_atom_site.B_iso_or_equiv'                   
13 3 'Structure model' '_atom_site.Cartn_x'                          
14 3 'Structure model' '_atom_site.Cartn_y'                          
15 3 'Structure model' '_atom_site.Cartn_z'                          
16 3 'Structure model' '_atom_site.auth_asym_id'                     
17 3 'Structure model' '_atom_site.auth_atom_id'                     
18 3 'Structure model' '_atom_site.auth_comp_id'                     
19 3 'Structure model' '_atom_site.auth_seq_id'                      
20 3 'Structure model' '_atom_site.label_asym_id'                    
21 3 'Structure model' '_atom_site.label_atom_id'                    
22 3 'Structure model' '_atom_site.label_comp_id'                    
23 3 'Structure model' '_atom_site.label_entity_id'                  
24 3 'Structure model' '_atom_site.type_symbol'                      
25 3 'Structure model' '_atom_site_anisotrop.id'                     
26 3 'Structure model' '_atom_site_anisotrop.pdbx_label_asym_id'     
27 3 'Structure model' '_chem_comp.formula'                          
28 3 'Structure model' '_chem_comp.formula_weight'                   
29 3 'Structure model' '_chem_comp.id'                               
30 3 'Structure model' '_chem_comp.mon_nstd_flag'                    
31 3 'Structure model' '_chem_comp.name'                             
32 3 'Structure model' '_chem_comp.pdbx_synonyms'                    
33 3 'Structure model' '_chem_comp.type'                             
34 3 'Structure model' '_entity.formula_weight'                      
35 3 'Structure model' '_entity.pdbx_description'                    
36 3 'Structure model' '_entity.pdbx_number_of_molecules'            
37 3 'Structure model' '_entity.src_method'                          
38 3 'Structure model' '_entity.type'                                
39 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
40 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
41 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
42 3 'Structure model' '_struct_asym.entity_id'                      
43 4 'Structure model' '_chem_comp.pdbx_synonyms'                    
44 4 'Structure model' '_database_2.pdbx_DOI'                        
45 4 'Structure model' '_database_2.pdbx_database_accession'         
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10_2155: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? .                  2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? SCALA  ? ? ? .                  3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? .                  4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 20  ? ? -157.08 73.81 
2 1 PHE A 46  ? ? -144.59 26.83 
3 1 LYS A 98  ? ? 61.94   61.85 
4 1 PHE A 123 ? ? -141.46 49.78 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 523 ? 6.46 . 
2 1 O ? A HOH 524 ? 6.55 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 102 ? CG ? A LYS 103 CG 
2 1 Y 1 A LYS 102 ? CD ? A LYS 103 CD 
3 1 Y 1 A LYS 102 ? CE ? A LYS 103 CE 
4 1 Y 1 A LYS 102 ? NZ ? A LYS 103 NZ 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
FRU C1   C  N N 74  
FRU C2   C  N R 75  
FRU C3   C  N S 76  
FRU C4   C  N S 77  
FRU C5   C  N R 78  
