data_6MEQ # _entry.id 6MEQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6MEQ pdb_00006meq 10.2210/pdb6meq/pdb WWPDB D_1000236768 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6MEQ _pdbx_database_status.recvd_initial_deposition_date 2018-09-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Nicoludis, J.M.' 1 0000-0002-3755-7844 'Gaudet, R.' 2 0000-0002-9177-054X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 116 _citation.language ? _citation.page_first 17825 _citation.page_last 17830 _citation.title 'Interaction specificity of clustered protocadherins inferred from sequence covariation and structural analysis.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1821063116 _citation.pdbx_database_id_PubMed 31431536 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nicoludis, J.M.' 1 ? primary 'Green, A.G.' 2 ? primary 'Walujkar, S.' 3 ? primary 'May, E.J.' 4 ? primary 'Sotomayor, M.' 5 ? primary 'Marks, D.S.' 6 ? primary 'Gaudet, R.' 7 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6MEQ _cell.details ? _cell.formula_units_Z ? _cell.length_a 126.811 _cell.length_a_esd ? _cell.length_b 162.912 _cell.length_b_esd ? _cell.length_c 52.857 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6MEQ _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protocadherin gamma-B3' 45942.207 1 ? ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 9 ? ? ? ? 3 water nat water 18.015 92 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name PCDH-gamma-B3 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;EPIRYAIPEELDRGSLVGNLAKDLGFGVGDLPTRNLRVIAEKKFFTVSPENGNLLVSDRIDREEICGKKSTCVLEFEMVA EKPLNFFHVTVLIQDINDNPPTFSQNITELEISELALTGATFALESAQDPDVGVNSLQQYYLSPDPHFSLIQKENLDGSR YPELVLKAPLDREEQPHHHLVLTAVDGGEPSRSCTTQIRVIVADANDNPPVFTQDMYRVNVAENLPAGSSVLKVMAIDMD EGINAEIIYAFINIGKEVRQLFKLDSKTGELTTIGELDFEERDSYTIGVEAKDGGHHTAYCKVQIDISDENDNAPEITLA SESQHIQEDAELGTAVALIKTHDLDSGFNGEILCQLKGNFPFKIVQDTKNTYRLVTDGALDREQIPEYNVTITATDKGNP PLSSSKTITLHILDAA ; _entity_poly.pdbx_seq_one_letter_code_can ;EPIRYAIPEELDRGSLVGNLAKDLGFGVGDLPTRNLRVIAEKKFFTVSPENGNLLVSDRIDREEICGKKSTCVLEFEMVA EKPLNFFHVTVLIQDINDNPPTFSQNITELEISELALTGATFALESAQDPDVGVNSLQQYYLSPDPHFSLIQKENLDGSR YPELVLKAPLDREEQPHHHLVLTAVDGGEPSRSCTTQIRVIVADANDNPPVFTQDMYRVNVAENLPAGSSVLKVMAIDMD EGINAEIIYAFINIGKEVRQLFKLDSKTGELTTIGELDFEERDSYTIGVEAKDGGHHTAYCKVQIDISDENDNAPEITLA SESQHIQEDAELGTAVALIKTHDLDSGFNGEILCQLKGNFPFKIVQDTKNTYRLVTDGALDREQIPEYNVTITATDKGNP PLSSSKTITLHILDAA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 PRO n 1 3 ILE n 1 4 ARG n 1 5 TYR n 1 6 ALA n 1 7 ILE n 1 8 PRO n 1 9 GLU n 1 10 GLU n 1 11 LEU n 1 12 ASP n 1 13 ARG n 1 14 GLY n 1 15 SER n 1 16 LEU n 1 17 VAL n 1 18 GLY n 1 19 ASN n 1 20 LEU n 1 21 ALA n 1 22 LYS n 1 23 ASP n 1 24 LEU n 1 25 GLY n 1 26 PHE n 1 27 GLY n 1 28 VAL n 1 29 GLY n 1 30 ASP n 1 31 LEU n 1 32 PRO n 1 33 THR n 1 34 ARG n 1 35 ASN n 1 36 LEU n 1 37 ARG n 1 38 VAL n 1 39 ILE n 1 40 ALA n 1 41 GLU n 1 42 LYS n 1 43 LYS n 1 44 PHE n 1 45 PHE n 1 46 THR n 1 47 VAL n 1 48 SER n 1 49 PRO n 1 50 GLU n 1 51 ASN n 1 52 GLY n 1 53 ASN n 1 54 LEU n 1 55 LEU n 1 56 VAL n 1 57 SER n 1 58 ASP n 1 59 ARG n 1 60 ILE n 1 61 ASP n 1 62 ARG n 1 63 GLU n 1 64 GLU n 1 65 ILE n 1 66 CYS n 1 67 GLY n 1 68 LYS n 1 69 LYS n 1 70 SER n 1 71 THR n 1 72 CYS n 1 73 VAL n 1 74 LEU n 1 75 GLU n 1 76 PHE n 1 77 GLU n 1 78 MET n 1 79 VAL n 1 80 ALA n 1 81 GLU n 1 82 LYS n 1 83 PRO n 1 84 LEU n 1 85 ASN n 1 86 PHE n 1 87 PHE n 1 88 HIS n 1 89 VAL n 1 90 THR n 1 91 VAL n 1 92 LEU n 1 93 ILE n 1 94 GLN n 1 95 ASP n 1 96 ILE n 1 97 ASN n 1 98 ASP n 1 99 ASN n 1 100 PRO n 1 101 PRO n 1 102 THR n 1 103 PHE n 1 104 SER n 1 105 GLN n 1 106 ASN n 1 107 ILE n 1 108 THR n 1 109 GLU n 1 110 LEU n 1 111 GLU n 1 112 ILE n 1 113 SER n 1 114 GLU n 1 115 LEU n 1 116 ALA n 1 117 LEU n 1 118 THR n 1 119 GLY n 1 120 ALA n 1 121 THR n 1 122 PHE n 1 123 ALA n 1 124 LEU n 1 125 GLU n 1 126 SER n 1 127 ALA n 1 128 GLN n 1 129 ASP n 1 130 PRO n 1 131 ASP n 1 132 VAL n 1 133 GLY n 1 134 VAL n 1 135 ASN n 1 136 SER n 1 137 LEU n 1 138 GLN n 1 139 GLN n 1 140 TYR n 1 141 TYR n 1 142 LEU n 1 143 SER n 1 144 PRO n 1 145 ASP n 1 146 PRO n 1 147 HIS n 1 148 PHE n 1 149 SER n 1 150 LEU n 1 151 ILE n 1 152 GLN n 1 153 LYS n 1 154 GLU n 1 155 ASN n 1 156 LEU n 1 157 ASP n 1 158 GLY n 1 159 SER n 1 160 ARG n 1 161 TYR n 1 162 PRO n 1 163 GLU n 1 164 LEU n 1 165 VAL n 1 166 LEU n 1 167 LYS n 1 168 ALA n 1 169 PRO n 1 170 LEU n 1 171 ASP n 1 172 ARG n 1 173 GLU n 1 174 GLU n 1 175 GLN n 1 176 PRO n 1 177 HIS n 1 178 HIS n 1 179 HIS n 1 180 LEU n 1 181 VAL n 1 182 LEU n 1 183 THR n 1 184 ALA n 1 185 VAL n 1 186 ASP n 1 187 GLY n 1 188 GLY n 1 189 GLU n 1 190 PRO n 1 191 SER n 1 192 ARG n 1 193 SER n 1 194 CYS n 1 195 THR n 1 196 THR n 1 197 GLN n 1 198 ILE n 1 199 ARG n 1 200 VAL n 1 201 ILE n 1 202 VAL n 1 203 ALA n 1 204 ASP n 1 205 ALA n 1 206 ASN n 1 207 ASP n 1 208 ASN n 1 209 PRO n 1 210 PRO n 1 211 VAL n 1 212 PHE n 1 213 THR n 1 214 GLN n 1 215 ASP n 1 216 MET n 1 217 TYR n 1 218 ARG n 1 219 VAL n 1 220 ASN n 1 221 VAL n 1 222 ALA n 1 223 GLU n 1 224 ASN n 1 225 LEU n 1 226 PRO n 1 227 ALA n 1 228 GLY n 1 229 SER n 1 230 SER n 1 231 VAL n 1 232 LEU n 1 233 LYS n 1 234 VAL n 1 235 MET n 1 236 ALA n 1 237 ILE n 1 238 ASP n 1 239 MET n 1 240 ASP n 1 241 GLU n 1 242 GLY n 1 243 ILE n 1 244 ASN n 1 245 ALA n 1 246 GLU n 1 247 ILE n 1 248 ILE n 1 249 TYR n 1 250 ALA n 1 251 PHE n 1 252 ILE n 1 253 ASN n 1 254 ILE n 1 255 GLY n 1 256 LYS n 1 257 GLU n 1 258 VAL n 1 259 ARG n 1 260 GLN n 1 261 LEU n 1 262 PHE n 1 263 LYS n 1 264 LEU n 1 265 ASP n 1 266 SER n 1 267 LYS n 1 268 THR n 1 269 GLY n 1 270 GLU n 1 271 LEU n 1 272 THR n 1 273 THR n 1 274 ILE n 1 275 GLY n 1 276 GLU n 1 277 LEU n 1 278 ASP n 1 279 PHE n 1 280 GLU n 1 281 GLU n 1 282 ARG n 1 283 ASP n 1 284 SER n 1 285 TYR n 1 286 THR n 1 287 ILE n 1 288 GLY n 1 289 VAL n 1 290 GLU n 1 291 ALA n 1 292 LYS n 1 293 ASP n 1 294 GLY n 1 295 GLY n 1 296 HIS n 1 297 HIS n 1 298 THR n 1 299 ALA n 1 300 TYR n 1 301 CYS n 1 302 LYS n 1 303 VAL n 1 304 GLN n 1 305 ILE n 1 306 ASP n 1 307 ILE n 1 308 SER n 1 309 ASP n 1 310 GLU n 1 311 ASN n 1 312 ASP n 1 313 ASN n 1 314 ALA n 1 315 PRO n 1 316 GLU n 1 317 ILE n 1 318 THR n 1 319 LEU n 1 320 ALA n 1 321 SER n 1 322 GLU n 1 323 SER n 1 324 GLN n 1 325 HIS n 1 326 ILE n 1 327 GLN n 1 328 GLU n 1 329 ASP n 1 330 ALA n 1 331 GLU n 1 332 LEU n 1 333 GLY n 1 334 THR n 1 335 ALA n 1 336 VAL n 1 337 ALA n 1 338 LEU n 1 339 ILE n 1 340 LYS n 1 341 THR n 1 342 HIS n 1 343 ASP n 1 344 LEU n 1 345 ASP n 1 346 SER n 1 347 GLY n 1 348 PHE n 1 349 ASN n 1 350 GLY n 1 351 GLU n 1 352 ILE n 1 353 LEU n 1 354 CYS n 1 355 GLN n 1 356 LEU n 1 357 LYS n 1 358 GLY n 1 359 ASN n 1 360 PHE n 1 361 PRO n 1 362 PHE n 1 363 LYS n 1 364 ILE n 1 365 VAL n 1 366 GLN n 1 367 ASP n 1 368 THR n 1 369 LYS n 1 370 ASN n 1 371 THR n 1 372 TYR n 1 373 ARG n 1 374 LEU n 1 375 VAL n 1 376 THR n 1 377 ASP n 1 378 GLY n 1 379 ALA n 1 380 LEU n 1 381 ASP n 1 382 ARG n 1 383 GLU n 1 384 GLN n 1 385 ILE n 1 386 PRO n 1 387 GLU n 1 388 TYR n 1 389 ASN n 1 390 VAL n 1 391 THR n 1 392 ILE n 1 393 THR n 1 394 ALA n 1 395 THR n 1 396 ASP n 1 397 LYS n 1 398 GLY n 1 399 ASN n 1 400 PRO n 1 401 PRO n 1 402 LEU n 1 403 SER n 1 404 SER n 1 405 SER n 1 406 LYS n 1 407 THR n 1 408 ILE n 1 409 THR n 1 410 LEU n 1 411 HIS n 1 412 ILE n 1 413 LEU n 1 414 ASP n 1 415 ALA n 1 416 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 416 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PCDHGB3 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PCDGF_HUMAN _struct_ref.pdbx_db_accession Q9Y5G1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EPIRYAIPEELDRGSLVGNLAKDLGFGVGDLPTRNLRVIAEKKFFTVSPENGNLLVSDRIDREEICGKKSTCVLEFEMVA EKPLNFFHVTVLIQDINDNPPTFSQNITELEISELALTGATFALESAQDPDVGVNSLQQYYLSPDPHFSLIQKENLDGSR YPELVLKAPLDREEQPHHHLVLTAVDGGEPSRSCTTQIRVIVADANDNPPVFTQDMYRVNVAENLPAGSSVLKVMAIDMD EGINAEIIYAFINIGKEVRQLFKLDSKTGELTTIGELDFEERDSYTIGVEAKDGGHHTAYCKVQIDISDENDNAPEITLA SESQHIQEDAELGTAVALIKTHDLDSGFNGEILCQLKGNFPFKIVQDTKNTYRLVTDGALDREQIPEYNVTITATDKGNP PLSSSKTITLHILD ; _struct_ref.pdbx_align_begin 31 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6MEQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 414 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9Y5G1 _struct_ref_seq.db_align_beg 31 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 444 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 414 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6MEQ ALA A 415 ? UNP Q9Y5G1 ? ? 'expression tag' 415 1 1 6MEQ ALA A 416 ? UNP Q9Y5G1 ? ? 'expression tag' 416 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6MEQ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.97 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 58.60 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '50 mM HEPES pH7, 10% PEG 5000MME, 4% ethylene glycol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 70 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-12-19 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.98 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 75.67 _reflns.entry_id 6MEQ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.9 _reflns.d_resolution_low 49.919 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11833 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94.21 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.2 _reflns.pdbx_Rmerge_I_obs 0.113 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.02 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.1249 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.996 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.9 _reflns_shell.d_res_low 3.004 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6MEQ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.900 _refine.ls_d_res_low 49.919 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11831 _refine.ls_number_reflns_R_free 1181 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.24 _refine.ls_percent_reflns_R_free 9.98 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2291 _refine.ls_R_factor_R_free 0.2709 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2244 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5k8r _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.90 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.51 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 3229 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 9 _refine_hist.number_atoms_solvent 92 _refine_hist.number_atoms_total 3330 _refine_hist.d_res_high 2.900 _refine_hist.d_res_low 49.919 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.001 ? 3287 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.377 ? 4469 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 11.486 ? 2010 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.041 ? 518 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 596 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.9002 3.0322 . . 104 956 70.00 . . . 0.4700 . 0.4055 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0322 3.1920 . . 137 1232 89.00 . . . 0.3834 . 0.3415 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1920 3.3920 . . 150 1391 99.00 . . . 0.3799 . 0.2914 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3920 3.6538 . . 152 1377 99.00 . . . 0.3232 . 0.2720 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6538 4.0213 . . 155 1402 99.00 . . . 0.2800 . 0.2336 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.0213 4.6029 . . 159 1393 99.00 . . . 0.2392 . 0.1988 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.6029 5.7978 . . 158 1425 99.00 . . . 0.2028 . 0.1826 . . . . . . . . . . 'X-RAY DIFFRACTION' 5.7978 49.9268 . . 166 1474 98.00 . . . 0.2493 . 0.1921 . . . . . . . . . . # _struct.entry_id 6MEQ _struct.title 'PcdhgB3 EC1-4 in 50 mM HEPES' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6MEQ _struct_keywords.text 'cell-adhesion, neuronal self-avoidance, CELL ADHESION' _struct_keywords.pdbx_keywords 'CELL ADHESION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? I N N 2 ? J N N 2 ? K N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 20 ? GLY A 25 ? LEU A 20 GLY A 25 1 ? 6 HELX_P HELX_P2 AA2 GLY A 27 ? GLY A 29 ? GLY A 27 GLY A 29 5 ? 3 HELX_P HELX_P3 AA3 ASP A 30 ? ASN A 35 ? ASP A 30 ASN A 35 1 ? 6 HELX_P HELX_P4 AA4 ASP A 61 ? CYS A 66 ? ASP A 61 CYS A 66 1 ? 6 HELX_P HELX_P5 AA5 VAL A 132 ? SER A 136 ? VAL A 132 SER A 136 5 ? 5 HELX_P HELX_P6 AA6 GLU A 241 ? ALA A 245 ? GLU A 241 ALA A 245 5 ? 5 HELX_P HELX_P7 AA7 GLY A 255 ? GLN A 260 ? GLY A 255 GLN A 260 1 ? 6 HELX_P HELX_P8 AA8 SER A 346 ? GLY A 350 ? SER A 346 GLY A 350 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 66 SG ? ? ? 1_555 A CYS 72 SG ? ? A CYS 66 A CYS 72 1_555 ? ? ? ? ? ? ? 2.031 ? ? metalc1 metalc ? ? A GLU 9 OE1 ? ? ? 1_555 F CA . CA ? ? A GLU 9 A CA 505 1_555 ? ? ? ? ? ? ? 2.876 ? ? metalc2 metalc ? ? A GLU 9 OE2 ? ? ? 1_555 G CA . CA ? ? A GLU 9 A CA 506 1_555 ? ? ? ? ? ? ? 2.487 ? ? metalc3 metalc ? ? A GLU 10 OE2 ? ? ? 1_555 F CA . CA ? ? A GLU 10 A CA 505 1_555 ? ? ? ? ? ? ? 2.912 ? ? metalc4 metalc ? ? A ASP 61 OD1 ? ? ? 1_555 F CA . CA ? ? A ASP 61 A CA 505 1_555 ? ? ? ? ? ? ? 2.501 ? ? metalc5 metalc ? ? A GLU 63 OE1 ? ? ? 1_555 F CA . CA ? ? A GLU 63 A CA 505 1_555 ? ? ? ? ? ? ? 2.519 ? ? metalc6 metalc ? ? A GLU 63 OE1 ? ? ? 1_555 G CA . CA ? ? A GLU 63 A CA 506 1_555 ? ? ? ? ? ? ? 3.072 ? ? metalc7 metalc ? ? A GLU 63 OE2 ? ? ? 1_555 G CA . CA ? ? A GLU 63 A CA 506 1_555 ? ? ? ? ? ? ? 2.424 ? ? metalc8 metalc ? ? A ASP 95 OD1 ? ? ? 1_555 G CA . CA ? ? A ASP 95 A CA 506 1_555 ? ? ? ? ? ? ? 2.575 ? ? metalc9 metalc ? ? A ILE 96 O ? ? ? 1_555 G CA . CA ? ? A ILE 96 A CA 506 1_555 ? ? ? ? ? ? ? 2.500 ? ? metalc10 metalc ? ? A ASN 97 OD1 ? ? ? 1_555 E CA . CA ? ? A ASN 97 A CA 504 1_555 ? ? ? ? ? ? ? 2.470 ? ? metalc11 metalc ? ? A ASP 98 OD2 ? ? ? 1_555 F CA . CA ? ? A ASP 98 A CA 505 1_555 ? ? ? ? ? ? ? 2.565 ? ? metalc12 metalc ? ? A ASP 98 OD1 ? ? ? 1_555 G CA . CA ? ? A ASP 98 A CA 506 1_555 ? ? ? ? ? ? ? 2.534 ? ? metalc13 metalc ? ? A ASN 99 O ? ? ? 1_555 E CA . CA ? ? A ASN 99 A CA 504 1_555 ? ? ? ? ? ? ? 2.558 ? ? metalc14 metalc ? ? A GLU 114 OE2 ? ? ? 1_555 J CA . CA ? ? A GLU 114 A CA 509 1_555 ? ? ? ? ? ? ? 2.433 ? ? metalc15 metalc ? ? A ASP 129 OD1 ? ? ? 1_555 E CA . CA ? ? A ASP 129 A CA 504 1_555 ? ? ? ? ? ? ? 2.974 ? ? metalc16 metalc ? ? A ASP 129 OD2 ? ? ? 1_555 E CA . CA ? ? A ASP 129 A CA 504 1_555 ? ? ? ? ? ? ? 2.457 ? ? metalc17 metalc ? ? A ASP 131 OD2 ? ? ? 1_555 E CA . CA ? ? A ASP 131 A CA 504 1_555 ? ? ? ? ? ? ? 2.442 ? ? metalc18 metalc ? ? A ASP 131 OD1 ? ? ? 1_555 G CA . CA ? ? A ASP 131 A CA 506 1_555 ? ? ? ? ? ? ? 2.587 ? ? metalc19 metalc ? ? A ASN 135 O ? ? ? 1_555 E CA . CA ? ? A ASN 135 A CA 504 1_555 ? ? ? ? ? ? ? 2.471 ? ? metalc20 metalc ? ? A ASP 171 OD1 ? ? ? 1_555 H CA . CA ? ? A ASP 171 A CA 507 1_555 ? ? ? ? ? ? ? 2.513 ? ? metalc21 metalc ? ? A GLU 173 OE1 ? ? ? 1_555 H CA . CA ? ? A GLU 173 A CA 507 1_555 ? ? ? ? ? ? ? 2.459 ? ? metalc22 metalc ? ? A GLU 173 OE1 ? ? ? 1_555 J CA . CA ? ? A GLU 173 A CA 509 1_555 ? ? ? ? ? ? ? 2.650 ? ? metalc23 metalc ? ? A GLU 173 OE2 ? ? ? 1_555 J CA . CA ? ? A GLU 173 A CA 509 1_555 ? ? ? ? ? ? ? 2.446 ? ? metalc24 metalc ? ? A ASP 186 OD2 ? ? ? 1_555 E CA . CA ? ? A ASP 186 A CA 504 1_555 ? ? ? ? ? ? ? 2.713 ? ? metalc25 metalc ? ? A ASP 204 OD1 ? ? ? 1_555 J CA . CA ? ? A ASP 204 A CA 509 1_555 ? ? ? ? ? ? ? 2.404 ? ? metalc26 metalc ? ? A ALA 205 O ? ? ? 1_555 J CA . CA ? ? A ALA 205 A CA 509 1_555 ? ? ? ? ? ? ? 2.948 ? ? metalc27 metalc ? ? A ASN 206 OD1 ? ? ? 1_555 B CA . CA ? ? A ASN 206 A CA 501 1_555 ? ? ? ? ? ? ? 