FRU C6   C  N N 79  
FRU O1   O  N N 80  
FRU O2   O  N N 81  
FRU O3   O  N N 82  
FRU O4   O  N N 83  
FRU O5   O  N N 84  
FRU O6   O  N N 85  
FRU H11  H  N N 86  
FRU H12  H  N N 87  
FRU H3   H  N N 88  
FRU H4   H  N N 89  
FRU H5   H  N N 90  
FRU H61  H  N N 91  
FRU H62  H  N N 92  
FRU HO1  H  N N 93  
FRU HO2  H  N N 94  
FRU HO3  H  N N 95  
FRU HO4  H  N N 96  
FRU HO6  H  N N 97  
GLC C1   C  N S 98  
GLC C2   C  N R 99  
GLC C3   C  N S 100 
GLC C4   C  N S 101 
GLC C5   C  N R 102 
GLC C6   C  N N 103 
GLC O1   O  N N 104 
GLC O2   O  N N 105 
GLC O3   O  N N 106 
GLC O4   O  N N 107 
GLC O5   O  N N 108 
GLC O6   O  N N 109 
GLC H1   H  N N 110 
GLC H2   H  N N 111 
GLC H3   H  N N 112 
GLC H4   H  N N 113 
GLC H5   H  N N 114 
GLC H61  H  N N 115 
GLC H62  H  N N 116 
GLC HO1  H  N N 117 
GLC HO2  H  N N 118 
GLC HO3  H  N N 119 
GLC HO4  H  N N 120 
GLC HO6  H  N N 121 
GLN N    N  N N 122 
GLN CA   C  N S 123 
GLN C    C  N N 124 
GLN O    O  N N 125 
GLN CB   C  N N 126 
GLN CG   C  N N 127 
GLN CD   C  N N 128 
GLN OE1  O  N N 129 
GLN NE2  N  N N 130 
GLN OXT  O  N N 131 
GLN H    H  N N 132 
GLN H2   H  N N 133 
GLN HA   H  N N 134 
GLN HB2  H  N N 135 
GLN HB3  H  N N 136 
GLN HG2  H  N N 137 
GLN HG3  H  N N 138 
GLN HE21 H  N N 139 
GLN HE22 H  N N 140 
GLN HXT  H  N N 141 
GLU N    N  N N 142 
GLU CA   C  N S 143 
GLU C    C  N N 144 
GLU O    O  N N 145 
GLU CB   C  N N 146 
GLU CG   C  N N 147 
GLU CD   C  N N 148 
GLU OE1  O  N N 149 
GLU OE2  O  N N 150 
GLU OXT  O  N N 151 
GLU H    H  N N 152 
GLU H2   H  N N 153 
GLU HA   H  N N 154 
GLU HB2  H  N N 155 
GLU HB3  H  N N 156 
GLU HG2  H  N N 157 
GLU HG3  H  N N 158 
GLU HE2  H  N N 159 
GLU HXT  H  N N 160 
GLY N    N  N N 161 
GLY CA   C  N N 162 
GLY C    C  N N 163 
GLY O    O  N N 164 
GLY OXT  O  N N 165 
GLY H    H  N N 166 
GLY H2   H  N N 167 
GLY HA2  H  N N 168 
GLY HA3  H  N N 169 
GLY HXT  H  N N 170 
HEM CHA  C  N N 171 
HEM CHB  C  N N 172 
HEM CHC  C  N N 173 
HEM CHD  C  N N 174 
HEM C1A  C  Y N 175 
HEM C2A  C  Y N 176 
HEM C3A  C  Y N 177 
HEM C4A  C  Y N 178 
HEM CMA  C  N N 179 
HEM CAA  C  N N 180 
HEM CBA  C  N N 181 
HEM CGA  C  N N 182 
HEM O1A  O  N N 183 
HEM O2A  O  N N 184 
HEM C1B  C  N N 185 
HEM C2B  C  N N 186 
HEM C3B  C  N N 187 
HEM C4B  C  N N 188 
HEM CMB  C  N N 189 
HEM CAB  C  N N 190 
HEM CBB  C  N N 191 
HEM C1C  C  Y N 192 
HEM C2C  C  Y N 193 
HEM C3C  C  Y N 194 
HEM C4C  C  Y N 195 
HEM CMC  C  N N 196 
HEM CAC  C  N N 197 
HEM CBC  C  N N 198 
HEM C1D  C  N N 199 
HEM C2D  C  N N 200 
HEM C3D  C  N N 201 
HEM C4D  C  N N 202 
HEM CMD  C  N N 203 
HEM CAD  C  N N 204 
HEM CBD  C  N N 205 
HEM CGD  C  N N 206 
HEM O1D  O  N N 207 
HEM O2D  O  N N 208 
HEM NA   N  Y N 209 
HEM NB   N  N N 210 
HEM NC   N  Y N 211 
HEM ND   N  N N 212 
HEM FE   FE N N 213 
HEM HHB  H  N N 214 
HEM HHC  H  N N 215 
HEM HHD  H  N N 216 
HEM HMA  H  N N 217 
HEM HMAA H  N N 218 
HEM HMAB H  N N 219 
HEM HAA  H  N N 220 
HEM HAAA H  N N 221 
HEM HBA  H  N N 222 
HEM HBAA H  N N 223 
HEM HMB  H  N N 224 
HEM HMBA H  N N 225 
HEM HMBB H  N N 226 
HEM HAB  H  N N 227 
HEM HBB  H  N N 228 
HEM HBBA H  N N 229 
HEM HMC  H  N N 230 
HEM HMCA H  N N 231 
HEM HMCB H  N N 232 
HEM HAC  H  N N 233 
HEM HBC  H  N N 234 
HEM HBCA H  N N 235 
HEM HMD  H  N N 236 
HEM HMDA H  N N 237 
HEM HMDB H  N N 238 
HEM HAD  H  N N 239 
HEM HADA H  N N 240 
HEM HBD  H  N N 241 
HEM HBDA H  N N 242 
HEM H2A  H  N N 243 
HEM H2D  H  N N 244 
HEM HHA  H  N N 245 
HIS N    N  N N 246 
HIS CA   C  N S 247 
HIS C    C  N N 248 
HIS O    O  N N 249 
HIS CB   C  N N 250 
HIS CG   C  Y N 251 
HIS ND1  N  Y N 252 
HIS CD2  C  Y N 253 
HIS CE1  C  Y N 254 
HIS NE2  N  Y N 255 
HIS OXT  O  N N 256 
HIS H    H  N N 257 
HIS H2   H  N N 258 
HIS HA   H  N N 259 
HIS HB2  H  N N 260 
HIS HB3  H  N N 261 
HIS HD1  H  N N 262 
HIS HD2  H  N N 263 
HIS HE1  H  N N 264 
HIS HE2  H  N N 265 
HIS HXT  H  N N 266 
HOH O    O  N N 267 
HOH H1   H  N N 268 
HOH H2   H  N N 269 
ILE N    N  N N 270 
ILE CA   C  N S 271 
ILE C    C  N N 272 
ILE O    O  N N 273 
ILE CB   C  N S 274 
ILE CG1  C  N N 275 
ILE CG2  C  N N 276 
ILE CD1  C  N N 277 
ILE OXT  O  N N 278 
ILE H    H  N N 279 
ILE H2   H  N N 280 
ILE HA   H  N N 281 
ILE HB   H  N N 282 
ILE HG12 H  N N 283 
ILE HG13 H  N N 284 
ILE HG21 H  N N 285 
ILE HG22 H  N N 286 
ILE HG23 H  N N 287 
ILE HD11 H  N N 288 
ILE HD12 H  N N 289 
ILE HD13 H  N N 290 
ILE HXT  H  N N 291 
LEU N    N  N N 292 
LEU CA   C  N S 293 
LEU C    C  N N 294 
LEU O    O  N N 295 
LEU CB   C  N N 296 
LEU CG   C  N N 297 
LEU CD1  C  N N 298 
LEU CD2  C  N N 299 
LEU OXT  O  N N 300 
LEU H    H  N N 301 
LEU H2   H  N N 302 
LEU HA   H  N N 303 
LEU HB2  H  N N 304 
LEU HB3  H  N N 305 
LEU HG   H  N N 306 
LEU HD11 H  N N 307 
LEU HD12 H  N N 308 
LEU HD13 H  N N 309 
LEU HD21 H  N N 310 
LEU HD22 H  N N 311 
LEU HD23 H  N N 312 
LEU HXT  H  N N 313 
LYS N    N  N N 314 
LYS CA   C  N S 315 
LYS C    C  N N 316 
LYS O    O  N N 317 
LYS CB   C  N N 318 
LYS CG   C  N N 319 
LYS CD   C  N N 320 
LYS CE   C  N N 321 
LYS NZ   N  N N 322 
LYS OXT  O  N N 323 
LYS H    H  N N 324 
LYS H2   H  N N 325 
LYS HA   H  N N 326 
LYS HB2  H  N N 327 
LYS HB3  H  N N 328 
LYS HG2  H  N N 329 
LYS HG3  H  N N 330 
LYS HD2  H  N N 331 
LYS HD3  H  N N 332 
LYS HE2  H  N N 333 
LYS HE3  H  N N 334 
LYS HZ1  H  N N 335 
LYS HZ2  H  N N 336 
LYS HZ3  H  N N 337 
LYS HXT  H  N N 338 
MET N    N  N N 339 
MET CA   C  N S 340 
MET C    C  N N 341 
MET O    O  N N 342 
MET CB   C  N N 343 
MET CG   C  N N 344 
MET SD   S  N N 345 
MET CE   C  N N 346 
MET OXT  O  N N 347 
MET H    H  N N 348 
MET H2   H  N N 349 
MET HA   H  N N 350 
MET HB2  H  N N 351 
MET HB3  H  N N 352 
MET HG2  H  N N 353 
MET HG3  H  N N 354 
MET HE1  H  N N 355 
MET HE2  H  N N 356 
MET HE3  H  N N 357 
MET HXT  H  N N 358 
PHE N    N  N N 359 
PHE CA   C  N S 360 
PHE C    C  N N 361 
PHE O    O  N N 362 
PHE CB   C  N N 363 
PHE CG   C  Y N 364 
PHE CD1  C  Y N 365 
PHE CD2  C  Y N 366 
PHE CE1  C  Y N 367 
PHE CE2  C  Y N 368 
PHE CZ   C  Y N 369 
PHE OXT  O  N N 370 
PHE H    H  N N 371 
PHE H2   H  N N 372 
PHE HA   H  N N 373 
PHE HB2  H  N N 374 
PHE HB3  H  N N 375 
PHE HD1  H  N N 376 
PHE HD2  H  N N 377 
PHE HE1  H  N N 378 
PHE HE2  H  N N 379 
PHE HZ   H  N N 380 
PHE HXT  H  N N 381 
PRO N    N  N N 382 
PRO CA   C  N S 383 
PRO C    C  N N 384 
PRO O    O  N N 385 
PRO CB   C  N N 386 
PRO CG   C  N N 387 
PRO CD   C  N N 388 