2.401 ? ? metalc28 metalc ? ? A ASP 207 OD2 ? ? ? 1_555 H CA . CA ? ? A ASP 207 A CA 507 1_555 ? ? ? ? ? ? ? 2.487 ? ? metalc29 metalc ? ? A ASP 207 OD1 ? ? ? 1_555 J CA . CA ? ? A ASP 207 A CA 509 1_555 ? ? ? ? ? ? ? 2.367 ? ? metalc30 metalc ? ? A ASN 208 O ? ? ? 1_555 B CA . CA ? ? A ASN 208 A CA 501 1_555 ? ? ? ? ? ? ? 2.477 ? ? metalc31 metalc ? ? A GLU 223 OE1 ? ? ? 1_555 D CA . CA ? ? A GLU 223 A CA 503 1_555 ? ? ? ? ? ? ? 3.079 ? ? metalc32 metalc ? ? A GLU 223 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 223 A CA 503 1_555 ? ? ? ? ? ? ? 2.468 ? ? metalc33 metalc ? ? A GLU 223 OE1 ? ? ? 1_555 I CA . CA ? ? A GLU 223 A CA 508 1_555 ? ? ? ? ? ? ? 2.432 ? ? metalc34 metalc ? ? A ASP 238 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 238 A CA 501 1_555 ? ? ? ? ? ? ? 2.573 ? ? metalc35 metalc ? ? A ASP 238 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 238 A CA 501 1_555 ? ? ? ? ? ? ? 2.461 ? ? metalc36 metalc ? ? A ASP 240 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 240 A CA 501 1_555 ? ? ? ? ? ? ? 2.502 ? ? metalc37 metalc ? ? A ASP 240 OD1 ? ? ? 1_555 J CA . CA ? ? A ASP 240 A CA 509 1_555 ? ? ? ? ? ? ? 2.812 ? ? metalc38 metalc ? ? A ASN 244 O ? ? ? 1_555 B CA . CA ? ? A ASN 244 A CA 501 1_555 ? ? ? ? ? ? ? 2.583 ? ? metalc39 metalc ? ? A ASP 278 OD1 ? ? ? 1_555 I CA . CA ? ? A ASP 278 A CA 508 1_555 ? ? ? ? ? ? ? 2.498 ? ? metalc40 metalc ? ? A GLU 280 OE1 ? ? ? 1_555 D CA . CA ? ? A GLU 280 A CA 503 1_555 ? ? ? ? ? ? ? 2.976 ? ? metalc41 metalc ? ? A GLU 280 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 280 A CA 503 1_555 ? ? ? ? ? ? ? 2.475 ? ? metalc42 metalc ? ? A GLU 280 OE1 ? ? ? 1_555 I CA . CA ? ? A GLU 280 A CA 508 1_555 ? ? ? ? ? ? ? 2.933 ? ? metalc43 metalc ? ? A ASP 293 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 293 A CA 501 1_555 ? ? ? ? ? ? ? 2.827 ? ? metalc44 metalc ? ? A ASP 309 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 309 A CA 503 1_555 ? ? ? ? ? ? ? 2.822 ? ? metalc45 metalc ? ? A GLU 310 O ? ? ? 1_555 D CA . CA ? ? A GLU 310 A CA 503 1_555 ? ? ? ? ? ? ? 2.468 ? ? metalc46 metalc ? ? A ASN 311 OD1 ? ? ? 1_555 C CA . CA ? ? A ASN 311 A CA 502 1_555 ? ? ? ? ? ? ? 2.596 ? ? metalc47 metalc ? ? A ASP 312 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 312 A CA 503 1_555 ? ? ? ? ? ? ? 2.482 ? ? metalc48 metalc ? ? A ASP 312 OD2 ? ? ? 1_555 I CA . CA ? ? A ASP 312 A CA 508 1_555 ? ? ? ? ? ? ? 2.619 ? ? metalc49 metalc ? ? A ASN 313 O ? ? ? 1_555 C CA . CA ? ? A ASN 313 A CA 502 1_555 ? ? ? ? ? ? ? 2.532 ? ? metalc50 metalc ? ? A ASP 343 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 343 A CA 502 1_555 ? ? ? ? ? ? ? 2.873 ? ? metalc51 metalc ? ? A ASP 343 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 343 A CA 502 1_555 ? ? ? ? ? ? ? 2.473 ? ? metalc52 metalc ? ? A ASP 345 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 345 A CA 502 1_555 ? ? ? ? ? ? ? 2.730 ? ? metalc53 metalc ? ? A ASP 345 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 345 A CA 503 1_555 ? ? ? ? ? ? ? 2.580 ? ? metalc54 metalc ? ? A ASN 349 O ? ? ? 1_555 C CA . CA ? ? A ASN 349 A CA 502 1_555 ? ? ? ? ? ? ? 2.582 ? ? metalc55 metalc ? ? A ASP 396 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 396 A CA 502 1_555 ? ? ? ? ? ? ? 3.123 ? ? metalc56 metalc ? ? H CA . CA ? ? ? 1_555 K HOH . O ? ? A CA 507 A HOH 638 1_555 ? ? ? ? ? ? ? 2.505 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LYS 82 A . ? LYS 82 A PRO 83 A ? PRO 83 A 1 -3.12 2 GLU 189 A . ? GLU 189 A PRO 190 A ? PRO 190 A 1 -0.14 3 ASN 399 A . ? ASN 399 A PRO 400 A ? PRO 400 A 1 -0.58 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 3 ? AA3 ? 4 ? AA4 ? 3 ? AA5 ? 2 ? AA6 ? 4 ? AA7 ? 3 ? AA8 ? 4 ? AA9 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA5 1 2 ? anti-parallel AA6 1 2 ? parallel AA6 2 3 ? anti-parallel AA6 3 4 ? anti-parallel AA7 1 2 ? anti-parallel AA7 2 3 ? anti-parallel AA8 1 2 ? anti-parallel AA8 2 3 ? anti-parallel AA8 3 4 ? anti-parallel AA9 1 2 ? parallel AA9 2 3 ? anti-parallel AA9 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 3 ? PRO A 8 ? ILE A 3 PRO A 8 AA1 2 ASN A 85 ? GLN A 94 ? ASN A 85 GLN A 94 AA1 3 VAL A 73 ? ALA A 80 ? VAL A 73 ALA A 80 AA1 4 ARG A 37 ? ILE A 39 ? ARG A 37 ILE A 39 AA2 1 LEU A 16 ? ASN A 19 ? LEU A 16 ASN A 19 AA2 2 ASN A 53 ? VAL A 56 ? ASN A 53 VAL A 56 AA2 3 PHE A 45 ? VAL A 47 ? PHE A 45 VAL A 47 AA3 1 ILE A 107 ? SER A 113 ? ILE A 107 SER A 113 AA3 2 SER A 193 ? ALA A 203 ? SER A 193 ALA A 203 AA3 3 HIS A 177 ? ASP A 186 ? HIS A 177 ASP A 186 AA3 4 GLN A 138 ? LEU A 142 ? GLN A 138 LEU A 142 AA4 1 THR A 121 ? ALA A 123 ? THR A 121 ALA A 123 AA4 2 ARG A 160 ? LEU A 166 ? ARG A 160 LEU A 166 AA4 3 PHE A 148 ? GLU A 154 ? PHE A 148 GLU A 154 AA5 1 VAL A 211 ? PHE A 212 ? VAL A 211 PHE A 212 AA5 2 ALA A 236 ? ILE A 237 ? ALA A 236 ILE A 237 AA6 1 MET A 216 ? VAL A 221 ? MET A 216 VAL A 221 AA6 2 THR A 298 ? ILE A 307 ? THR A 298 ILE A 307 AA6 3 SER A 284 ? LYS A 292 ? SER A 284 LYS A 292 AA6 4 ILE A 248 ? ILE A 252 ? ILE A 248 ILE A 252 AA7 1 SER A 230 ? LYS A 233 ? SER A 230 LYS A 233 AA7 2 GLU A 270 ? THR A 273 ? GLU A 270 THR A 273 AA7 3 PHE A 262 ? LEU A 264 ? PHE A 262 LEU A 264 AA8 1 GLU A 316 ? SER A 321 ? GLU A 316 SER A 321 AA8 2 ALA A 335 ? HIS A 342 ? ALA A 335 HIS A 342 AA8 3 THR A 371 ? THR A 376 ? THR A 371 THR A 376 AA8 4 PHE A 362 ? GLN A 366 ? PHE A 362 GLN A 366 AA9 1 HIS A 325 ? GLN A 327 ? HIS A 325 GLN A 327 AA9 2 SER A 403 ? LEU A 413 ? SER A 403 LEU A 413 AA9 3 GLU A 387 ? ASP A 396 ? GLU A 387 ASP A 396 AA9 4 ILE A 352 ? LYS A 357 ? ILE A 352 LYS A 357 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TYR A 5 ? N TYR A 5 O LEU A 92 ? O LEU A 92 AA1 2 3 O PHE A 87 ? O PHE A 87 N MET A 78 ? N MET A 78 AA1 3 4 O VAL A 79 ? O VAL A 79 N ARG A 37 ? N ARG A 37 AA2 1 2 N GLY A 18 ? N GLY A 18 O LEU A 54 ? O LEU A 54 AA2 2 3 O LEU A 55 ? O LEU A 55 N THR A 46 ? N THR A 46 AA3 1 2 N ILE A 112 ? N ILE A 112 O ALA A 203 ? O ALA A 203 AA3 2 3 O THR A 196 ? O THR A 196 N LEU A 182 ? N LEU A 182 AA3 3 4 O THR A 183 ? O THR A 183 N TYR A 141 ? N TYR A 141 AA4 1 2 N PHE A 122 ? N PHE A 122 O LEU A 164 ? O LEU A 164 AA4 2 3 O GLU A 163 ? O GLU A 163 N ILE A 151 ? N ILE A 151 AA5 1 2 N VAL A 211 ? N VAL A 211 O ILE A 237 ? O ILE A 237 AA6 1 2 N VAL A 219 ? N VAL A 219 O ASP A 306 ? O ASP A 306 AA6 2 3 O VAL A 303 ? O VAL A 303 N ILE A 287 ? N ILE A 287 AA6 3 4 O GLU A 290 ? O GLU A 290 N ALA A 250 ? N ALA A 250 AA7 1 2 N VAL A 231 ? N VAL A 231 O LEU A 271 ? O LEU A 271 AA7 2 3 O THR A 272 ? O THR A 272 N LYS A 263 ? N LYS A 263 AA8 1 2 N ALA A 320 ? N ALA A 320 O LEU A 338 ? O LEU A 338 AA8 2 3 N ALA A 337 ? N ALA A 337 O LEU A 374 ? O LEU A 374 AA8 3 4 O VAL A 375 ? O VAL A 375 N LYS A 363 ? N LYS A 363 AA9 1 2 N ILE A 326 ? N ILE A 326 O LEU A 413 ? O LEU A 413 AA9 2 3 O LEU A 410 ? O LEU A 410 N TYR A 388 ? N TYR A 388 AA9 3 4 O THR A 395 ? O THR A 395 N LEU A 353 ? N LEU A 353 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 501 ? 6 'binding site for residue CA A 501' AC2 Software A CA 502 ? 6 'binding site for residue CA A 502' AC3 Software A CA 503 ? 7 'binding site for residue CA A 503' AC4 Software A CA 504 ? 6 'binding site for residue CA A 504' AC5 Software A CA 505 ? 5 'binding site for residue CA A 505' AC6 Software A CA 506 ? 6 'binding site for residue CA A 506' AC7 Software A CA 507 ? 4 'binding site for residue CA A 507' AC8 Software A CA 508 ? 4 'binding site for residue CA A 508' AC9 Software A CA 509 ? 6 'binding site for residue CA A 509' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ASN A 206 ? ASN A 206 . ? 1_555 ? 2 AC1 6 ASN A 208 ? ASN A 208 . ? 1_555 ? 3 AC1 6 ASP A 238 ? ASP A 238 . ? 1_555 ? 4 AC1 6 ASP A 240 ? ASP A 240 . ? 1_555 ? 5 AC1 6 ASN A 244 ? ASN A 244 . ? 1_555 ? 6 AC1 6 ASP A 293 ? ASP A 293 . ? 