PRO OXT  O  N N 389 
PRO H    H  N N 390 
PRO HA   H  N N 391 
PRO HB2  H  N N 392 
PRO HB3  H  N N 393 
PRO HG2  H  N N 394 
PRO HG3  H  N N 395 
PRO HD2  H  N N 396 
PRO HD3  H  N N 397 
PRO HXT  H  N N 398 
SER N    N  N N 399 
SER CA   C  N S 400 
SER C    C  N N 401 
SER O    O  N N 402 
SER CB   C  N N 403 
SER OG   O  N N 404 
SER OXT  O  N N 405 
SER H    H  N N 406 
SER H2   H  N N 407 
SER HA   H  N N 408 
SER HB2  H  N N 409 
SER HB3  H  N N 410 
SER HG   H  N N 411 
SER HXT  H  N N 412 
SO4 S    S  N N 413 
SO4 O1   O  N N 414 
SO4 O2   O  N N 415 
SO4 O3   O  N N 416 
SO4 O4   O  N N 417 
THR N    N  N N 418 
THR CA   C  N S 419 
THR C    C  N N 420 
THR O    O  N N 421 
THR CB   C  N R 422 
THR OG1  O  N N 423 
THR CG2  C  N N 424 
THR OXT  O  N N 425 
THR H    H  N N 426 
THR H2   H  N N 427 
THR HA   H  N N 428 
THR HB   H  N N 429 
THR HG1  H  N N 430 
THR HG21 H  N N 431 
THR HG22 H  N N 432 
THR HG23 H  N N 433 
THR HXT  H  N N 434 
TRP N    N  N N 435 
TRP CA   C  N S 436 
TRP C    C  N N 437 
TRP O    O  N N 438 
TRP CB   C  N N 439 
TRP CG   C  Y N 440 
TRP CD1  C  Y N 441 
TRP CD2  C  Y N 442 
TRP NE1  N  Y N 443 
TRP CE2  C  Y N 444 
TRP CE3  C  Y N 445 
TRP CZ2  C  Y N 446 
TRP CZ3  C  Y N 447 
TRP CH2  C  Y N 448 
TRP OXT  O  N N 449 
TRP H    H  N N 450 
TRP H2   H  N N 451 
TRP HA   H  N N 452 
TRP HB2  H  N N 453 
TRP HB3  H  N N 454 
TRP HD1  H  N N 455 
TRP HE1  H  N N 456 
TRP HE3  H  N N 457 
TRP HZ2  H  N N 458 
TRP HZ3  H  N N 459 
TRP HH2  H  N N 460 
TRP HXT  H  N N 461 
TYR N    N  N N 462 
TYR CA   C  N S 463 
TYR C    C  N N 464 
TYR O    O  N N 465 
TYR CB   C  N N 466 
TYR CG   C  Y N 467 
TYR CD1  C  Y N 468 
TYR CD2  C  Y N 469 
TYR CE1  C  Y N 470 
TYR CE2  C  Y N 471 
TYR CZ   C  Y N 472 
TYR OH   O  N N 473 
TYR OXT  O  N N 474 
TYR H    H  N N 475 
TYR H2   H  N N 476 
TYR HA   H  N N 477 
TYR HB2  H  N N 478 
TYR HB3  H  N N 479 
TYR HD1  H  N N 480 
TYR HD2  H  N N 481 
TYR HE1  H  N N 482 
TYR HE2  H  N N 483 
TYR HH   H  N N 484 
TYR HXT  H  N N 485 
VAL N    N  N N 486 
VAL CA   C  N S 487 
VAL C    C  N N 488 
VAL O    O  N N 489 
VAL CB   C  N N 490 
VAL CG1  C  N N 491 
VAL CG2  C  N N 492 
VAL OXT  O  N N 493 
VAL H    H  N N 494 
VAL H2   H  N N 495 
VAL HA   H  N N 496 
VAL HB   H  N N 497 
VAL HG11 H  N N 498 
VAL HG12 H  N N 499 
VAL HG13 H  N N 500 
VAL HG21 H  N N 501 
VAL HG22 H  N N 502 
VAL HG23 H  N N 503 
VAL HXT  H  N N 504 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
FRU C1  C2   sing N N 70  
FRU C1  O1   sing N N 71  
FRU C1  H11  sing N N 72  
FRU C1  H12  sing N N 73  
FRU C2  C3   sing N N 74  
FRU C2  O2   sing N N 75  
FRU C2  O5   sing N N 76  
FRU C3  C4   sing N N 77  
FRU C3  O3   sing N N 78  
FRU C3  H3   sing N N 79  
FRU C4  C5   sing N N 80  
FRU C4  O4   sing N N 81  
FRU C4  H4   sing N N 82  
FRU C5  C6   sing N N 83  
FRU C5  O5   sing N N 84  
FRU C5  H5   sing N N 85  
FRU C6  O6   sing N N 86  
FRU C6  H61  sing N N 87  
FRU C6  H62  sing N N 88  
FRU O1  HO1  sing N N 89  
FRU O2  HO2  sing N N 90  
FRU O3  HO3  sing N N 91  
FRU O4  HO4  sing N N 92  
FRU O6  HO6  sing N N 93  
GLC C1  C2   sing N N 94  
GLC C1  O1   sing N N 95  
GLC C1  O5   sing N N 96  
GLC C1  H1   sing N N 97  