1_555 ? 7 AC2 6 ASN A 311 ? ASN A 311 . ? 1_555 ? 8 AC2 6 ASN A 313 ? ASN A 313 . ? 1_555 ? 9 AC2 6 ASP A 343 ? ASP A 343 . ? 1_555 ? 10 AC2 6 ASP A 345 ? ASP A 345 . ? 1_555 ? 11 AC2 6 ASN A 349 ? ASN A 349 . ? 1_555 ? 12 AC2 6 ASP A 396 ? ASP A 396 . ? 1_555 ? 13 AC3 7 GLU A 223 ? GLU A 223 . ? 1_555 ? 14 AC3 7 GLU A 280 ? GLU A 280 . ? 1_555 ? 15 AC3 7 ASP A 309 ? ASP A 309 . ? 1_555 ? 16 AC3 7 GLU A 310 ? GLU A 310 . ? 1_555 ? 17 AC3 7 ASP A 312 ? ASP A 312 . ? 1_555 ? 18 AC3 7 ASN A 313 ? ASN A 313 . ? 1_555 ? 19 AC3 7 ASP A 345 ? ASP A 345 . ? 1_555 ? 20 AC4 6 ASN A 97 ? ASN A 97 . ? 1_555 ? 21 AC4 6 ASN A 99 ? ASN A 99 . ? 1_555 ? 22 AC4 6 ASP A 129 ? ASP A 129 . ? 1_555 ? 23 AC4 6 ASP A 131 ? ASP A 131 . ? 1_555 ? 24 AC4 6 ASN A 135 ? ASN A 135 . ? 1_555 ? 25 AC4 6 ASP A 186 ? ASP A 186 . ? 1_555 ? 26 AC5 5 GLU A 9 ? GLU A 9 . ? 1_555 ? 27 AC5 5 GLU A 10 ? GLU A 10 . ? 1_555 ? 28 AC5 5 ASP A 61 ? ASP A 61 . ? 1_555 ? 29 AC5 5 GLU A 63 ? GLU A 63 . ? 1_555 ? 30 AC5 5 ASP A 98 ? ASP A 98 . ? 1_555 ? 31 AC6 6 GLU A 9 ? GLU A 9 . ? 1_555 ? 32 AC6 6 GLU A 63 ? GLU A 63 . ? 1_555 ? 33 AC6 6 ASP A 95 ? ASP A 95 . ? 1_555 ? 34 AC6 6 ILE A 96 ? ILE A 96 . ? 1_555 ? 35 AC6 6 ASP A 98 ? ASP A 98 . ? 1_555 ? 36 AC6 6 ASP A 131 ? ASP A 131 . ? 1_555 ? 37 AC7 4 ASP A 171 ? ASP A 171 . ? 1_555 ? 38 AC7 4 GLU A 173 ? GLU A 173 . ? 1_555 ? 39 AC7 4 ASP A 207 ? ASP A 207 . ? 1_555 ? 40 AC7 4 HOH K . ? HOH A 638 . ? 1_555 ? 41 AC8 4 GLU A 223 ? GLU A 223 . ? 1_555 ? 42 AC8 4 ASP A 278 ? ASP A 278 . ? 1_555 ? 43 AC8 4 GLU A 280 ? GLU A 280 . ? 1_555 ? 44 AC8 4 ASP A 312 ? ASP A 312 . ? 1_555 ? 45 AC9 6 GLU A 114 ? GLU A 114 . ? 1_555 ? 46 AC9 6 GLU A 173 ? GLU A 173 . ? 1_555 ? 47 AC9 6 ASP A 204 ? ASP A 204 . ? 1_555 ? 48 AC9 6 ALA A 205 ? ALA A 205 . ? 1_555 ? 49 AC9 6 ASP A 207 ? ASP A 207 . ? 1_555 ? 50 AC9 6 ASP A 240 ? ASP A 240 . ? 1_555 ? # _atom_sites.entry_id 6MEQ _atom_sites.fract_transf_matrix[1][1] 0.007886 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006138 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018919 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 1 GLU GLU A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 CYS 72 72 72 CYS CYS A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 MET 78 78 78 MET MET A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 GLN 94 94 94 GLN GLN A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 PHE 122 122 122 PHE PHE A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 GLN 128 128 128 GLN GLN A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 PRO 130 130 130 PRO PRO A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 ASN 135 135 135 ASN ASN A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 GLN 138 138 138 GLN GLN A . n A 1 139 GLN 139 139 139 GLN GLN A . n A 1 140 TYR 140 140 140 TYR TYR A . n A 1 141 TYR 141 141 141 TYR TYR A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 PRO 144 144 144 PRO PRO A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 PRO 146 146 146 PRO PRO A . n A 1 147 HIS 147 147 147 HIS HIS A . n A 1 148 PHE 148 148 148 PHE PHE A . n A 1 149 SER 149 149 149 SER SER A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 ILE 151 151 151 ILE ILE A . n A 1 152 GLN 152 152 152 GLN GLN A . n A 1 153 LYS 153 153 153 LYS LYS A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 ASN 155 155 155 ASN ASN A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 SER 159 159 159 SER SER A . n A 1 160 ARG 160 160 160 ARG ARG A . n A 1 161 TYR 161 161 161 TYR TYR A . n A 1 162 PRO 162 162 162 PRO PRO A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 VAL 165 165 165 VAL VAL A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 LYS 167 167 167 LYS LYS A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 PRO 169 169 169 PRO PRO A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 ARG 172 172 172 ARG ARG A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 GLU 174 174 174 GLU GLU A . n A 1 175 GLN 175 175 175 GLN GLN A . n A 1 176 PRO 176 176 176 PRO PRO A . n A 1 177 HIS 177 177 177 HIS HIS A . n A 1 178 HIS 178 178 178 HIS HIS A . n A 1 179 HIS 179 179 179 HIS HIS A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 LEU 182 182 182 LEU LEU A . n A 1 183 THR 183 183 183 THR THR A . n A 1 184 ALA 184 184 184 ALA ALA A . n A 1 185 VAL 185 185 185 VAL VAL A . n A 1 186 ASP 186 186 186 ASP ASP A . n A 1 187 GLY 187 187 187 GLY GLY A . n A 1 188 GLY 188 188 188 GLY GLY A . n A 1 189 GLU 189 189 189 GLU GLU A . n A 1 190 PRO 190 190 190 PRO PRO A . n A 1 191 SER 191 191 191 SER SER A . n A 1 192 ARG 192 192 192 ARG ARG A . n A 1 193 SER 193 193 193 SER SER A . n A 1 194 CYS 194 194 194 CYS CYS A . n A 1 195 THR 195 195 195 THR THR A . n A 1 196 THR 196 196 196 THR THR A . n A 1 197 GLN 197 197 197 GLN GLN A . n A 1 198 ILE 198 198 198 ILE ILE A . n A 1 199 ARG 199 199 199 ARG ARG A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 ILE 201 201 201 ILE ILE A . n A 1 202 VAL 202 202 202 VAL VAL A . n A 1 203 ALA 203 203 203 ALA ALA A . n A 1 204 ASP 204 204 204 ASP ASP A . n A 1 205 ALA 205 205 205 ALA ALA A . n A 1 206 ASN 206 206 206 ASN ASN A . n A 1 207 ASP 207 207 207 ASP ASP A . n A 1 208 ASN 208 208 208 ASN ASN A . n A 1 209 PRO 209 209 209 PRO PRO A . n A 1 210 PRO 210 210 210 PRO PRO A . n A 1 211 VAL 211 211 211 VAL VAL A . n A 1 212 PHE 212 212 212 PHE PHE A . n A 1 213 THR 213 213 213 THR THR A . n A 1 214 GLN 214 214 214 GLN GLN A . n A 1 215 ASP 215 215 215 ASP ASP A . n A 1 216 MET 216 216 216 MET MET A . n A 1 217 TYR 217 217 217 TYR TYR A . n A 1 218 ARG 218 218 218 ARG ARG A . n A 1 219 VAL 219 219 219 VAL VAL A . n A 1 220 ASN 220 220 220 ASN ASN A . n A 1 221 VAL 221 221 221 VAL VAL A . n A 1 222 ALA 222 222 222 ALA ALA A . n A 1 223 GLU 223 223 223 GLU GLU A . n A 1 224 ASN 224 224 224 ASN ASN A . n A 1 225 LEU 225 225 225 LEU LEU A . n A 1 226 PRO 226 226 226 PRO PRO A . n A 1 227 ALA 227 227 227 ALA ALA A . n A 1 228 GLY 228 228 228 GLY GLY A . n A 1 229 SER 229 229 229 SER SER A . n A 1 230 SER 230 230 230 SER SER A . n A 1 231 VAL 231 231 231 VAL VAL A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 LYS 233 233 233 LYS LYS A . n A 1 234 VAL 234 234 234 VAL VAL A . n A 1 235 MET 235 235 235 MET MET A . n A 1 236 ALA 236 236 236 ALA ALA A . n A 1 237 ILE 237 237 237 ILE ILE A . n A 1 238 ASP 238 238 238 ASP ASP A . n A 1 239 MET 239 239 239 MET MET A . n A 1 240 ASP 240 240 240 ASP ASP A . n A 1 241 GLU 241 241 241 GLU GLU A . n A 1 242 GLY 242 242 242 GLY GLY A . n A 1 243 ILE 243 243 243 ILE ILE A . n A 1 244 ASN 244 244 244 ASN ASN A . n A 1 245 ALA 245 245 245 ALA ALA A . n A 1 246 GLU 246 246 246 GLU GLU A . n A 1 247 ILE 247 247 247 ILE ILE A . n A 1 248 ILE 248 248 248 ILE ILE A . n A 1 249 TYR 249 249 249 TYR TYR A . n A 1 250 ALA 250 250 250 ALA ALA A . n A 1 251 PHE 251 251 251 PHE PHE A . n A 1 252 ILE 252 252 252 ILE ILE A . n A 1 253 ASN 253 253 253 ASN ASN A . n A 1 254 ILE 254 254 254 ILE ILE A . n A 1 255 GLY 255 255 255 GLY GLY A . n A 1 256 LYS 256 256 256 LYS LYS A . n A 1 257 GLU 257 257 257 GLU GLU A . n A 1 258 VAL 258 258 258 VAL VAL A . n A 1 259 ARG 259 259 259 ARG ARG A . n A 1 260 GLN 260 260 260 GLN GLN A . n A 1 261 LEU 261 261 261 LEU LEU A . n A 1 262 PHE 262 262 262 PHE PHE A . n A 1 263 LYS 263 263 263 LYS LYS A . n A 1 264 LEU 264 264 264 LEU LEU A . n A 1 265 ASP 265 265 265 ASP ASP A . n A 1 266 SER 266 266 266 SER SER A . n A 1 267 LYS 267 267 267 LYS LYS A . n A 1 268 THR 268 268 268 THR THR A . n A 1 269 GLY 269 269 269 GLY GLY A . n A 1 270 GLU 270 270 270 GLU GLU A . n A 1 271 LEU 271 271 271 LEU LEU A . n A 1 272 THR 272 272 272 THR THR A . n A 1 273 THR 273 273 273 THR THR A . n A 1 274 ILE 274 274 274 ILE ILE A . n A 1 275 GLY 275 275 275 GLY GLY A . n A 1 276 GLU 276 276 276 GLU