GLC C2  C3   sing N N 98  
GLC C2  O2   sing N N 99  
GLC C2  H2   sing N N 100 
GLC C3  C4   sing N N 101 
GLC C3  O3   sing N N 102 
GLC C3  H3   sing N N 103 
GLC C4  C5   sing N N 104 
GLC C4  O4   sing N N 105 
GLC C4  H4   sing N N 106 
GLC C5  C6   sing N N 107 
GLC C5  O5   sing N N 108 
GLC C5  H5   sing N N 109 
GLC C6  O6   sing N N 110 
GLC C6  H61  sing N N 111 
GLC C6  H62  sing N N 112 
GLC O1  HO1  sing N N 113 
GLC O2  HO2  sing N N 114 
GLC O3  HO3  sing N N 115 
GLC O4  HO4  sing N N 116 
GLC O6  HO6  sing N N 117 
GLN N   CA   sing N N 118 
GLN N   H    sing N N 119 
GLN N   H2   sing N N 120 
GLN CA  C    sing N N 121 
GLN CA  CB   sing N N 122 
GLN CA  HA   sing N N 123 
GLN C   O    doub N N 124 
GLN C   OXT  sing N N 125 
GLN CB  CG   sing N N 126 
GLN CB  HB2  sing N N 127 
GLN CB  HB3  sing N N 128 
GLN CG  CD   sing N N 129 
GLN CG  HG2  sing N N 130 
GLN CG  HG3  sing N N 131 
GLN CD  OE1  doub N N 132 
GLN CD  NE2  sing N N 133 
GLN NE2 HE21 sing N N 134 
GLN NE2 HE22 sing N N 135 
GLN OXT HXT  sing N N 136 
GLU N   CA   sing N N 137 
GLU N   H    sing N N 138 
GLU N   H2   sing N N 139 
GLU CA  C    sing N N 140 
GLU CA  CB   sing N N 141 
GLU CA  HA   sing N N 142 
GLU C   O    doub N N 143 
GLU C   OXT  sing N N 144 
GLU CB  CG   sing N N 145 
GLU CB  HB2  sing N N 146 
GLU CB  HB3  sing N N 147 
GLU CG  CD   sing N N 148 
GLU CG  HG2  sing N N 149 
GLU CG  HG3  sing N N 150 
GLU CD  OE1  doub N N 151 
GLU CD  OE2  sing N N 152 
GLU OE2 HE2  sing N N 153 
GLU OXT HXT  sing N N 154 
GLY N   CA   sing N N 155 
GLY N   H    sing N N 156 
GLY N   H2   sing N N 157 
GLY CA  C    sing N N 158 
GLY CA  HA2  sing N N 159 
GLY CA  HA3  sing N N 160 
GLY C   O    doub N N 161 
GLY C   OXT  sing N N 162 
GLY OXT HXT  sing N N 163 
HEM CHA C1A  sing N N 164 
HEM CHA C4D  doub N N 165 
HEM CHA HHA  sing N N 166 
HEM CHB C4A  sing N N 167 
HEM CHB C1B  doub N N 168 
HEM CHB HHB  sing N N 169 
HEM CHC C4B  sing N N 170 
HEM CHC C1C  doub N N 171 
HEM CHC HHC  sing N N 172 
HEM CHD C4C  doub N N 173 
HEM CHD C1D  sing N N 174 
HEM CHD HHD  sing N N 175 
HEM C1A C2A  doub Y N 176 
HEM C1A NA   sing Y N 177 
HEM C2A C3A  sing Y N 178 
HEM C2A CAA  sing N N 179 
HEM C3A C4A  doub Y N 180 
HEM C3A CMA  sing N N 181 
HEM C4A NA   sing Y N 182 
HEM CMA HMA  sing N N 183 
HEM CMA HMAA sing N N 184 
HEM CMA HMAB sing N N 185 
HEM CAA CBA  sing N N 186 
HEM CAA HAA  sing N N 187 
HEM CAA HAAA sing N N 188 
HEM CBA CGA  sing N N 189 
HEM CBA HBA  sing N N 190 
HEM CBA HBAA sing N N 191 
HEM CGA O1A  doub N N 192 
HEM CGA O2A  sing N N 193 
HEM C1B C2B  sing N N 194 
HEM C1B NB   sing N N 195 
HEM C2B C3B  doub N N 196 
HEM C2B CMB  sing N N 197 
HEM C3B C4B  sing N N 198 
HEM C3B CAB  sing N N 199 
HEM C4B NB   doub N N 200 
HEM CMB HMB  sing N N 201 
HEM CMB HMBA sing N N 202 
HEM CMB HMBB sing N N 203 
HEM CAB CBB  doub N N 204 
HEM CAB HAB  sing N N 205 
HEM CBB HBB  sing N N 206 
HEM CBB HBBA sing N N 207 
HEM C1C C2C  sing Y N 208 
HEM C1C NC   sing Y N 209 
HEM C2C C3C  doub Y N 210 
HEM C2C CMC  sing N N 211 
HEM C3C C4C  sing Y N 212 
HEM C3C CAC  sing N N 213 
HEM C4C NC   sing Y N 214 
HEM CMC HMC  sing N N 215 
HEM CMC HMCA sing N N 216 
HEM CMC HMCB sing N N 217 
HEM CAC CBC  doub N N 218 
HEM CAC HAC  sing N N 219 
HEM CBC HBC  sing N N 220 
HEM CBC HBCA sing N N 221 
HEM C1D C2D  sing N N 222 
HEM C1D ND   doub N N 223 
HEM C2D C3D  doub N N 224 
HEM C2D CMD  sing N N 225 
HEM C3D C4D  sing N N 226 
HEM C3D CAD  sing N N 227 
HEM C4D ND   sing N N 228 
HEM CMD HMD  sing N N 229 
HEM CMD HMDA sing N N 230 
HEM CMD HMDB sing N N 231 
HEM CAD CBD  sing N N 232 
HEM CAD HAD  sing N N 233 
HEM CAD HADA sing N N 234 
HEM CBD CGD  sing N N 235 
HEM CBD HBD  sing N N 236 
HEM CBD HBDA sing N N 237 
HEM CGD O1D  doub N N 238 
HEM CGD O2D  sing N N 239 
HEM O2A H2A  sing N N 240 
HEM O2D H2D  sing N N 241 
HEM FE  NA   sing N N 242 
HEM FE  NB   sing N N 243 
HEM FE  NC   sing N N 244 
HEM FE  ND   sing N N 245 
HIS N   CA   sing N N 246 
HIS N   H    sing N N 247 
HIS N   H2   sing N N 248 
HIS CA  C    sing N N 249 
HIS CA  CB   sing N N 250 
HIS CA  HA   sing N N 251 
HIS C   O    doub N N 252 
HIS C   OXT  sing N N 253 
HIS CB  CG   sing N N 254 
HIS CB  HB2  sing N N 255 
HIS CB  HB3  sing N N 256 
HIS CG  ND1  sing Y N 257 
HIS CG  CD2  doub Y N 258 
HIS ND1 CE1  doub Y N 259 
HIS ND1 HD1  sing N N 260 
HIS CD2 NE2  sing Y N 261 
HIS CD2 HD2  sing N N 262 
HIS CE1 NE2  sing Y N 263 
HIS CE1 HE1  sing N N 264 
HIS NE2 HE2  sing N N 265 
HIS OXT HXT  sing N N 266 
HOH O   H1   sing N N 267 
HOH O   H2   sing N N 268 
ILE N   CA   sing N N 269 
ILE N   H    sing N N 270 
ILE N   H2   sing N N 271 
ILE CA  C    sing N N 272 
ILE CA  CB   sing N N 273 
ILE CA  HA   sing N N 274 
ILE C   O    doub N N 275 
ILE C   OXT  sing N N 276 
ILE CB  CG1  sing N N 277 
ILE CB  CG2  sing N N 278 
ILE CB  HB   sing N N 279 
ILE CG1 CD1  sing N N 280 
ILE CG1 HG12 sing N N 281 
ILE CG1 HG13 sing N N 282 
ILE CG2 HG21 sing N N 283 
ILE CG2 HG22 sing N N 284 
ILE CG2 HG23 sing N N 285 
ILE CD1 HD11 sing N N 286 
ILE CD1 HD12 sing N N 287 
ILE CD1 HD13 sing N N 288 
ILE OXT HXT  sing N N 289 
LEU N   CA   sing N N 290 
LEU N   H    sing N N 291 
LEU N   H2   sing N N 292 
LEU CA  C    sing N N 293 
LEU CA  CB   sing N N 294 
LEU CA  HA   sing N N 295 
LEU C   O    doub N N 296 
LEU C   OXT  sing N N 297 
LEU CB  CG   sing N N 298 
LEU CB  HB2  sing N N 299 
LEU CB  HB3  sing N N 300 
LEU CG  CD1  sing N N 301 
LEU CG  CD2  sing N N 302 
LEU CG  HG   sing N N 303 
LEU CD1 HD11 sing N N 304 
LEU CD1 HD12 sing N N 305 
LEU CD1 HD13 sing N N 306 
LEU CD2 HD21 sing N N 307 
LEU CD2 HD22 sing N N 308 
LEU CD2 HD23 sing N N 309 
LEU OXT HXT  sing N N 310 
LYS N   CA   sing N N 311 
LYS N   H    sing N N 312 
LYS N   H2   sing N N 313 
LYS CA  C    sing N N 314 
LYS CA  CB   sing N N 315 
LYS CA  HA   sing N N 316 
LYS C   O    doub N N 317 
LYS C   OXT  sing N N 318 
LYS CB  CG   sing N N 319 
LYS CB  HB2  sing N N 320 
LYS CB  HB3  sing N N 321 
LYS CG  CD   sing N N 322 
LYS CG  HG2  sing N N 323 
LYS CG  HG3  sing N N 324 
LYS CD  CE   sing N N 325 
LYS CD  HD2  sing N N 326 
LYS CD  HD3  sing N N 327 
LYS CE  NZ   sing N N 328 
LYS CE  HE2  sing N N 329 
LYS CE  HE3  sing N N 330 
LYS NZ  HZ1  sing N N 331 
LYS NZ  HZ2  sing N N 332 
LYS NZ  HZ3  sing N N 333 
LYS OXT HXT  sing N N 334 
MET N   CA   sing N N 335 
MET N   H    sing N N 336 
MET N   H2   sing N N 337 