GLU A . n A 1 277 LEU 277 277 277 LEU LEU A . n A 1 278 ASP 278 278 278 ASP ASP A . n A 1 279 PHE 279 279 279 PHE PHE A . n A 1 280 GLU 280 280 280 GLU GLU A . n A 1 281 GLU 281 281 281 GLU GLU A . n A 1 282 ARG 282 282 282 ARG ARG A . n A 1 283 ASP 283 283 283 ASP ASP A . n A 1 284 SER 284 284 284 SER SER A . n A 1 285 TYR 285 285 285 TYR TYR A . n A 1 286 THR 286 286 286 THR THR A . n A 1 287 ILE 287 287 287 ILE ILE A . n A 1 288 GLY 288 288 288 GLY GLY A . n A 1 289 VAL 289 289 289 VAL VAL A . n A 1 290 GLU 290 290 290 GLU GLU A . n A 1 291 ALA 291 291 291 ALA ALA A . n A 1 292 LYS 292 292 292 LYS LYS A . n A 1 293 ASP 293 293 293 ASP ASP A . n A 1 294 GLY 294 294 294 GLY GLY A . n A 1 295 GLY 295 295 295 GLY GLY A . n A 1 296 HIS 296 296 296 HIS HIS A . n A 1 297 HIS 297 297 297 HIS HIS A . n A 1 298 THR 298 298 298 THR THR A . n A 1 299 ALA 299 299 299 ALA ALA A . n A 1 300 TYR 300 300 300 TYR TYR A . n A 1 301 CYS 301 301 301 CYS CYS A . n A 1 302 LYS 302 302 302 LYS LYS A . n A 1 303 VAL 303 303 303 VAL VAL A . n A 1 304 GLN 304 304 304 GLN GLN A . n A 1 305 ILE 305 305 305 ILE ILE A . n A 1 306 ASP 306 306 306 ASP ASP A . n A 1 307 ILE 307 307 307 ILE ILE A . n A 1 308 SER 308 308 308 SER SER A . n A 1 309 ASP 309 309 309 ASP ASP A . n A 1 310 GLU 310 310 310 GLU GLU A . n A 1 311 ASN 311 311 311 ASN ASN A . n A 1 312 ASP 312 312 312 ASP ASP A . n A 1 313 ASN 313 313 313 ASN ASN A . n A 1 314 ALA 314 314 314 ALA ALA A . n A 1 315 PRO 315 315 315 PRO PRO A . n A 1 316 GLU 316 316 316 GLU GLU A . n A 1 317 ILE 317 317 317 ILE ILE A . n A 1 318 THR 318 318 318 THR THR A . n A 1 319 LEU 319 319 319 LEU LEU A . n A 1 320 ALA 320 320 320 ALA ALA A . n A 1 321 SER 321 321 321 SER SER A . n A 1 322 GLU 322 322 322 GLU GLU A . n A 1 323 SER 323 323 323 SER SER A . n A 1 324 GLN 324 324 324 GLN GLN A . n A 1 325 HIS 325 325 325 HIS HIS A . n A 1 326 ILE 326 326 326 ILE ILE A . n A 1 327 GLN 327 327 327 GLN GLN A . n A 1 328 GLU 328 328 328 GLU GLU A . n A 1 329 ASP 329 329 329 ASP ASP A . n A 1 330 ALA 330 330 330 ALA ALA A . n A 1 331 GLU 331 331 331 GLU GLU A . n A 1 332 LEU 332 332 332 LEU LEU A . n A 1 333 GLY 333 333 333 GLY GLY A . n A 1 334 THR 334 334 334 THR THR A . n A 1 335 ALA 335 335 335 ALA ALA A . n A 1 336 VAL 336 336 336 VAL VAL A . n A 1 337 ALA 337 337 337 ALA ALA A . n A 1 338 LEU 338 338 338 LEU LEU A . n A 1 339 ILE 339 339 339 ILE ILE A . n A 1 340 LYS 340 340 340 LYS LYS A . n A 1 341 THR 341 341 341 THR THR A . n A 1 342 HIS 342 342 342 HIS HIS A . n A 1 343 ASP 343 343 343 ASP ASP A . n A 1 344 LEU 344 344 344 LEU LEU A . n A 1 345 ASP 345 345 345 ASP ASP A . n A 1 346 SER 346 346 346 SER SER A . n A 1 347 GLY 347 347 347 GLY GLY A . n A 1 348 PHE 348 348 348 PHE PHE A . n A 1 349 ASN 349 349 349 ASN ASN A . n A 1 350 GLY 350 350 350 GLY GLY A . n A 1 351 GLU 351 351 351 GLU GLU A . n A 1 352 ILE 352 352 352 ILE ILE A . n A 1 353 LEU 353 353 353 LEU LEU A . n A 1 354 CYS 354 354 354 CYS CYS A . n A 1 355 GLN 355 355 355 GLN GLN A . n A 1 356 LEU 356 356 356 LEU LEU A . n A 1 357 LYS 357 357 357 LYS LYS A . n A 1 358 GLY 358 358 358 GLY GLY A . n A 1 359 ASN 359 359 359 ASN ASN A . n A 1 360 PHE 360 360 360 PHE PHE A . n A 1 361 PRO 361 361 361 PRO PRO A . n A 1 362 PHE 362 362 362 PHE PHE A . n A 1 363 LYS 363 363 363 LYS LYS A . n A 1 364 ILE 364 364 364 ILE ILE A . n A 1 365 VAL 365 365 365 VAL VAL A . n A 1 366 GLN 366 366 366 GLN GLN A . n A 1 367 ASP 367 367 367 ASP ASP A . n A 1 368 THR 368 368 368 THR THR A . n A 1 369 LYS 369 369 369 LYS LYS A . n A 1 370 ASN 370 370 370 ASN ASN A . n A 1 371 THR 371 371 371 THR THR A . n A 1 372 TYR 372 372 372 TYR TYR A . n A 1 373 ARG 373 373 373 ARG ARG A . n A 1 374 LEU 374 374 374 LEU LEU A . n A 1 375 VAL 375 375 375 VAL VAL A . n A 1 376 THR 376 376 376 THR THR A . n A 1 377 ASP 377 377 377 ASP ASP A . n A 1 378 GLY 378 378 378 GLY GLY A . n A 1 379 ALA 379 379 379 ALA ALA A . n A 1 380 LEU 380 380 380 LEU LEU A . n A 1 381 ASP 381 381 381 ASP ASP A . n A 1 382 ARG 382 382 382 ARG ARG A . n A 1 383 GLU 383 383 383 GLU GLU A . n A 1 384 GLN 384 384 384 GLN GLN A . n A 1 385 ILE 385 385 385 ILE ILE A . n A 1 386 PRO 386 386 386 PRO PRO A . n A 1 387 GLU 387 387 387 GLU GLU A . n A 1 388 TYR 388 388 388 TYR TYR A . n A 1 389 ASN 389 389 389 ASN ASN A . n A 1 390 VAL 390 390 390 VAL VAL A . n A 1 391 THR 391 391 391 THR THR A . n A 1 392 ILE 392 392 392 ILE ILE A . n A 1 393 THR 393 393 393 THR THR A . n A 1 394 ALA 394 394 394 ALA ALA A . n A 1 395 THR 395 395 395 THR THR A . n A 1 396 ASP 396 396 396 ASP ASP A . n A 1 397 LYS 397 397 397 LYS LYS A . n A 1 398 GLY 398 398 398 GLY GLY A . n A 1 399 ASN 399 399 399 ASN ASN A . n A 1 400 PRO 400 400 400 PRO PRO A . n A 1 401 PRO 401 401 401 PRO PRO A . n A 1 402 LEU 402 402 402 LEU LEU A . n A 1 403 SER 403 403 403 SER SER A . n A 1 404 SER 404 404 404 SER SER A . n A 1 405 SER 405 405 405 SER SER A . n A 1 406 LYS 406 406 406 LYS LYS A . n A 1 407 THR 407 407 407 THR THR A . n A 1 408 ILE 408 408 408 ILE ILE A . n A 1 409 THR 409 409 409 THR THR A . n A 1 410 LEU 410 410 410 LEU LEU A . n A 1 411 HIS 411 411 411 HIS HIS A . n A 1 412 ILE 412 412 412 ILE ILE A . n A 1 413 LEU 413 413 413 LEU LEU A . n A 1 414 ASP 414 414 414 ASP ASP A . n A 1 415 ALA 415 415 415 ALA ALA A . n A 1 416 ALA 416 416 416 ALA ALA A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 501 9 CA CA A . C 2 CA 1 502 12 CA CA A . D 2 CA 1 503 14 CA CA A . E 2 CA 1 504 16 CA CA A . F 2 CA 1 505 17 CA CA A . G 2 CA 1 506 21 CA CA A . H 2 CA 1 507 24 CA CA A . I 2 CA 1 508 25 CA CA A . J 2 CA 1 509 26 CA CA A . K 3 HOH 1 601 224 HOH HOH A . K 3 HOH 2 602 223 HOH HOH A . K 3 HOH 3 603 159 HOH HOH A . K 3 HOH 4 604 217 HOH HOH A . K 3 HOH 5 605 181 HOH HOH A . K 3 HOH 6 606 234 HOH HOH A . K 3 HOH 7 607 210 HOH HOH A . K 3 HOH 8 608 104 HOH HOH A . K 3 HOH 9 609 228 HOH HOH A . K 3 HOH 10 610 169 HOH HOH A . K 3 HOH 11 611 63 HOH HOH A . K 3 HOH 12 612 168 HOH HOH A . K 3 HOH 13 613 1 HOH HOH A . K 3 HOH 14 614 201 HOH HOH A . K 3 HOH 15 615 175 HOH HOH A . K 3 HOH 16 616 160 HOH HOH A . K 3 HOH 17 617 153 HOH HOH A . K 3 HOH 18 618 200 HOH HOH A . K 3 HOH 19 619 222 HOH HOH A . K 3 HOH 20 620 173 HOH HOH A . K 3 HOH 21 621 142 HOH HOH A . K 3 HOH 22 622 220 HOH HOH A . K 3 HOH 23 623 207 HOH HOH A . K 3 HOH 24 624 166 HOH HOH A . K 3 HOH 25 625 197 HOH HOH A . K 3 HOH 26 626 178 HOH HOH A . K 3 HOH 27 627 193 HOH HOH A . K 3 HOH 28 628 225 HOH HOH A . K 3 HOH 29 629 165 HOH HOH A . K 3 HOH 30 630 214 HOH HOH A . K 3 HOH 31 631 85 HOH HOH A . K 3 HOH 32 632 170 HOH HOH A . K 3 HOH 33 633 157 HOH HOH A . K 3 HOH 34 634 226 HOH HOH A . K 3 HOH 35 635 156 HOH HOH A . K 3 HOH 36 636 152 HOH HOH A . K 3 HOH 37 637 15 HOH HOH A . K 3 HOH 38 638 229 HOH HOH A . K 3 HOH 39 639 187 HOH HOH A . K 3 HOH 40 640 7 HOH HOH A . K 3 HOH 41 641 32 HOH HOH A . K 3 HOH 42 642 230 HOH HOH A . K 3 HOH 43 643 161 HOH HOH A . K 3 HOH 44 644 123 HOH HOH A . K 3 HOH 45 645 163 HOH HOH A . K 3 HOH 46 646 167 HOH HOH A . K 3 HOH 47 647 78 HOH HOH A . K 3 HOH 48 648 154 HOH HOH A . K 3 HOH 49 649 233 HOH HOH A . K 3 HOH 50 650 212 HOH HOH A . K 3 HOH 51 651 203 HOH HOH A . K 3 HOH 52 652 195 HOH HOH A . K 3 HOH 53 653 215 HOH HOH A . K 3 HOH 54 654 80 HOH HOH A . K 3 HOH 55 655 218 HOH HOH A . K 3 HOH 56 656 206 HOH HOH A . K 3 HOH 57 657 5 HOH HOH A . K 3 HOH 58 658 194 HOH HOH A . K 3 HOH 59 659 150 HOH HOH A . K 3 HOH 60 660 231 HOH HOH A . K 3 HOH 61 661 227 HOH HOH A . K 3 HOH 62 662 186 HOH HOH A . K 3 HOH 63 663 77 HOH HOH A . K 3 HOH 64 664 122 HOH HOH A . K 3 HOH 65 665 172 HOH HOH A . K 3 HOH 66 666 6 HOH HOH A . K 3 HOH 67 667 190 HOH HOH A . K 3 HOH 68 668 185 HOH HOH A . K 3 HOH 69 669 180 HOH HOH A . K 3 HOH 70 670 204 HOH HOH A . K 3 HOH 71 671 171 HOH HOH A . K 3 HOH 72 672 191 HOH HOH A . K 3 HOH 73 673 179 HOH HOH A . K 3 HOH 74 674 209 HOH HOH A . K 3 HOH 75 675 61 HOH HOH A . K 3 HOH 76 676 52 HOH HOH A . K 3 HOH 77 677 106 HOH HOH A . K 3 HOH 78 678 188 HOH HOH A . K 3 HOH 79 679 213 HOH HOH A . K 3 HOH 80 680 183 HOH HOH A . K 3 HOH 81 681 232 HOH HOH A . K 3 HOH 82 682 144 HOH HOH A . K 3 HOH 83 683 131 HOH HOH A . K 3 HOH 84 684 149 HOH HOH A . K 3 HOH 85 685 196 HOH HOH A . K 3 HOH 86 686 221 HOH HOH A . K 3 HOH 87 687 127 HOH HOH A . K 3 HOH 88 688 216 HOH HOH A . K 3 HOH 89 689 147 HOH HOH A . K 3 HOH 90 690 146 HOH HOH A . K 3 HOH 91 691 205 HOH HOH A . K 3 HOH 92 692 192 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3860 ? 