MET CA  C    sing N N 338 
MET CA  CB   sing N N 339 
MET CA  HA   sing N N 340 
MET C   O    doub N N 341 
MET C   OXT  sing N N 342 
MET CB  CG   sing N N 343 
MET CB  HB2  sing N N 344 
MET CB  HB3  sing N N 345 
MET CG  SD   sing N N 346 
MET CG  HG2  sing N N 347 
MET CG  HG3  sing N N 348 
MET SD  CE   sing N N 349 
MET CE  HE1  sing N N 350 
MET CE  HE2  sing N N 351 
MET CE  HE3  sing N N 352 
MET OXT HXT  sing N N 353 
PHE N   CA   sing N N 354 
PHE N   H    sing N N 355 
PHE N   H2   sing N N 356 
PHE CA  C    sing N N 357 
PHE CA  CB   sing N N 358 
PHE CA  HA   sing N N 359 
PHE C   O    doub N N 360 
PHE C   OXT  sing N N 361 
PHE CB  CG   sing N N 362 
PHE CB  HB2  sing N N 363 
PHE CB  HB3  sing N N 364 
PHE CG  CD1  doub Y N 365 
PHE CG  CD2  sing Y N 366 
PHE CD1 CE1  sing Y N 367 
PHE CD1 HD1  sing N N 368 
PHE CD2 CE2  doub Y N 369 
PHE CD2 HD2  sing N N 370 
PHE CE1 CZ   doub Y N 371 
PHE CE1 HE1  sing N N 372 
PHE CE2 CZ   sing Y N 373 
PHE CE2 HE2  sing N N 374 
PHE CZ  HZ   sing N N 375 
PHE OXT HXT  sing N N 376 
PRO N   CA   sing N N 377 
PRO N   CD   sing N N 378 
PRO N   H    sing N N 379 
PRO CA  C    sing N N 380 
PRO CA  CB   sing N N 381 
PRO CA  HA   sing N N 382 
PRO C   O    doub N N 383 
PRO C   OXT  sing N N 384 
PRO CB  CG   sing N N 385 
PRO CB  HB2  sing N N 386 
PRO CB  HB3  sing N N 387 
PRO CG  CD   sing N N 388 
PRO CG  HG2  sing N N 389 
PRO CG  HG3  sing N N 390 
PRO CD  HD2  sing N N 391 
PRO CD  HD3  sing N N 392 
PRO OXT HXT  sing N N 393 
SER N   CA   sing N N 394 
SER N   H    sing N N 395 
SER N   H2   sing N N 396 
SER CA  C    sing N N 397 
SER CA  CB   sing N N 398 
SER CA  HA   sing N N 399 
SER C   O    doub N N 400 
SER C   OXT  sing N N 401 
SER CB  OG   sing N N 402 
SER CB  HB2  sing N N 403 
SER CB  HB3  sing N N 404 
SER OG  HG   sing N N 405 
SER OXT HXT  sing N N 406 
SO4 S   O1   doub N N 407 
SO4 S   O2   doub N N 408 
SO4 S   O3   sing N N 409 
SO4 S   O4   sing N N 410 
THR N   CA   sing N N 411 
THR N   H    sing N N 412 
THR N   H2   sing N N 413 
THR CA  C    sing N N 414 
THR CA  CB   sing N N 415 
THR CA  HA   sing N N 416 
THR C   O    doub N N 417 
THR C   OXT  sing N N 418 
THR CB  OG1  sing N N 419 
THR CB  CG2  sing N N 420 
THR CB  HB   sing N N 421 
THR OG1 HG1  sing N N 422 
THR CG2 HG21 sing N N 423 
THR CG2 HG22 sing N N 424 
THR CG2 HG23 sing N N 425 
THR OXT HXT  sing N N 426 
TRP N   CA   sing N N 427 
TRP N   H    sing N N 428 
TRP N   H2   sing N N 429 
TRP CA  C    sing N N 430 
TRP CA  CB   sing N N 431 
TRP CA  HA   sing N N 432 
TRP C   O    doub N N 433 
TRP C   OXT  sing N N 434 
TRP CB  CG   sing N N 435 
TRP CB  HB2  sing N N 436 
TRP CB  HB3  sing N N 437 
TRP CG  CD1  doub Y N 438 
TRP CG  CD2  sing Y N 439 
TRP CD1 NE1  sing Y N 440 
TRP CD1 HD1  sing N N 441 
TRP CD2 CE2  doub Y N 442 
TRP CD2 CE3  sing Y N 443 
TRP NE1 CE2  sing Y N 444 
TRP NE1 HE1  sing N N 445 
TRP CE2 CZ2  sing Y N 446 
TRP CE3 CZ3  doub Y N 447 
TRP CE3 HE3  sing N N 448 
TRP CZ2 CH2  doub Y N 449 
TRP CZ2 HZ2  sing N N 450 
TRP CZ3 CH2  sing Y N 451 
TRP CZ3 HZ3  sing N N 452 
TRP CH2 HH2  sing N N 453 
TRP OXT HXT  sing N N 454 
TYR N   CA   sing N N 455 
TYR N   H    sing N N 456 
TYR N   H2   sing N N 457 
TYR CA  C    sing N N 458 
TYR CA  CB   sing N N 459 
TYR CA  HA   sing N N 460 
TYR C   O    doub N N 461 
TYR C   OXT  sing N N 462 
TYR CB  CG   sing N N 463 
TYR CB  HB2  sing N N 464 
TYR CB  HB3  sing N N 465 
TYR CG  CD1  doub Y N 466 
TYR CG  CD2  sing Y N 467 
TYR CD1 CE1  sing Y N 468 
TYR CD1 HD1  sing N N 469 
TYR CD2 CE2  doub Y N 470 
TYR CD2 HD2  sing N N 471 
TYR CE1 CZ   doub Y N 472 
TYR CE1 HE1  sing N N 473 
TYR CE2 CZ   sing Y N 474 
TYR CE2 HE2  sing N N 475 
TYR CZ  OH   sing N N 476 
TYR OH  HH   sing N N 477 
TYR OXT HXT  sing N N 478 
VAL N   CA   sing N N 479 
VAL N   H    sing N N 480 
VAL N   H2   sing N N 481 
VAL CA  C    sing N N 482 
VAL CA  CB   sing N N 483 
VAL CA  HA   sing N N 484 
VAL C   O    doub N N 485 
VAL C   OXT  sing N N 486 
VAL CB  CG1  sing N N 487 
VAL CB  CG2  sing N N 488 
VAL CB  HB   sing N N 489 
VAL CG1 HG11 sing N N 490 
VAL CG1 HG12 sing N N 491 
VAL CG1 HG13 sing N N 492 
VAL CG2 HG21 sing N N 493 
VAL CG2 HG22 sing N N 494 
VAL CG2 HG23 sing N N 495 
VAL OXT HXT  sing N N 496 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
B 2 GLC 1 B GLC 1 C SUC 1 n 
B 2 FRU 2 B FRU 2 C SUC 1 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FRU 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DFrufb             
FRU 'COMMON NAME'                         GMML     1.0 b-D-fructofuranose 
FRU 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Fruf           
FRU 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fru                
GLC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpa             
GLC 'COMMON NAME'                         GMML     1.0 a-D-glucopyranose  
GLC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-Glcp           
GLC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Glc                
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 DFrufb2-1DGlcpa                                            'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/2,2,1/[ha122h-2b_2-5][a2122h-1a_1-5]/1-2/a2-b1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[][b-D-Fruf]{[(2+1)][a-D-Glcp]{}}'                        LINUCS                      PDB-CARE   ?     
# 
_pdbx_entity_branch_link.link_id                    1 
_pdbx_entity_branch_link.entity_id                  2 
_pdbx_entity_branch_link.entity_branch_list_num_1   1 
_pdbx_entity_branch_link.comp_id_1                  GLC 
_pdbx_entity_branch_link.atom_id_1                  C1 
_pdbx_entity_branch_link.leaving_atom_id_1          O1 
_pdbx_entity_branch_link.entity_branch_list_num_2   2 
_pdbx_entity_branch_link.comp_id_2                  FRU 
_pdbx_entity_branch_link.atom_id_2                  O2 
_pdbx_entity_branch_link.leaving_atom_id_2          HO2 
_pdbx_entity_branch_link.value_order                sing 
_pdbx_entity_branch_link.details                    ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 GLC 1 n 
2 FRU 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'SULFATE ION'                     SO4 
4 'PROTOPORPHYRIN IX CONTAINING FE' HEM 
5 water                             HOH 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   1JW8 
_pdbx_initial_refinement_model.details          ? 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
#