1 MORE -98 ? 1 'SSA (A^2)' 44280 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 671 ? K HOH . 2 1 A HOH 688 ? K HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 9 ? A GLU 9 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 OE2 ? A GLU 10 ? A GLU 10 ? 1_555 87.0 ? 2 OE1 ? A GLU 9 ? A GLU 9 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 OD1 ? A ASP 61 ? A ASP 61 ? 1_555 87.0 ? 3 OE2 ? A GLU 10 ? A GLU 10 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 OD1 ? A ASP 61 ? A ASP 61 ? 1_555 74.6 ? 4 OE1 ? A GLU 9 ? A GLU 9 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 OE1 ? A GLU 63 ? A GLU 63 ? 1_555 80.1 ? 5 OE2 ? A GLU 10 ? A GLU 10 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 OE1 ? A GLU 63 ? A GLU 63 ? 1_555 146.4 ? 6 OD1 ? A ASP 61 ? A ASP 61 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 OE1 ? A GLU 63 ? A GLU 63 ? 1_555 73.8 ? 7 OE1 ? A GLU 9 ? A GLU 9 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 OD2 ? A ASP 98 ? A ASP 98 ? 1_555 99.8 ? 8 OE2 ? A GLU 10 ? A GLU 10 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 OD2 ? A ASP 98 ? A ASP 98 ? 1_555 92.9 ? 9 OD1 ? A ASP 61 ? A ASP 61 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 OD2 ? A ASP 98 ? A ASP 98 ? 1_555 165.6 ? 10 OE1 ? A GLU 63 ? A GLU 63 ? 1_555 CA ? F CA . ? A CA 505 ? 1_555 OD2 ? A ASP 98 ? A ASP 98 ? 1_555 119.7 ? 11 OE2 ? A GLU 9 ? A GLU 9 ? 1_555 CA ? G CA . ? A CA 506 ? 1_555 OE1 ? A GLU 63 ? A GLU 63 ? 1_555 82.9 ? 12 OE2 ? A GLU 9 ? A GLU 9 ? 1_555 CA ? G CA . ? A CA 506 ? 1_555 OE2 ? A GLU 63 ? A GLU 63 ? 1_555 102.8 ? 13 OE1 ? A GLU 63 ? A GLU 63 ? 1_555 CA ? G CA . ? A CA 506 ? 1_555 OE2 ? A GLU 63 ? A GLU 63 ? 1_555 45.2 ? 14 OE2 ? A GLU 9 ? A GLU 9 ? 1_555 CA ? G CA . ? A CA 506 ? 1_555 OD1 ? A ASP 95 ? A ASP 95 ? 1_555 78.8 ? 15 OE1 ? A GLU 63 ? A GLU 63 ? 1_555 CA ? G CA . ? A CA 506 ? 1_555 OD1 ? A ASP 95 ? A ASP 95 ? 1_555 110.1 ? 16 OE2 ? A GLU 63 ? A GLU 63 ? 1_555 CA ? G CA . ? A CA 506 ? 1_555 OD1 ? A ASP 95 ? A ASP 95 ? 1_555 74.8 ? 17 OE2 ? A GLU 9 ? A GLU 9 ? 1_555 CA ? G CA . ? A CA 506 ? 1_555 O ? A ILE 96 ? A ILE 96 ? 1_555 90.0 ? 18 OE1 ? A GLU 63 ? A GLU 63 ? 1_555 CA ? G CA . ? A CA 506 ? 1_555 O ? A ILE 96 ? A ILE 96 ? 1_555 162.0 ? 19 OE2 ? A GLU 63 ? A GLU 63 ? 1_555 CA ? G CA . ? A CA 506 ? 1_555 O ? A ILE 96 ? A ILE 96 ? 1_555 152.7 ? 20 OD1 ? A ASP 95 ? A ASP 95 ? 1_555 CA ? G CA . ? A CA 506 ? 1_555 O ? A ILE 96 ? A ILE 96 ? 1_555 84.4 ? 21 OE2 ? A GLU 9 ? A GLU 9 ? 1_555 CA ? G CA . ? A CA 506 ? 1_555 OD1 ? A ASP 98 ? A ASP 98 ? 1_555 97.3 ? 22 OE1 ? A GLU 63 ? A GLU 63 ? 1_555 CA ? G CA . ? A CA 506 ? 1_555 OD1 ? A ASP 98 ? A ASP 98 ? 1_555 89.9 ? 23 OE2 ? A GLU 63 ? A GLU 63 ? 1_555 CA ? G CA . ? A CA 506 ? 1_555 OD1 ? A ASP 98 ? A ASP 98 ? 1_555 126.3 ? 24 OD1 ? A ASP 95 ? A ASP 95 ? 1_555 CA ? G CA . ? A CA 506 ? 1_555 OD1 ? A ASP 98 ? A ASP 98 ? 1_555 158.7 ? 25 O ? A ILE 96 ? A ILE 96 ? 1_555 CA ? G CA . ? A CA 506 ? 1_555 OD1 ? A ASP 98 ? A ASP 98 ? 1_555 74.6 ? 26 OE2 ? A GLU 9 ? A GLU 9 ? 1_555 CA ? G CA . ? A CA 506 ? 1_555 OD1 ? A ASP 131 ? A ASP 131 ? 1_555 172.6 ? 27 OE1 ? A GLU 63 ? A GLU 63 ? 1_555 CA ? G CA . ? A CA 506 ? 1_555 OD1 ? A ASP 131 ? A ASP 131 ? 1_555 91.6 ? 28 OE2 ? A GLU 63 ? A GLU 63 ? 1_555 CA ? G CA . ? A CA 506 ? 1_555 OD1 ? A ASP 131 ? A ASP 131 ? 1_555 69.8 ? 29 OD1 ? A ASP 95 ? A ASP 95 ? 1_555 CA ? G CA . ? A CA 506 ? 1_555 OD1 ? A ASP 131 ? A ASP 131 ? 1_555 98.5 ? 30 O ? A ILE 96 ? A ILE 96 ? 1_555 CA ? G CA . ? A CA 506 ? 1_555 OD1 ? A ASP 131 ? A ASP 131 ? 1_555 96.7 ? 31 OD1 ? A ASP 98 ? A ASP 98 ? 1_555 CA ? G CA . ? A CA 506 ? 1_555 OD1 ? A ASP 131 ? A ASP 131 ? 1_555 87.7 ? 32 OD1 ? A ASN 97 ? A ASN 97 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 O ? A ASN 99 ? A ASN 99 ? 1_555 93.2 ? 33 OD1 ? A ASN 97 ? A ASN 97 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 OD1 ? A ASP 129 ? A ASP 129 ? 1_555 152.3 ? 34 O ? A ASN 99 ? A ASN 99 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 OD1 ? A ASP 129 ? A ASP 129 ? 1_555 72.4 ? 35 OD1 ? A ASN 97 ? A ASN 97 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 OD2 ? A ASP 129 ? A ASP 129 ? 1_555 157.0 ? 36 O ? A ASN 99 ? A ASN 99 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 OD2 ? A ASP 129 ? A ASP 129 ? 1_555 82.0 ? 37 OD1 ? A ASP 129 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 OD2 ? A ASP 129 ? A ASP 129 ? 1_555 46.5 ? 38 OD1 ? A ASN 97 ? A ASN 97 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 OD2 ? A ASP 131 ? A ASP 131 ? 1_555 83.5 ? 39 O ? A ASN 99 ? A ASN 99 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 OD2 ? A ASP 131 ? A ASP 131 ? 1_555 75.4 ? 40 OD1 ? A ASP 129 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 OD2 ? A ASP 131 ? A ASP 131 ? 1_555 70.2 ? 41 OD2 ? A ASP 129 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 OD2 ? A ASP 131 ? A ASP 131 ? 1_555 116.5 ? 42 OD1 ? A ASN 97 ? A ASN 97 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 O ? A ASN 135 ? A ASN 135 ? 1_555 98.5 ? 43 O ? A ASN 99 ? A ASN 99 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 O ? A ASN 135 ? A ASN 135 ? 1_555 167.5 ? 44 OD1 ? A ASP 129 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 O ? A ASN 135 ? A ASN 135 ? 1_555 98.5 ? 45 OD2 ? A ASP 129 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 O ? A ASN 135 ? A ASN 135 ? 1_555 85.6 ? 46 OD2 ? A ASP 131 ? A ASP 131 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 O ? A ASN 135 ? A ASN 135 ? 1_555 110.0 ? 47 OD1 ? A ASN 97 ? A ASN 97 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 OD2 ? A ASP 186 ? A ASP 186 ? 1_555 67.2 ? 48 O ? A ASN 99 ? A ASN 99 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 OD2 ? A ASP 186 ? A ASP 186 ? 1_555 104.3 ? 49 OD1 ? A ASP 129 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 OD2 ? A ASP 186 ? A ASP 186 ? 1_555 138.5 ? 50 OD2 ? A ASP 129 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 OD2 ? A ASP 186 ? A ASP 186 ? 1_555 92.1 ? 51 OD2 ? A ASP 131 ? A ASP 131 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 OD2 ? A ASP 186 ? A ASP 186 ? 1_555 150.7 ? 52 O ? A ASN 135 ? A ASN 135 ? 1_555 CA ? E CA . ? A CA 504 ? 1_555 OD2 ? A ASP 186 ? A ASP 186 ? 1_555 76.6 ? 53 OE2 ? A GLU 114 ? A GLU 114 ? 1_555 CA ? J CA . ? A CA 509 ? 1_555 OE1 ? A GLU 173 ? A GLU 173 ? 1_555 102.7 ? 54 OE2 ? A GLU 114 ? A GLU 114 ? 1_555 CA ? J CA . ? A CA 509 ? 1_555 OE2 ? A GLU 173 ? A GLU 173 ? 1_555 149.2 ? 55 OE1 ? A GLU 173 ? A GLU 173 ? 1_555 CA ? J CA . ? A CA 509 ? 1_555 OE2 ? A GLU 173 ? A GLU 173 ? 1_555 50.8 ? 56 OE2 ? A GLU 114 ? A GLU 114 ? 1_555 CA ? J CA . ? A CA 509 ? 1_555 OD1 ? A ASP 204 ? A ASP 204 ? 1_555 96.4 ? 57 OE1 ? A GLU 173 ? A GLU 173 ? 1_555 CA ? J CA . ? A CA 509 ? 1_555 OD1 ? A ASP 204 ? A ASP 204 ? 1_555 116.1 ? 58 OE2 ? A GLU 173 ? A GLU 173 ? 1_555 CA ? J CA . ? A CA 509 ? 1_555 OD1 ? A ASP 204 ? A ASP 204 ? 1_555 85.2 ? 59 OE2 ? A GLU 114 ? A GLU 114 ? 1_555 CA ? J CA . ? A CA 509 ? 1_555 O ? A ALA 205 ? A ALA 205 ? 1_555 62.2 ? 60 OE1 ? A GLU 173 ? A GLU 173 ? 1_555 CA ? J CA . ? A CA 509 ? 1_555 O ? A ALA 205 ? A ALA 205 ? 1_555 155.4 ? 61 OE2 ? A GLU 173 ? A GLU 173 ? 1_555 CA ? J CA . ? A CA 509 ? 1_555 O ? A ALA 205 ? A ALA 205 ? 1_555 148.2 ? 62 OD1 ? A ASP 204 ? A ASP 204 ? 1_555 CA ? J CA . ? A CA 509 ? 1_555 O ? A ALA 205 ? A ALA 205 ? 1_555 86.1 ? 63 OE2 ? A GLU 114 ? A GLU 114 ? 1_555 CA ? J CA . ? A CA 509 ? 1_555 OD1 ? A ASP 207 ? A ASP 207 ? 1_555 80.9 ? 64 OE1 ? A GLU 173 ? A GLU 173 ? 1_555 CA ? J CA . ? A CA 509 ? 1_555 OD1 ? A ASP 207 ? A ASP 207 ? 1_555 95.9 ? 65 OE2 ? A GLU 173 ? A GLU 173 ? 1_555 CA ? J CA . ? A CA 509 ? 1_555 OD1 ? A ASP 207 ? A ASP 207 ? 1_555 113.5 ? 66 OD1 ? A ASP 204 ? A ASP 204 ? 1_555 CA ? J CA . ? A CA 509 ? 1_555 OD1 ? A ASP 207 ? A ASP 207 ? 1_555 147.5 ? 67 O ? A ALA 205 ? A ALA 205 ? 1_555 CA ? J CA . ? A CA 509 ? 1_555 OD1 ? A ASP 207 ? A ASP 207 ? 1_555 63.8 ? 68 OE2 ? A GLU 114 ? A GLU 114 ? 1_555 CA ? J CA . ? A CA 509 ? 1_555 OD1 ? A ASP 240 ? A ASP 240 ? 1_555 135.3 ? 69 OE1 ? A GLU 173 ? A GLU 173 ? 1_555 CA ? J CA . ? A CA 509 ? 1_555 OD1 ? A ASP 240 ? A ASP 240 ? 1_555 109.0 ? 70 OE2 ? A GLU 173 ? A GLU 173 ? 1_555 CA ? J CA . ? A CA 509 ? 1_555 OD1 ? A ASP 240 ? A ASP 240 ? 1_555 74.4 ? 71 OD1 ? A ASP 204 ? A ASP 204 ? 1_555 CA ? J CA . ? A CA 509 ? 1_555 OD1 ? A ASP 240 ? A ASP 240 ? 1_555 97.1 ? 72 O ? A ALA 205 ? A ALA 205 ? 1_555 CA ? J CA . ? A CA 509 ? 1_555 OD1 ? A ASP 240 ? A ASP 240 ? 1_555 76.4 ? 73 OD1 ? A ASP 207 ? A ASP 207 ? 1_555 CA ? J CA . ? A CA 509 ? 1_555 OD1 ? A ASP 240 ? A ASP 240 ? 1_555 65.4 ? 74 OD1 ? A ASP 171 ? A ASP 171 ? 1_555 CA ? H CA . ? A CA 507 ? 1_555 OE1 ? A GLU 173 ? A GLU 173 ? 1_555 76.8 ? 75 OD1 ? A ASP 171 ? A ASP 171 ? 1_555 CA ? H CA . ? A CA 507 ? 1_555 OD2 ? A ASP 207 ? A ASP 207 ? 1_555 98.0 ? 76 OE1 ? A GLU 173 ? A GLU 173 ? 1_555 CA ? H CA . ? A CA 507 ? 1_555 OD2 ? A ASP 207 ? A ASP 207 ? 1_555 92.0 ? 77 OD1 ? A ASP 171 ? A ASP 171 ? 1_555 CA ? H CA . ? A CA 507 ? 1_555 O ? K HOH . ? A HOH 638 ? 1_555 84.4 ? 78 OE1 ? A GLU 173 ? A GLU 173 ? 1_555 CA ? H CA . ? A CA 507 ? 1_555 O ? K HOH . ? A HOH 638 ? 1_555 161.0 ? 79 OD2 ? A ASP 207 ? A ASP 207 ? 1_555 CA ? H CA . ? A CA 507 ? 1_555 O ? K HOH . ? A HOH 638 ? 1_555 92.5 ? 80 OD1 ? A ASN 206 ? A ASN 206 ? 1_555 CA ? B CA . ? A CA 501 ? 1_555 O ? A ASN 208 ? A ASN 208 ? 1_555 107.8 ? 81 OD1 ? A ASN 206 ? A ASN 206 ? 1_555 CA ? B CA . ? A CA 501 ? 1_555 OD1 ? A ASP 238 ? A ASP 238 ? 1_555 146.4 ? 82 O ? A ASN 208 ? A ASN 208 ? 1_555 CA ? B CA . ? A CA 501 ? 1_555 OD1 ? A ASP 238 ? A ASP 238 ? 1_555 75.5 ? 83 OD1 ? A ASN 206 ? A ASN 206 ? 1_555 CA ? B CA . ? A CA 501 ? 1_555 OD2 ? A ASP 238 ? A ASP 238 ? 1_555 148.4 ? 84 O ? A ASN 208 ? A ASN 208 ? 1_555 CA ? B CA . ? A CA 501 ? 1_555 OD2 ? A ASP 238 ? A ASP 238 ? 1_555 102.3 ? 85 OD1 ? A ASP 238 ? A ASP 238 ? 1_555 CA ? B CA . ? A CA 501 ? 1_555 OD2 ? A ASP 238 ? A ASP 238 ? 1_555 51.6 ? 86 OD1 ? A ASN 206 ? A ASN 206 ? 1_555 CA ? B CA . ? A CA 501 ? 1_555 OD2 ? A ASP 240 ? A ASP 240 ? 1_555 69.8 ? 87 O ? A ASN 208 ? A ASN 208 ? 1_555 CA ? B CA . ? A CA 501 ? 1_555 OD2 ? A ASP 240 ? A ASP 240 ? 1_555 73.6 ? 88 OD1 ? A ASP 238 ? A ASP 238 ? 1_555 CA ? B CA . ? A CA 501 ? 1_555 OD2 ? A ASP 240 ? A ASP 240 ? 1_555 79.6 ? 89 OD2 ? A ASP 238 ? A ASP 238 ? 1_555 CA ? B CA . ? A CA 501 ? 1_555 OD2 ? A ASP 240 ? A ASP 240 ? 1_555 129.4 ? 90 OD1 ? A ASN 206 ? A ASN 206 ? 1_555 CA ? B CA . ? A CA 501 ? 1_555 O ? A ASN 244 ? A ASN 244 ? 1_555 84.0 ? 91 O ? A ASN 208 ? A ASN 208 ? 1_555 CA ? B CA . ? A CA 501 ? 1_555 O ? A ASN 244 ? A ASN 244 ? 1_555 157.3 ? 92 OD1 ? A ASP 238 ? A ASP 238 ? 1_555 CA ? B CA . ? A CA 501 ? 1_555 O ? A ASN 244 ? A ASN 244 ? 1_555 84.0 ? 93 OD2 ? A ASP 238 ? A ASP 238 ? 1_555 CA ? B CA . ? A CA 501 ? 1_555 O ? A ASN 244 ? A ASN 244 ? 1_555 71.3 ? 94 OD2 ? A ASP 240 ? A ASP 240 ? 1_555 CA ? B CA . ? A CA 501 ? 1_555 O ? A ASN 244 ? A ASN 244 ? 1_555 93.4 ? 95 OD1 ? A ASN 206 ? A ASN 206 ? 1_555 CA ? B CA . ? A CA 501 ? 1_555 OD2 ? A ASP 293 ? A ASP 293 ? 1_555 75.4 ? 96 O ? A ASN 208 ? A ASN 208 ? 1_555 CA ? B CA . ? A CA 501 ? 1_555 OD2 ? A ASP 293 ? A ASP 293 ? 1_555 109.2 ? 97 OD1 ? A ASP 238 ? A ASP 238 ? 1_555 CA ? B CA . ? A CA 501 ? 1_555 OD2 ? A ASP 293 ? A ASP 293 ? 1_555 136.4 ? 98 OD2 ? A ASP 238 ? A ASP 238 ? 1_555 CA ? B CA . ? A CA 501 ? 1_555 OD2 ? A ASP 293 ? A ASP 293 ? 1_555 86.0 ? 99 OD2 ? A ASP 240 ? A ASP 240 ? 1_555 CA ? B CA . ? A CA 501 ? 1_555 OD2 ? A ASP 293 ? A ASP 293 ? 1_555 143.9 ? 100 O ? A ASN 244 ? A ASN 244 ? 1_555 CA ? B CA . ? A CA 501 ? 1_555 OD2 ? A ASP 293 ? A ASP 293 ? 1_555 92.3 ? 101 OE1 ? A GLU 223 ? A GLU 223 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OE2 ? A GLU 223 ? A GLU 223 ? 1_555 44.9 ? 102 OE1 ? A GLU 223 ? A GLU 223 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OE1 ? A GLU 280 ? A GLU 280 ? 1_555 72.8 ? 103 OE2 ? A GLU 223 ? A GLU 223 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OE1 ? A GLU 280 ? A GLU 280 ? 1_555 79.2 ? 104 OE1 ? A GLU 223 ? A GLU 223 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OE2 ? A GLU 280 ? A GLU 280 ? 1_555 118.5 ? 105 OE2 ? A GLU 223 ? A GLU 223 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OE2 ? A GLU 280 ? A GLU 280 ? 1_555 105.6 ? 106 OE1 ? A GLU 280 ? A GLU 280 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OE2 ? A GLU 280 ? A GLU 280 ? 1_555 46.4 ? 107 OE1 ? A GLU 223 ? A GLU 223 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OD1 ? A ASP 309 ? A ASP 309 ? 1_555 118.8 ? 108 OE2 ? A GLU 223 ? A GLU 223 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OD1 ? A ASP 309 ? A ASP 309 ? 1_555 73.9 ? 109 OE1 ? A GLU 280 ? A GLU 280 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OD1 ? A ASP 309 ? A ASP 309 ? 1_555 97.0 ? 110 OE2 ? A GLU 280 ? A GLU 280 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OD1 ? A ASP 309 ? A ASP 309 ? 1_555 69.0 ? 111 OE1 ? A GLU 223 ? A GLU 223 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 O ? A GLU 310 ? A GLU 310 ? 1_555 95.7 ? 112 OE2 ? A GLU 223 ? A GLU 223 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 O ? A GLU 310 ? A GLU 310 ? 1_555 89.9 ? 113 OE1 ? A GLU 280 ? A GLU 280 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 O ? A GLU 310 ? A GLU 310 ? 1_555 167.9 ? 114 OE2 ? A GLU 280 ? A GLU 280 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 O ? A GLU 310 ? A GLU 310 ? 1_555 143.9 ? 115 OD1 ? A ASP 309 ? A ASP 309 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 O ? A GLU 310 ? A GLU 310 ? 1_555 85.0 ? 116 OE1 ? A GLU 223 ? A GLU 223 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OD1 ? A ASP 312 ? A ASP 312 ? 1_555 63.2 ? 117 OE2 ? A GLU 223 ? A GLU 223 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OD1 ? A ASP 312 ? A ASP 312 ? 1_555 103.2 ? 118 OE1 ? A GLU 280 ? A GLU 280 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OD1 ? A ASP 312 ? A ASP 312 ? 1_555 105.4 ? 119 OE2 ? A GLU 280 ? A GLU 280 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OD1 ? A ASP 312 ? A ASP 312 ? 1_555 132.6 ? 120 OD1 ? A ASP 309 ? A ASP 309 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OD1 ? A ASP 312 ? A ASP 312 ? 1_555 156.6 ? 121 O ? A GLU 310 ? A GLU 310 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OD1 ? A ASP 312 ? A ASP 312 ? 1_555 71.7 ? 122 OE1 ? A GLU 223 ? A GLU 223 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OD1 ? A ASP 345 ? A ASP 345 ? 1_555 145.7 ? 123 OE2 ? A GLU 223 ? A GLU 223 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OD1 ? A ASP 345 ? A ASP 345 ? 1_555 169.1 ? 124 OE1 ? A GLU 280 ? A GLU 280 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OD1 ? A ASP 345 ? A ASP 345 ? 1_555 105.1 ? 125 OE2 ? A GLU 280 ? A GLU 280 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OD1 ? A ASP 345 ? A ASP 345 ? 1_555 72.0 ? 126 OD1 ? A ASP 309 ? A ASP 309 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OD1 ? A ASP 345 ? A ASP 345 ? 1_555 95.5 ? 127 O ? A GLU 310 ? A GLU 310 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OD1 ? A ASP 345 ? A ASP 345 ? 1_555 86.6 ? 128 OD1 ? A ASP 312 ? A ASP 312 ? 1_555 CA ? D CA . ? A CA 503 ? 1_555 OD1 ? A ASP 345 ? A ASP 345 ? 1_555 85.5 ? 129 OE1 ? A GLU 223 ? A GLU 223 ? 1_555 CA ? I CA . ? A CA 508 ? 1_555 OD1 ? A ASP 278 ? A ASP 278 ? 1_555 102.6 ? 130 OE1 ? A GLU 223 ? A GLU 223 ? 1_555 CA ? I CA . ? A CA 508 ? 1_555 OE1 ? A GLU 280 ? A GLU 280 ? 1_555 83.6 ? 131 OD1 ? A ASP 278 ? A ASP 278 ? 1_555 CA ? I CA . ? A CA 508 ? 1_555 OE1 ? A GLU 280 ? A GLU 280 ? 1_555 63.4 ? 132 OE1 ? A GLU 223 ? A GLU 223 ? 1_555 CA ? I CA . ? A CA 508 ? 1_555 OD2 ? A ASP 312 ? A ASP 312 ? 1_555 68.3 ? 133 OD1 ? A ASP 278 ? A ASP 278 ? 1_555 CA ? I CA . ? A CA 508 ? 1_555 OD2 ? A ASP 312 ? A ASP 312 ? 1_555 164.3 ? 134 OE1 ? A GLU 280 ? A GLU 280 ? 1_555 CA ? I CA . ? A CA 508 ? 1_555 OD2 ? A ASP 312 ? A ASP 312 ? 1_555 125.6 ? 135 OD1 ? A ASN 311 ? A ASN 311 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 O ? A ASN 313 ? A ASN 313 ? 1_555 86.3 ? 136 OD1 ? A ASN 311 ? A ASN 311 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OD1 ? A ASP 343 ? A ASP 343 ? 1_555 154.4 ? 137 O ? A ASN 313 ? A ASN 313 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OD1 ? A ASP 343 ? A ASP 343 ? 1_555 68.2 ? 138 OD1 ? A ASN 311 ? A ASN 311 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OD2 ? A ASP 343 ? A ASP 343 ? 1_555 136.8 ? 139 O ? A ASN 313 ? A ASN 313 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OD2 ? A ASP 343 ? A ASP 343 ? 1_555 94.6 ? 140 OD1 ? A ASP 343 ? A ASP 343 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OD2 ? A ASP 343 ? A ASP 343 ? 1_555 47.7 ? 141 OD1 ? A ASN 311 ? A ASN 311 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OD2 ? A ASP 345 ? A ASP 345 ? 1_555 69.0 ? 142 O ? A ASN 313 ? A ASN 313 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OD2 ? A ASP 345 ? A ASP 345 ? 1_555 73.8 ? 143 OD1 ? A ASP 343 ? A ASP 343 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OD2 ? A ASP 345 ? A ASP 345 ? 1_555 100.0 ? 144 OD2 ? A ASP 343 ? A ASP 343 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OD2 ? A ASP 345 ? A ASP 345 ? 1_555 69.9 ? 145 OD1 ? A ASN 311 ? A ASN 311 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 O ? A ASN 349 ? A ASN 349 ? 1_555 100.3 ? 146 O ? A ASN 313 ? A ASN 313 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 O ? A ASN 349 ? A ASN 349 ? 1_555 161.0 ? 147 OD1 ? A ASP 343 ? A ASP 343 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 O ? A ASN 349 ? A ASN 349 ? 1_555 103.2 ? 148 OD2 ? A ASP 343 ? A ASP 343 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 O ? A ASN 349 ? A ASN 349 ? 1_555 68.3 ? 149 OD2 ? A ASP 345 ? A ASP 345 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 O ? A ASN 349 ? A ASN 349 ? 1_555 91.8 ? 150 OD1 ? A ASN 311 ? A ASN 311 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OD2 ? A ASP 396 ? A ASP 396 ? 1_555 81.4 ? 151 O ? A ASN 313 ? A ASN 313 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OD2 ? A ASP 396 ? A ASP 396 ? 1_555 89.7 ? 152 OD1 ? A ASP 343 ? A ASP 343 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OD2 ? A ASP 396 ? A ASP 396 ? 1_555 100.3 ? 153 OD2 ? A ASP 343 ? A ASP 343 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OD2 ? A ASP 396 ? A ASP 396 ? 1_555 141.7 ? 154 OD2 ? A ASP 345 ? A ASP 345 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OD2 ? A ASP 396 ? A ASP 396 ? 1_555 146.7 ? 155 O ? A ASN 349 ? A ASN 349 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OD2 ? A ASP 396 ? A ASP 396 ? 1_555 108.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-09-04 2 'Structure model' 1 1 2019-09-18 3 'Structure model' 1 2 2023-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Derived calculations' 6 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model 7 3 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' 5 3 'Structure model' '_database_2.pdbx_DOI' 6 3 'Structure model' '_database_2.pdbx_database_accession' 7 3 'Structure model' '_struct_conn.pdbx_dist_value' 8 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 10 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 45.1139 58.4307 32.1088 0.8550 0.6065 0.7321 0.0581 -0.0958 0.0191 2.4681 3.5602 7.4471 1.7620 1.7122 1.9504 -0.1137 0.0617 -0.1945 -0.2332 -0.1219 -0.0415 0.0607 0.1079 -0.0001 'X-RAY DIFFRACTION' 2 ? refined 38.6317 24.5459 3.4028 0.9551 0.7341 0.6065 0.0807 0.0218 -0.0068 3.2569 6.0069 1.6372 -0.6850 -0.9668 2.4089 -0.1227 0.0443 -0.2702 0.0417 0.1942 -0.3031 -0.0478 0.3931 -0.0001 'X-RAY DIFFRACTION' 3 ? refined 50.3690 -17.9577 -22.8084 1.0303 0.6089 0.9855 0.0228 -0.0187 -0.0285 2.0895 3.2631 6.3710 -1.5454 -1.5052 3.3118 0.0875 -0.1235 0.0978 0.2232 0.1024 -0.3094 -0.1672 0.1751 -0.0000 'X-RAY DIFFRACTION' 4 ? refined 58.1885 -55.4152 -53.1110 0.9075 0.7542 0.6436 -0.0525 0.1403 0.0879 2.4404 4.7094 5.7215 -1.9974 -0.2252 4.2798 0.1214 0.0710 -0.2018 0.1955 -0.4419 0.0469 0.4885 0.0935 0.0001 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 1 through 99 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 100 through 208 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 209 through 313 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 314 through 416 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.13rc1_2961)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 26 ? ? -102.73 -126.45 2 1 ASN A 35 ? ? 51.44 76.08 3 1 ASP A 293 ? ? -122.52 -162.02 4 1 PRO A 361 ? ? -79.40 42.04 5 1 ASP A 367 ? ? -95.15 -70.25 6 1 THR A 368 ? ? -109.32 -161.98 7 1 LYS A 397 ? ? -109.28 40.33 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TYR N N N N 322 TYR CA C N S 323 TYR C C N N 324 TYR O O N N 325 TYR CB C N N 326 TYR CG C Y N 327 TYR CD1 C Y N 328 TYR CD2 C Y N 329 TYR CE1 C Y N 330 TYR CE2 C Y N 331 TYR CZ C Y N 332 TYR OH O N N 333 TYR OXT O N N 334 TYR H H N N 335 TYR H2 H N N 336 TYR HA H N N 337 TYR HB2 H N N 338 TYR HB3 H N N 339 TYR HD1 H N N 340 TYR HD2 H N N 341 TYR HE1 H N N 342 TYR HE2 H N N 343 TYR HH H N N 344 TYR HXT H N N 345 VAL N N N N 346 VAL CA C N S 347 VAL C C N N 348 VAL O O N N 349 VAL CB C N N 350 VAL CG1 C N N 351 VAL CG2 C N N 352 VAL OXT O N N 353 VAL H H N N 354 VAL H2 H N N 355 VAL HA H N N 356 VAL HB H N N 357 VAL HG11 H N N 358 VAL HG12 H N N 359 VAL HG13 H N N 360 VAL HG21 H N N 361 VAL HG22 H N N 362 VAL HG23 H N N 363 VAL HXT H N N 364 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TYR N CA sing N N 306 TYR N H sing N N 307 TYR N H2 sing N N 308 TYR CA C sing N N 309 TYR CA CB sing N N 310 TYR CA HA sing N N 311 TYR C O doub N N 312 TYR C OXT sing N N 313 TYR CB CG sing N N 314 TYR CB HB2 sing N N 315 TYR CB HB3 sing N N 316 TYR CG CD1 doub Y N 317 TYR CG CD2 sing Y N 318 TYR CD1 CE1 sing Y N 319 TYR CD1 HD1 sing N N 320 TYR CD2 CE2 doub Y N 321 TYR CD2 HD2 sing N N 322 TYR CE1 CZ doub Y N 323 TYR CE1 HE1 sing N N 324 TYR CE2 CZ sing Y N 325 TYR CE2 HE2 sing N N 326 TYR CZ OH sing N N 327 TYR OH HH sing N N 328 TYR OXT HXT sing N N 329 VAL N CA sing N N 330 VAL N H sing N N 331 VAL N H2 sing N N 332 VAL CA C sing N N 333 VAL CA CB sing N N 334 VAL CA HA sing N N 335 VAL C O doub N N 336 VAL C OXT sing N N 337 VAL CB CG1 sing N N 338 VAL CB CG2 sing N N 339 VAL CB HB sing N N 340 VAL CG1 HG11 sing N N 341 VAL CG1 HG12 sing N N 342 VAL CG1 HG13 sing N N 343 VAL CG2 HG21 sing N N 344 VAL CG2 HG22 sing N N 345 VAL CG2 HG23 sing N N 346 VAL OXT HXT sing N N 347 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5K8R _pdbx_initial_refinement_model.details ? # _pdbx_related_exp_data_set.ordinal 1 _pdbx_related_exp_data_set.data_reference 10.15785/SBGRID/603 _pdbx_related_exp_data_set.metadata_reference ? _pdbx_related_exp_data_set.data_set_type 'diffraction image data' _pdbx_related_exp_data_set.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #