data_6MNP # _entry.id 6MNP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6MNP pdb_00006mnp 10.2210/pdb6mnp/pdb WWPDB D_1000236760 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6MNP _pdbx_database_status.recvd_initial_deposition_date 2018-10-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Akhtar, A.' 1 0000-0002-6521-2421 'Chen, Y.' 2 0000-0002-5115-3600 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Infect Dis.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2373-8227 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 5 _citation.language ? _citation.page_first 1013 _citation.page_last 1021 _citation.title 'Active-Site Druggability of Carbapenemases and Broad-Spectrum Inhibitor Discovery.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsinfecdis.9b00052 _citation.pdbx_database_id_PubMed 30942078 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Torelli, N.J.' 1 ? primary 'Akhtar, A.' 2 ? primary 'DeFrees, K.' 3 ? primary 'Jaishankar, P.' 4 ? primary 'Pemberton, O.A.' 5 ? primary 'Zhang, X.' 6 ? primary 'Johnson, C.' 7 ? primary 'Renslo, A.R.' 8 ? primary 'Chen, Y.' 9 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6MNP _cell.details ? _cell.formula_units_Z ? _cell.length_a 56.347 _cell.length_a_esd ? _cell.length_b 59.768 _cell.length_b_esd ? _cell.length_c 77.094 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6MNP _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 2 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Carbapenem-hydrolyzing beta-lactamase KPC' 30806.631 1 3.5.2.6 ? ? ? 2 non-polymer syn '3-(1H-tetrazol-5-ylmethyl)-5,6,7,8-tetrahydro[1]benzothieno[2,3-d]pyrimidin-4(3H)-one' 288.328 3 ? ? ? ? 3 non-polymer nat GLYCEROL 92.094 1 ? ? ? ? 4 water nat water 18.015 20 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Carbapenem-hydrolyzing beta-lactamase KPC-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMLTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARS QQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDR WELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTA NDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGVNGQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMLTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARS QQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDR WELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTA NDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGVNGQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 LEU n 1 23 THR n 1 24 ASN n 1 25 LEU n 1 26 VAL n 1 27 ALA n 1 28 GLU n 1 29 PRO n 1 30 PHE n 1 31 ALA n 1 32 LYS n 1 33 LEU n 1 34 GLU n 1 35 GLN n 1 36 ASP n 1 37 PHE n 1 38 GLY n 1 39 GLY n 1 40 SER n 1 41 ILE n 1 42 GLY n 1 43 VAL n 1 44 TYR n 1 45 ALA n 1 46 MET n 1 47 ASP n 1 48 THR n 1 49 GLY n 1 50 SER n 1 51 GLY n 1 52 ALA n 1 53 THR n 1 54 VAL n 1 55 SER n 1 56 TYR n 1 57 ARG n 1 58 ALA n 1 59 GLU n 1 60 GLU n 1 61 ARG n 1 62 PHE n 1 63 PRO n 1 64 LEU n 1 65 CYS n 1 66 SER n 1 67 SER n 1 68 PHE n 1 69 LYS n 1 70 GLY n 1 71 PHE n 1 72 LEU n 1 73 ALA n 1 74 ALA n 1 75 ALA n 1 76 VAL n 1 77 LEU n 1 78 ALA n 1 79 ARG n 1 80 SER n 1 81 GLN n 1 82 GLN n 1 83 GLN n 1 84 ALA n 1 85 GLY n 1 86 LEU n 1 87 LEU n 1 88 ASP n 1 89 THR n 1 90 PRO n 1 91 ILE n 1 92 ARG n 1 93 TYR n 1 94 GLY n 1 95 LYS n 1 96 ASN n 1 97 ALA n 1 98 LEU n 1 99 VAL n 1 100 PRO n 1 101 TRP n 1 102 SER n 1 103 PRO n 1 104 ILE n 1 105 SER n 1 106 GLU n 1 107 LYS n 1 108 TYR n 1 109 LEU n 1 110 THR n 1 111 THR n 1 112 GLY n 1 113 MET n 1 114 THR n 1 115 VAL n 1 116 ALA n 1 117 GLU n 1 118 LEU n 1 119 SER n 1 120 ALA n 1 121 ALA n 1 122 ALA n 1 123 VAL n 1 124 GLN n 1 125 TYR n 1 126 SER n 1 127 ASP n 1 128 ASN n 1 129 ALA n 1 130 ALA n 1 131 ALA n 1 132 ASN n 1 133 LEU n 1 134 LEU n 1 135 LEU n 1 136 LYS n 1 137 GLU n 1 138 LEU n 1 139 GLY n 1 140 GLY n 1 141 PRO n 1 142 ALA n 1 143 GLY n 1 144 LEU n 1 145 THR n 1 146 ALA n 1 147 PHE n 1 148 MET n 1 149 ARG n 1 150 SER n 1 151 ILE n 1 152 GLY n 1 153 ASP n 1 154 THR n 1 155 THR n 1 156 PHE n 1 157 ARG n 1 158 LEU n 1 159 ASP n 1 160 ARG n 1 161 TRP n 1 162 GLU n 1 163 LEU n 1 164 GLU n 1 165 LEU n 1 166 ASN n 1 167 SER n 1 168 ALA n 1 169 ILE n 1 170 PRO n 1 171 GLY n 1 172 ASP n 1 173 ALA n 1 174 ARG n 1 175 ASP n 1 176 THR n 1 177 SER n 1 178 SER n 1 179 PRO n 1 180 ARG n 1 181 ALA n 1 182 VAL n 1 183 THR n 1 184 GLU n 1 185 SER n 1 186 LEU n 1 187 GLN n 1 188 LYS n 1 189 LEU n 1 190 THR n 1 191 LEU n 1 192 GLY n 1 193 SER n 1 194 ALA n 1 195 LEU n 1 196 ALA n 1 197 ALA n 1 198 PRO n 1 199 GLN n 1 200 ARG n 1 201 GLN n 1 202 GLN n 1 203 PHE n 1 204 VAL n 1 205 ASP n 1 206 TRP n 1 207 LEU n 1 208 LYS n 1 209 GLY n 1 210 ASN n 1 211 THR n 1 212 THR n 1 213 GLY n 1 214 ASN n 1 215 HIS n 1 216 ARG n 1 217 ILE n 1 218 ARG n 1 219 ALA n 1 220 ALA n 1 221 VAL n 1 222 PRO n 1 223 ALA n 1 224 ASP n 1 225 TRP n 1 226 ALA n 1 227 VAL n 1 228 GLY n 1 229 ASP n 1 230 LYS n 1 231 THR n 1 232 GLY n 1 233 THR n 1 234 CYS n 1 235 GLY n 1 236 VAL n 1 237 TYR n 1 238 GLY n 1 239 THR n 1 240 ALA n 1 241 ASN n 1 242 ASP n 1 243 TYR n 1 244 ALA n 1 245 VAL n 1 246 VAL n 1 247 TRP n 1 248 PRO n 1 249 THR n 1 250 GLY n 1 251 ARG n 1 252 ALA n 1 253 PRO n 1 254 ILE n 1 255 VAL n 1 256 LEU n 1 257 ALA n 1 258 VAL n 1 259 TYR n 1 260 THR n 1 261 ARG n 1 262 ALA n 1 263 PRO n 1 264 ASN n 1 265 LYS n 1 266 ASP n 1 267 ASP n 1 268 LYS n 1 269 HIS n 1 270 SER n 1 271 GLU n 1 272 ALA n 1 273 VAL n 1 274 ILE n 1 275 ALA n 1 276 ALA n 1 277 ALA n 1 278 ALA n 1 279 ARG n 1 280 LEU n 1 281 ALA n 1 282 LEU n 1 283 GLU n 1 284 GLY n 1 285 LEU n 1 286 GLY n 1 287 VAL n 1 288 ASN n 1 289 GLY n 1 290 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 290 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'bla, kpc, kpc1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Klebsiella pneumoniae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 573 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BLKPC_KLEPN _struct_ref.pdbx_db_accession Q9F663 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPW SPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRA VTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTR APNKDDKHSEAVIAAAARLALEGLGVNGQ ; _struct_ref.pdbx_align_begin 25 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6MNP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 22 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 290 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9F663 _struct_ref_seq.db_align_beg 25 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 293 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 25 _struct_ref_seq.pdbx_auth_seq_align_end 295 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6MNP MET A 1 ? UNP Q9F663 ? ? 'expression tag' 4 1 1 6MNP GLY A 2 ? UNP Q9F663 ? ? 'expression tag' 5 2 1 6MNP SER A 3 ? UNP Q9F663 ? ? 'expression tag' 6 3 1 6MNP SER A 4 ? UNP Q9F663 ? ? 'expression tag' 7 4 1 6MNP HIS A 5 ? UNP Q9F663 ? ? 'expression tag' 8 5 1 6MNP HIS A 6 ? UNP Q9F663 ? ? 'expression tag' 9 6 1 6MNP HIS A 7 ? UNP Q9F663 ? ? 'expression tag' 10 7 1 6MNP HIS A 8 ? UNP Q9F663 ? ? 'expression tag' 11 8 1 6MNP HIS A 9 ? UNP Q9F663 ? ? 'expression tag' 12 9 1 6MNP HIS A 10 ? UNP Q9F663 ? ? 'expression tag' 13 10 1 6MNP SER A 11 ? UNP Q9F663 ? ? 'expression tag' 14 11 1 6MNP SER A 12 ? UNP Q9F663 ? ? 'expression tag' 15 12 1 6MNP GLY A 13 ? UNP Q9F663 ? ? 'expression tag' 16 13 1 6MNP LEU A 14 ? UNP Q9F663 ? ? 'expression tag' 17 14 1 6MNP VAL A 15 ? UNP Q9F663 ? ? 'expression tag' 18 15 1 6MNP PRO A 16 ? UNP Q9F663 ? ? 'expression tag' 19 16 1 6MNP ARG A 17 ? UNP Q9F663 ? ? 'expression tag' 20 17 1 6MNP GLY A 18 ? UNP Q9F663 ? ? 'expression tag' 21 18 1 6MNP SER A 19 ? UNP Q9F663 ? ? 'expression tag' 22 19 1 6MNP HIS A 20 ? UNP Q9F663 ? ? 'expression tag' 23 20 1 6MNP MET A 21 ? UNP Q9F663 ? ? 'expression tag' 24 21 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 1CE non-polymer . '3-(1H-tetrazol-5-ylmethyl)-5,6,7,8-tetrahydro[1]benzothieno[2,3-d]pyrimidin-4(3H)-one' ? 'C12 H12 N6 O S' 288.328 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6MNP _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.09 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 41.18 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.0 M Ammonium sulfate, 5% (v/v) Ethanol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-07-12 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6MNP _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.200 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13530 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.900 _reflns.pdbx_Rmerge_I_obs 0.136 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.800 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.082 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.155 _reflns.pdbx_Rpim_I_all 0.072 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 66050 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.200 2.240 ? ? ? ? ? ? 641 99.200 ? ? ? ? 0.806 ? ? ? ? ? ? ? ? 4.000 ? 0.918 ? ? 0.925 0.445 ? 1 1 0.682 ? 2.240 2.280 ? ? ? ? ? ? 672 99.300 ? ? ? ? 0.733 ? ? ? ? ? ? ? ? 4.100 ? 0.891 ? ? 0.838 0.399 ? 2 1 0.789 ? 2.280 2.320 ? ? ? ? ? ? 671 99.000 ? ? ? ? 0.643 ? ? ? ? ? ? ? ? 4.000 ? 0.871 ? ? 0.741 0.361 ? 3 1 0.791 ? 2.320 2.370 ? ? ? ? ? ? 643 98.900 ? ? ? ? 0.688 ? ? ? ? ? ? ? ? 4.600 ? 0.840 ? ? 0.780 0.362 ? 4 1 0.803 ? 2.370 2.420 ? ? ? ? ? ? 677 99.900 ? ? ? ? 0.645 ? ? ? ? ? ? ? ? 5.200 ? 0.815 ? ? 0.723 0.322 ? 5 1 0.870 ? 2.420 2.480 ? ? ? ? ? ? 676 99.100 ? ? ? ? 0.521 ? ? ? ? ? ? ? ? 5.400 ? 0.919 ? ? 0.584 0.259 ? 6 1 0.925 ? 2.480 2.540 ? ? ? ? ? ? 658 99.800 ? ? ? ? 0.465 ? ? ? ? ? ? ? ? 5.400 ? 0.942 ? ? 0.520 0.229 ? 7 1 0.939 ? 2.540 2.610 ? ? ? ? ? ? 668 99.400 ? ? ? ? 0.427 ? ? ? ? ? ? ? ? 5.400 ? 1.082 ? ? 0.478 0.211 ? 8 1 0.952 ? 2.610 2.690 ? ? ? ? ? ? 672 100.000 ? ? ? ? 0.377 ? ? ? ? ? ? ? ? 5.300 ? 1.109 ? ? 0.423 0.189 ? 9 1 0.931 ? 2.690 2.770 ? ? ? ? ? ? 681 100.000 ? ? ? ? 0.309 ? ? ? ? ? ? ? ? 5.400 ? 1.251 ? ? 0.347 0.153 ? 10 1 0.958 ? 2.770 2.870 ? ? ? ? ? ? 667 99.300 ? ? ? ? 0.277 ? ? ? ? ? ? ? ? 5.200 ? 1.123 ? ? 0.311 0.139 ? 11 1 0.947 ? 2.870 2.990 ? ? ? ? ? ? 676 98.400 ? ? ? ? 0.217 ? ? ? ? ? ? ? ? 4.800 ? 1.156 ? ? 0.247 0.116 ? 12 1 0.975 ? 2.990 3.120 ? ? ? ? ? ? 675 99.600 ? ? ? ? 0.194 ? ? ? ? ? ? ? ? 4.900 ? 1.386 ? ? 0.219 0.100 ? 13 1 0.976 ? 3.120 3.290 ? ? ? ? ? ? 681 99.400 ? ? ? ? 0.142 ? ? ? ? ? ? ? ? 5.400 ? 1.290 ? ? 0.160 0.071 ? 14 1 0.990 ? 3.290 3.490 ? ? ? ? ? ? 672 98.800 ? ? ? ? 0.128 ? ? ? ? ? ? ? ? 5.300 ? 1.447 ? ? 0.145 0.066 ? 15 1 0.987 ? 3.490 3.760 ? ? ? ? ? ? 682 98.800 ? ? ? ? 0.109 ? ? ? ? ? ? ? ? 4.900 ? 1.205 ? ? 0.124 0.058 ? 16 1 0.983 ? 3.760 4.140 ? ? ? ? ? ? 685 98.100 ? ? ? ? 0.093 ? ? ? ? ? ? ? ? 4.600 ? 1.194 ? ? 0.107 0.052 ? 17 1 0.985 ? 4.140 4.740 ? ? ? ? ? ? 670 96.300 ? ? ? ? 0.083 ? ? ? ? ? ? ? ? 4.200 ? 1.078 ? ? 0.096 0.047 ? 18 1 0.987 ? 4.740 5.970 ? ? ? ? ? ? 713 99.200 ? ? ? ? 0.084 ? ? ? ? ? ? ? ? 5.000 ? 1.010 ? ? 0.095 0.044 ? 19 1 0.987 ? 5.970 50.000 ? ? ? ? ? ? 750 97.500 ? ? ? ? 0.076 ? ? ? ? ? ? ? ? 4.500 ? 0.935 ? ? 0.088 0.043 ? 20 1 0.987 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 84.290 _refine.B_iso_mean 45.8964 _refine.B_iso_min 28.060 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6MNP _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.2020 _refine.ls_d_res_low 47.2360 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13472 _refine.ls_number_reflns_R_free 1337 _refine.ls_number_reflns_R_work 12135 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.1600 _refine.ls_percent_reflns_R_free 9.9200 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2310 _refine.ls_R_factor_R_free 0.2765 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2261 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3C5A _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.2500 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3300 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.2020 _refine_hist.d_res_low 47.2360 _refine_hist.pdbx_number_atoms_ligand 66 _refine_hist.number_atoms_solvent 20 _refine_hist.number_atoms_total 2072 _refine_hist.pdbx_number_residues_total 266 _refine_hist.pdbx_B_iso_mean_ligand 59.02 _refine_hist.pdbx_B_iso_mean_solvent 40.03 _refine_hist.pdbx_number_atoms_protein 1986 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2019 2.2806 1247 . 125 1122 93.0000 . . . 0.3845 0.0000 0.3029 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.2806 2.3719 1320 . 133 1187 99.0000 . . . 0.3338 0.0000 0.2823 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.3719 2.4798 1350 . 134 1216 99.0000 . . . 0.3116 0.0000 0.2514 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.4798 2.6106 1324 . 129 1195 99.0000 . . . 0.3216 0.0000 0.2624 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.6106 2.7741 1351 . 131 1220 100.0000 . . . 0.3081 0.0000 0.2590 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.7741 2.9883 1354 . 139 1215 99.0000 . . . 0.3298 0.0000 0.2675 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.9883 3.2889 1347 . 134 1213 99.0000 . . . 0.2939 0.0000 0.2447 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 3.2889 3.7647 1367 . 126 1241 99.0000 . . . 0.2804 0.0000 0.2237 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 3.7647 4.7424 1351 . 141 1210 97.0000 . . . 0.2216 0.0000 0.1897 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 4.7424 47.2464 1461 . 145 1316 98.0000 . . . 0.2441 0.0000 0.1996 . . . . . . 10 . . . # _struct.entry_id 6MNP _struct.title 'Crystal structure of KPC-2 with compound 6' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6MNP _struct_keywords.text 'Carbapenemase, tetrazole, inhibitor, complex, HYDROLASE, HYDROLASE-INHIBITOR complex' _struct_keywords.pdbx_keywords HYDROLASE/INHIBITOR # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 VAL A 26 ? GLY A 38 ? VAL A 29 GLY A 41 1 ? 13 HELX_P HELX_P2 AA2 SER A 67 ? GLN A 83 ? SER A 71 GLN A 87 1 ? 17 HELX_P HELX_P3 AA3 GLY A 85 ? ASP A 88 ? GLY A 89 ASP A 92 5 ? 4 HELX_P HELX_P4 AA4 GLY A 94 ? LEU A 98 ? GLY A 98 LEU A 102 5 ? 5 HELX_P HELX_P5 AA5 ILE A 104 ? LEU A 109 ? ILE A 108 LEU A 113 5 ? 6 HELX_P HELX_P6 AA6 VAL A 115 ? SER A 126 ? VAL A 119 SER A 130 1 ? 12 HELX_P HELX_P7 AA7 ASP A 127 ? LYS A 136 ? ASP A 131 LYS A 140 1 ? 10 HELX_P HELX_P8 AA8 GLY A 139 ? ILE A 151 ? GLY A 143 ILE A 155 1 ? 13 HELX_P HELX_P9 AA9 LEU A 163 ? SER A 167 ? LEU A 167 SER A 171 5 ? 5 HELX_P HELX_P10 AB1 SER A 178 ? LEU A 191 ? SER A 182 LEU A 195 1 ? 14 HELX_P HELX_P11 AB2 ALA A 196 ? GLY A 209 ? ALA A 200 GLY A 213 1 ? 14 HELX_P HELX_P12 AB3 ARG A 216 ? VAL A 221 ? ARG A 220 VAL A 225 5 ? 6 HELX_P HELX_P13 AB4 SER A 270 ? GLY A 286 ? SER A 275 GLY A 291 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 65 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 234 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 69 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 238 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.032 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 53 ? TYR A 56 ? THR A 56 TYR A 60 AA1 2 SER A 40 ? ASP A 47 ? SER A 43 ASP A 50 AA1 3 ILE A 254 ? ARG A 261 ? ILE A 259 ARG A 266 AA1 4 ALA A 240 ? TRP A 247 ? ALA A 244 TRP A 251 AA1 5 ALA A 226 ? THR A 233 ? ALA A 230 THR A 237 AA2 1 PHE A 62 ? PRO A 63 ? PHE A 66 PRO A 67 AA2 2 THR A 176 ? SER A 177 ? THR A 180 SER A 181 AA3 1 PRO A 90 ? ILE A 91 ? PRO A 94 ILE A 95 AA3 2 MET A 113 ? THR A 114 ? MET A 117 THR A 118 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O TYR A 56 ? O TYR A 60 N VAL A 43 ? N VAL A 46 AA1 2 3 N GLY A 42 ? N GLY A 45 O TYR A 259 ? O TYR A 264 AA1 3 4 O ILE A 254 ? O ILE A 259 N VAL A 246 ? N VAL A 250 AA1 4 5 O TRP A 247 ? O TRP A 251 N ALA A 226 ? N ALA A 230 AA2 1 2 N PHE A 62 ? N PHE A 66 O SER A 177 ? O SER A 181 AA3 1 2 N ILE A 91 ? N ILE A 95 O MET A 113 ? O MET A 117 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A 1CE 301 ? 8 'binding site for residue 1CE A 301' AC2 Software A 1CE 302 ? 6 'binding site for residue 1CE A 302' AC3 Software A 1CE 303 ? 4 'binding site for residue 1CE A 303' AC4 Software A GOL 304 ? 3 'binding site for residue GOL A 304' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 TRP A 101 ? TRP A 105 . ? 1_555 ? 2 AC1 8 PRO A 103 ? PRO A 107 . ? 1_555 ? 3 AC1 8 GLU A 106 ? GLU A 110 . ? 1_555 ? 4 AC1 8 LYS A 107 ? LYS A 111 . ? 1_555 ? 5 AC1 8 GLY A 139 ? GLY A 143 . ? 3_655 ? 6 AC1 8 ALA A 142 ? ALA A 146 . ? 3_655 ? 7 AC1 8 GLY A 143 ? GLY A 147 . ? 3_655 ? 8 AC1 8 1CE D . ? 1CE A 303 . ? 1_555 ? 9 AC2 6 TRP A 101 ? TRP A 105 . ? 1_555 ? 10 AC2 6 SER A 126 ? SER A 130 . ? 1_555 ? 11 AC2 6 ASN A 128 ? ASN A 132 . ? 1_555 ? 12 AC2 6 THR A 212 ? THR A 216 . ? 1_555 ? 13 AC2 6 THR A 231 ? THR A 235 . ? 1_555 ? 14 AC2 6 THR A 233 ? THR A 237 . ? 1_555 ? 15 AC3 4 TYR A 125 ? TYR A 129 . ? 1_555 ? 16 AC3 4 LEU A 138 ? LEU A 142 . ? 3_655 ? 17 AC3 4 GLY A 139 ? GLY A 143 . ? 3_655 ? 18 AC3 4 1CE B . ? 1CE A 301 . ? 1_555 ? 19 AC4 3 GLN A 201 ? GLN A 205 . ? 1_555 ? 20 AC4 3 LYS A 208 ? LYS A 212 . ? 1_555 ? 21 AC4 3 TRP A 247 ? TRP A 251 . ? 1_555 ? # _atom_sites.entry_id 6MNP _atom_sites.fract_transf_matrix[1][1] 0.017747 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016731 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012971 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 4 ? ? ? A . n A 1 2 GLY 2 5 ? ? ? A . n A 1 3 SER 3 6 ? ? ? A . n A 1 4 SER 4 7 ? ? ? A . n A 1 5 HIS 5 8 ? ? ? A . n A 1 6 HIS 6 9 ? ? ? A . n A 1 7 HIS 7 10 ? ? ? A . n A 1 8 HIS 8 11 ? ? ? A . n A 1 9 HIS 9 12 ? ? ? A . n A 1 10 HIS 10 13 ? ? ? A . n A 1 11 SER 11 14 ? ? ? A . n A 1 12 SER 12 15 ? ? ? A . n A 1 13 GLY 13 16 ? ? ? A . n A 1 14 LEU 14 17 ? ? ? A . n A 1 15 VAL 15 18 ? ? ? A . n A 1 16 PRO 16 19 ? ? ? A . n A 1 17 ARG 17 20 ? ? ? A . n A 1 18 GLY 18 21 ? ? ? A . n A 1 19 SER 19 22 ? ? ? A . n A 1 20 HIS 20 23 ? ? ? A . n A 1 21 MET 21 24 ? ? ? A . n A 1 22 LEU 22 25 25 LEU LEU A . n A 1 23 THR 23 26 26 THR THR A . n A 1 24 ASN 24 27 27 ASN ASN A . n A 1 25 LEU 25 28 28 LEU LEU A . n A 1 26 VAL 26 29 29 VAL VAL A . n A 1 27 ALA 27 30 30 ALA ALA A . n A 1 28 GLU 28 31 31 GLU GLU A . n A 1 29 PRO 29 32 32 PRO PRO A . n A 1 30 PHE 30 33 33 PHE PHE A . n A 1 31 ALA 31 34 34 ALA ALA A . n A 1 32 LYS 32 35 35 LYS LYS A . n A 1 33 LEU 33 36 36 LEU LEU A . n A 1 34 GLU 34 37 37 GLU GLU A . n A 1 35 GLN 35 38 38 GLN GLN A . n A 1 36 ASP 36 39 39 ASP ASP A . n A 1 37 PHE 37 40 40 PHE PHE A . n A 1 38 GLY 38 41 41 GLY GLY A . n A 1 39 GLY 39 42 42 GLY GLY A . n A 1 40 SER 40 43 43 SER SER A . n A 1 41 ILE 41 44 44 ILE ILE A . n A 1 42 GLY 42 45 45 GLY GLY A . n A 1 43 VAL 43 46 46 VAL VAL A . n A 1 44 TYR 44 47 47 TYR TYR A . n A 1 45 ALA 45 48 48 ALA ALA A . n A 1 46 MET 46 49 49 MET MET A . n A 1 47 ASP 47 50 50 ASP ASP A . n A 1 48 THR 48 51 51 THR THR A . n A 1 49 GLY 49 52 52 GLY GLY A . n A 1 50 SER 50 53 53 SER SER A . n A 1 51 GLY 51 54 54 GLY GLY A . n A 1 52 ALA 52 55 55 ALA ALA A . n A 1 53 THR 53 56 56 THR THR A . n A 1 54 VAL 54 57 57 VAL VAL A . n A 1 55 SER 55 59 59 SER SER A . n A 1 56 TYR 56 60 60 TYR TYR A . n A 1 57 ARG 57 61 61 ARG ARG A . n A 1 58 ALA 58 62 62 ALA ALA A . n A 1 59 GLU 59 63 63 GLU GLU A . n A 1 60 GLU 60 64 64 GLU GLU A . n A 1 61 ARG 61 65 65 ARG ARG A . n A 1 62 PHE 62 66 66 PHE PHE A . n A 1 63 PRO 63 67 67 PRO PRO A . n A 1 64 LEU 64 68 68 LEU LEU A . n A 1 65 CYS 65 69 69 CYS CYS A . n A 1 66 SER 66 70 70 SER SER A . n A 1 67 SER 67 71 71 SER SER A . n A 1 68 PHE 68 72 72 PHE PHE A . n A 1 69 LYS 69 73 73 LYS LYS A . n A 1 70 GLY 70 74 74 GLY GLY A . n A 1 71 PHE 71 75 75 PHE PHE A . n A 1 72 LEU 72 76 76 LEU LEU A . n A 1 73 ALA 73 77 77 ALA ALA A . n A 1 74 ALA 74 78 78 ALA ALA A . n A 1 75 ALA 75 79 79 ALA ALA A . n A 1 76 VAL 76 80 80 VAL VAL A . n A 1 77 LEU 77 81 81 LEU LEU A . n A 1 78 ALA 78 82 82 ALA ALA A . n A 1 79 ARG 79 83 83 ARG ARG A . n A 1 80 SER 80 84 84 SER SER A . n A 1 81 GLN 81 85 85 GLN GLN A . n A 1 82 GLN 82 86 86 GLN GLN A . n A 1 83 GLN 83 87 87 GLN GLN A . n A 1 84 ALA 84 88 88 ALA ALA A . n A 1 85 GLY 85 89 89 GLY GLY A . n A 1 86 LEU 86 90 90 LEU LEU A . n A 1 87 LEU 87 91 91 LEU LEU A . n A 1 88 ASP 88 92 92 ASP ASP A . n A 1 89 THR 89 93 93 THR THR A . n A 1 90 PRO 90 94 94 PRO PRO A . n A 1 91 ILE 91 95 95 ILE ILE A . n A 1 92 ARG 92 96 96 ARG ARG A . n A 1 93 TYR 93 97 97 TYR TYR A . n A 1 94 GLY 94 98 98 GLY GLY A . n A 1 95 LYS 95 99 99 LYS LYS A . n A 1 96 ASN 96 100 100 ASN ASN A . n A 1 97 ALA 97 101 101 ALA ALA A . n A 1 98 LEU 98 102 102 LEU LEU A . n A 1 99 VAL 99 103 103 VAL VAL A . n A 1 100 PRO 100 104 104 PRO PRO A . n A 1 101 TRP 101 105 105 TRP TRP A . n A 1 102 SER 102 106 106 SER SER A . n A 1 103 PRO 103 107 107 PRO PRO A . n A 1 104 ILE 104 108 108 ILE ILE A . n A 1 105 SER 105 109 109 SER SER A . n A 1 106 GLU 106 110 110 GLU GLU A . n A 1 107 LYS 107 111 111 LYS LYS A . n A 1 108 TYR 108 112 112 TYR TYR A . n A 1 109 LEU 109 113 113 LEU LEU A . n A 1 110 THR 110 114 114 THR THR A . n A 1 111 THR 111 115 115 THR THR A . n A 1 112 GLY 112 116 116 GLY GLY A . n A 1 113 MET 113 117 117 MET MET A . n A 1 114 THR 114 118 118 THR THR A . n A 1 115 VAL 115 119 119 VAL VAL A . n A 1 116 ALA 116 120 120 ALA ALA A . n A 1 117 GLU 117 121 121 GLU GLU A . n A 1 118 LEU 118 122 122 LEU LEU A . n A 1 119 SER 119 123 123 SER SER A . n A 1 120 ALA 120 124 124 ALA ALA A . n A 1 121 ALA 121 125 125 ALA ALA A . n A 1 122 ALA 122 126 126 ALA ALA A . n A 1 123 VAL 123 127 127 VAL VAL A . n A 1 124 GLN 124 128 128 GLN GLN A . n A 1 125 TYR 125 129 129 TYR TYR A . n A 1 126 SER 126 130 130 SER SER A . n A 1 127 ASP 127 131 131 ASP ASP A . n A 1 128 ASN 128 132 132 ASN ASN A . n A 1 129 ALA 129 133 133 ALA ALA A . n A 1 130 ALA 130 134 134 ALA ALA A . n A 1 131 ALA 131 135 135 ALA ALA A . n A 1 132 ASN 132 136 136 ASN ASN A . n A 1 133 LEU 133 137 137 LEU LEU A . n A 1 134 LEU 134 138 138 LEU LEU A . n A 1 135 LEU 135 139 139 LEU LEU A . n A 1 136 LYS 136 140 140 LYS LYS A . n A 1 137 GLU 137 141 141 GLU GLU A . n A 1 138 LEU 138 142 142 LEU LEU A . n A 1 139 GLY 139 143 143 GLY GLY A . n A 1 140 GLY 140 144 144 GLY GLY A . n A 1 141 PRO 141 145 145 PRO PRO A . n A 1 142 ALA 142 146 146 ALA ALA A . n A 1 143 GLY 143 147 147 GLY GLY A . n A 1 144 LEU 144 148 148 LEU LEU A . n A 1 145 THR 145 149 149 THR THR A . n A 1 146 ALA 146 150 150 ALA ALA A . n A 1 147 PHE 147 151 151 PHE PHE A . n A 1 148 MET 148 152 152 MET MET A . n A 1 149 ARG 149 153 153 ARG ARG A . n A 1 150 SER 150 154 154 SER SER A . n A 1 151 ILE 151 155 155 ILE ILE A . n A 1 152 GLY 152 156 156 GLY GLY A . n A 1 153 ASP 153 157 157 ASP ASP A . n A 1 154 THR 154 158 158 THR THR A . n A 1 155 THR 155 159 159 THR THR A . n A 1 156 PHE 156 160 160 PHE PHE A . n A 1 157 ARG 157 161 161 ARG ARG A . n A 1 158 LEU 158 162 162 LEU LEU A . n A 1 159 ASP 159 163 163 ASP ASP A . n A 1 160 ARG 160 164 164 ARG ARG A . n A 1 161 TRP 161 165 165 TRP TRP A . n A 1 162 GLU 162 166 166 GLU GLU A . n A 1 163 LEU 163 167 167 LEU LEU A . n A 1 164 GLU 164 168 168 GLU GLU A . n A 1 165 LEU 165 169 169 LEU LEU A . n A 1 166 ASN 166 170 170 ASN ASN A . n A 1 167 SER 167 171 171 SER SER A . n A 1 168 ALA 168 172 172 ALA ALA A . n A 1 169 ILE 169 173 173 ILE ILE A . n A 1 170 PRO 170 174 174 PRO PRO A . n A 1 171 GLY 171 175 175 GLY GLY A . n A 1 172 ASP 172 176 176 ASP ASP A . n A 1 173 ALA 173 177 177 ALA ALA A . n A 1 174 ARG 174 178 178 ARG ARG A . n A 1 175 ASP 175 179 179 ASP ASP A . n A 1 176 THR 176 180 180 THR THR A . n A 1 177 SER 177 181 181 SER SER A . n A 1 178 SER 178 182 182 SER SER A . n A 1 179 PRO 179 183 183 PRO PRO A . n A 1 180 ARG 180 184 184 ARG ARG A . n A 1 181 ALA 181 185 185 ALA ALA A . n A 1 182 VAL 182 186 186 VAL VAL A . n A 1 183 THR 183 187 187 THR THR A . n A 1 184 GLU 184 188 188 GLU GLU A . n A 1 185 SER 185 189 189 SER SER A . n A 1 186 LEU 186 190 190 LEU LEU A . n A 1 187 GLN 187 191 191 GLN GLN A . n A 1 188 LYS 188 192 192 LYS LYS A . n A 1 189 LEU 189 193 193 LEU LEU A . n A 1 190 THR 190 194 194 THR THR A . n A 1 191 LEU 191 195 195 LEU LEU A . n A 1 192 GLY 192 196 196 GLY GLY A . n A 1 193 SER 193 197 197 SER SER A . n A 1 194 ALA 194 198 198 ALA ALA A . n A 1 195 LEU 195 199 199 LEU LEU A . n A 1 196 ALA 196 200 200 ALA ALA A . n A 1 197 ALA 197 201 201 ALA ALA A . n A 1 198 PRO 198 202 202 PRO PRO A . n A 1 199 GLN 199 203 203 GLN GLN A . n A 1 200 ARG 200 204 204 ARG ARG A . n A 1 201 GLN 201 205 205 GLN GLN A . n A 1 202 GLN 202 206 206 GLN GLN A . n A 1 203 PHE 203 207 207 PHE PHE A . n A 1 204 VAL 204 208 208 VAL VAL A . n A 1 205 ASP 205 209 209 ASP ASP A . n A 1 206 TRP 206 210 210 TRP TRP A . n A 1 207 LEU 207 211 211 LEU LEU A . n A 1 208 LYS 208 212 212 LYS LYS A . n A 1 209 GLY 209 213 213 GLY GLY A . n A 1 210 ASN 210 214 214 ASN ASN A . n A 1 211 THR 211 215 215 THR THR A . n A 1 212 THR 212 216 216 THR THR A . n A 1 213 GLY 213 217 217 GLY GLY A . n A 1 214 ASN 214 218 218 ASN ASN A . n A 1 215 HIS 215 219 219 HIS HIS A . n A 1 216 ARG 216 220 220 ARG ARG A . n A 1 217 ILE 217 221 221 ILE ILE A . n A 1 218 ARG 218 222 222 ARG ARG A . n A 1 219 ALA 219 223 223 ALA ALA A . n A 1 220 ALA 220 224 224 ALA ALA A . n A 1 221 VAL 221 225 225 VAL VAL A . n A 1 222 PRO 222 226 226 PRO PRO A . n A 1 223 ALA 223 227 227 ALA ALA A . n A 1 224 ASP 224 228 228 ASP ASP A . n A 1 225 TRP 225 229 229 TRP TRP A . n A 1 226 ALA 226 230 230 ALA ALA A . n A 1 227 VAL 227 231 231 VAL VAL A . n A 1 228 GLY 228 232 232 GLY GLY A . n A 1 229 ASP 229 233 233 ASP ASP A . n A 1 230 LYS 230 234 234 LYS LYS A . n A 1 231 THR 231 235 235 THR THR A . n A 1 232 GLY 232 236 236 GLY GLY A . n A 1 233 THR 233 237 237 THR THR A . n A 1 234 CYS 234 238 238 CYS CYS A . n A 1 235 GLY 235 239 239 GLY GLY A . n A 1 236 VAL 236 240 240 VAL VAL A . n A 1 237 TYR 237 241 241 TYR TYR A . n A 1 238 GLY 238 242 242 GLY GLY A . n A 1 239 THR 239 243 243 THR THR A . n A 1 240 ALA 240 244 244 ALA ALA A . n A 1 241 ASN 241 245 245 ASN ASN A . n A 1 242 ASP 242 246 246 ASP ASP A . n A 1 243 TYR 243 247 247 TYR TYR A . n A 1 244 ALA 244 248 248 ALA ALA A . n A 1 245 VAL 245 249 249 VAL VAL A . n A 1 246 VAL 246 250 250 VAL VAL A . n A 1 247 TRP 247 251 251 TRP TRP A . n A 1 248 PRO 248 252 252 PRO PRO A . n A 1 249 THR 249 254 254 THR THR A . n A 1 250 GLY 250 255 255 GLY GLY A . n A 1 251 ARG 251 256 256 ARG ARG A . n A 1 252 ALA 252 257 257 ALA ALA A . n A 1 253 PRO 253 258 258 PRO PRO A . n A 1 254 ILE 254 259 259 ILE ILE A . n A 1 255 VAL 255 260 260 VAL VAL A . n A 1 256 LEU 256 261 261 LEU LEU A . n A 1 257 ALA 257 262 262 ALA ALA A . n A 1 258 VAL 258 263 263 VAL VAL A . n A 1 259 TYR 259 264 264 TYR TYR A . n A 1 260 THR 260 265 265 THR THR A . n A 1 261 ARG 261 266 266 ARG ARG A . n A 1 262 ALA 262 267 267 ALA ALA A . n A 1 263 PRO 263 268 268 PRO PRO A . n A 1 264 ASN 264 269 269 ASN ASN A . n A 1 265 LYS 265 270 270 LYS LYS A . n A 1 266 ASP 266 271 271 ASP ASP A . n A 1 267 ASP 267 272 272 ASP ASP A . n A 1 268 LYS 268 273 273 LYS LYS A . n A 1 269 HIS 269 274 274 HIS HIS A . n A 1 270 SER 270 275 275 SER SER A . n A 1 271 GLU 271 276 276 GLU GLU A . n A 1 272 ALA 272 277 277 ALA ALA A . n A 1 273 VAL 273 278 278 VAL VAL A . n A 1 274 ILE 274 279 279 ILE ILE A . n A 1 275 ALA 275 280 280 ALA ALA A . n A 1 276 ALA 276 281 281 ALA ALA A . n A 1 277 ALA 277 282 282 ALA ALA A . n A 1 278 ALA 278 283 283 ALA ALA A . n A 1 279 ARG 279 284 284 ARG ARG A . n A 1 280 LEU 280 285 285 LEU LEU A . n A 1 281 ALA 281 286 286 ALA ALA A . n A 1 282 LEU 282 287 287 LEU LEU A . n A 1 283 GLU 283 288 288 GLU GLU A . n A 1 284 GLY 284 289 289 GLY GLY A . n A 1 285 LEU 285 290 290 LEU LEU A . n A 1 286 GLY 286 291 291 GLY GLY A . n A 1 287 VAL 287 292 292 VAL VAL A . n A 1 288 ASN 288 293 ? ? ? A . n A 1 289 GLY 289 294 ? ? ? A . n A 1 290 GLN 290 295 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 1CE 1 301 2 1CE 1CE A . C 2 1CE 1 302 1 1CE 1CE A . D 2 1CE 1 303 3 1CE 1CE A . E 3 GOL 1 304 1 GOL GOL A . F 4 HOH 1 401 3 HOH HOH A . F 4 HOH 2 402 39 HOH HOH A . F 4 HOH 3 403 16 HOH HOH A . F 4 HOH 4 404 8 HOH HOH A . F 4 HOH 5 405 9 HOH HOH A . F 4 HOH 6 406 19 HOH HOH A . F 4 HOH 7 407 12 HOH HOH A . F 4 HOH 8 408 7 HOH HOH A . F 4 HOH 9 409 22 HOH HOH A . F 4 HOH 10 410 2 HOH HOH A . F 4 HOH 11 411 4 HOH HOH A . F 4 HOH 12 412 32 HOH HOH A . F 4 HOH 13 413 38 HOH HOH A . F 4 HOH 14 414 35 HOH HOH A . F 4 HOH 15 415 42 HOH HOH A . F 4 HOH 16 416 1 HOH HOH A . F 4 HOH 17 417 37 HOH HOH A . F 4 HOH 18 418 23 HOH HOH A . F 4 HOH 19 419 40 HOH HOH A . F 4 HOH 20 420 43 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 410 ? F HOH . 2 1 A HOH 420 ? F HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-04-17 2 'Structure model' 1 1 2019-06-26 3 'Structure model' 1 2 2019-12-18 4 'Structure model' 1 3 2023-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' pdbx_audit_support 3 4 'Structure model' chem_comp_atom 4 4 'Structure model' chem_comp_bond 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_volume' 3 2 'Structure model' '_citation.page_first' 4 2 'Structure model' '_citation.page_last' 5 2 'Structure model' '_citation.title' 6 3 'Structure model' '_pdbx_audit_support.funding_organization' 7 4 'Structure model' '_database_2.pdbx_DOI' 8 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_phasing_MR.entry_id 6MNP _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 6.380 _pdbx_phasing_MR.d_res_low_rotation 40.780 _pdbx_phasing_MR.d_res_high_translation 6.380 _pdbx_phasing_MR.d_res_low_translation 40.780 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14_3228 1 ? 'data reduction' ? ? 'Andrew G.W. Leslie' andrew@mrc-lmb.cam.ac.uk ? ? ? ? ? http://www.mrc-lmb.cam.ac.uk/harry/mosflm/ ? MOSFLM ? ? package . 2 ? 'data scaling' ? ? 'Phil R. Evans' pre@mrc-lmb.cam.ac.uk 2013/07/21 ? ? ? Fortran_77 http://www.ccp4.ac.uk/dist/html/scala.html ? SCALA ? ? other 3.3.22 3 ? phasing ? ? 'Randy J. Read' cimr-phaser@lists.cam.ac.uk 'Fri Sep 11 04:46:07 2015 (svn Unversioned directory)' ? ? ? ? http://www-structmed.cimr.cam.ac.uk/phaser/ ? PHASER ? ? program 2.6.0 4 ? 'data extraction' ? ? PDB deposit@deposit.rcsb.org 'Sep. 1, 2017' ? ? ? C++ http://sw-tools.pdb.org/apps/PDB_EXTRACT/ ? PDB_EXTRACT ? ? package 3.24 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 27 ? ? -112.72 72.71 2 1 VAL A 29 ? ? -108.93 75.49 3 1 CYS A 69 ? ? 52.38 -136.58 4 1 TRP A 105 ? ? 52.87 77.59 5 1 THR A 115 ? ? -149.96 -26.73 6 1 LEU A 167 ? ? 76.76 -35.15 7 1 ARG A 220 ? ? -120.50 -113.55 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 4 ? A MET 1 2 1 Y 1 A GLY 5 ? A GLY 2 3 1 Y 1 A SER 6 ? A SER 3 4 1 Y 1 A SER 7 ? A SER 4 5 1 Y 1 A HIS 8 ? A HIS 5 6 1 Y 1 A HIS 9 ? A HIS 6 7 1 Y 1 A HIS 10 ? A HIS 7 8 1 Y 1 A HIS 11 ? A HIS 8 9 1 Y 1 A HIS 12 ? A HIS 9 10 1 Y 1 A HIS 13 ? A HIS 10 11 1 Y 1 A SER 14 ? A SER 11 12 1 Y 1 A SER 15 ? A SER 12 13 1 Y 1 A GLY 16 ? A GLY 13 14 1 Y 1 A LEU 17 ? A LEU 14 15 1 Y 1 A VAL 18 ? A VAL 15 16 1 Y 1 A PRO 19 ? A PRO 16 17 1 Y 1 A ARG 20 ? A ARG 17 18 1 Y 1 A GLY 21 ? A GLY 18 19 1 Y 1 A SER 22 ? A SER 19 20 1 Y 1 A HIS 23 ? A HIS 20 21 1 Y 1 A MET 24 ? A MET 21 22 1 Y 1 A ASN 293 ? A ASN 288 23 1 Y 1 A GLY 294 ? A GLY 289 24 1 Y 1 A GLN 295 ? A GLN 290 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 1CE O20 O N N 1 1CE C12 C N N 2 1CE N7 N N N 3 1CE C6 C N N 4 1CE C3 C Y N 5 1CE N2 N Y N 6 1CE N4 N Y N 7 1CE N5 N Y N 8 1CE N1 N Y N 9 1CE C11 C Y N 10 1CE C13 C Y N 11 1CE C16 C N N 12 1CE C17 C N N 13 1CE C18 C N N 14 1CE C19 C N N 15 1CE C14 C Y N 16 1CE S15 S Y N 17 1CE C10 C Y N 18 1CE N9 N N N 19 1CE C8 C N N 20 1CE H6 H N N 21 1CE H6A H N N 22 1CE HN4 H N N 23 1CE H16 H N N 24 1CE H16A H N N 25 1CE H17 H N N 26 1CE H17A H N N 27 1CE H18 H N N 28 1CE H18A H N N 29 1CE H19 H N N 30 1CE H19A H N N 31 1CE H8 H N N 32 ALA N N N N 33 ALA CA C N S 34 ALA C C N N 35 ALA O O N N 36 ALA CB C N N 37 ALA OXT O N N 38 ALA H H N N 39 ALA H2 H N N 40 ALA HA H N N 41 ALA HB1 H N N 42 ALA HB2 H N N 43 ALA HB3 H N N 44 ALA HXT H N N 45 ARG N N N N 46 ARG CA C N S 47 ARG C C N N 48 ARG O O N N 49 ARG CB C N N 50 ARG CG C N N 51 ARG CD C N N 52 ARG NE N N N 53 ARG CZ C N N 54 ARG NH1 N N N 55 ARG NH2 N N N 56 ARG OXT O N N 57 ARG H H N N 58 ARG H2 H N N 59 ARG HA H N N 60 ARG HB2 H N N 61 ARG HB3 H N N 62 ARG HG2 H N N 63 ARG HG3 H N N 64 ARG HD2 H N N 65 ARG HD3 H N N 66 ARG HE H N N 67 ARG HH11 H N N 68 ARG HH12 H N N 69 ARG HH21 H N N 70 ARG HH22 H N N 71 ARG HXT H N N 72 ASN N N N N 73 ASN CA C N S 74 ASN C C N N 75 ASN O O N N 76 ASN CB C N N 77 ASN CG C N N 78 ASN OD1 O N N 79 ASN ND2 N N N 80 ASN OXT O N N 81 ASN H H N N 82 ASN H2 H N N 83 ASN HA H N N 84 ASN HB2 H N N 85 ASN HB3 H N N 86 ASN HD21 H N N 87 ASN HD22 H N N 88 ASN HXT H N N 89 ASP N N N N 90 ASP CA C N S 91 ASP C C N N 92 ASP O O N N 93 ASP CB C N N 94 ASP CG C N N 95 ASP OD1 O N N 96 ASP OD2 O N N 97 ASP OXT O N N 98 ASP H H N N 99 ASP H2 H N N 100 ASP HA H N N 101 ASP HB2 H N N 102 ASP HB3 H N N 103 ASP HD2 H N N 104 ASP HXT H N N 105 CYS N N N N 106 CYS CA C N R 107 CYS C C N N 108 CYS O O N N 109 CYS CB C N N 110 CYS SG S N N 111 CYS OXT O N N 112 CYS H H N N 113 CYS H2 H N N 114 CYS HA H N N 115 CYS HB2 H N N 116 CYS HB3 H N N 117 CYS HG H N N 118 CYS HXT H N N 119 GLN N N N N 120 GLN CA C N S 121 GLN C C N N 122 GLN O O N N 123 GLN CB C N N 124 GLN CG C N N 125 GLN CD C N N 126 GLN OE1 O N N 127 GLN NE2 N N N 128 GLN OXT O N N 129 GLN H H N N 130 GLN H2 H N N 131 GLN HA H N N 132 GLN HB2 H N N 133 GLN HB3 H N N 134 GLN HG2 H N N 135 GLN HG3 H N N 136 GLN HE21 H N N 137 GLN HE22 H N N 138 GLN HXT H N N 139 GLU N N N N 140 GLU CA C N S 141 GLU C C N N 142 GLU O O N N 143 GLU CB C N N 144 GLU CG C N N 145 GLU CD C N N 146 GLU OE1 O N N 147 GLU OE2 O N N 148 GLU OXT O N N 149 GLU H H N N 150 GLU H2 H N N 151 GLU HA H N N 152 GLU HB2 H N N 153 GLU HB3 H N N 154 GLU HG2 H N N 155 GLU HG3 H N N 156 GLU HE2 H N N 157 GLU HXT H N N 158 GLY N N N N 159 GLY CA C N N 160 GLY C C N N 161 GLY O O N N 162 GLY OXT O N N 163 GLY H H N N 164 GLY H2 H N N 165 GLY HA2 H N N 166 GLY HA3 H N N 167 GLY HXT H N N 168 GOL C1 C N N 169 GOL O1 O N N 170 GOL C2 C N N 171 GOL O2 O N N 172 GOL C3 C N N 173 GOL O3 O N N 174 GOL H11 H N N 175 GOL H12 H N N 176 GOL HO1 H N N 177 GOL H2 H N N 178 GOL HO2 H N N 179 GOL H31 H N N 180 GOL H32 H N N 181 GOL HO3 H N N 182 HIS N N N N 183 HIS CA C N S 184 HIS C C N N 185 HIS O O N N 186 HIS CB C N N 187 HIS CG C Y N 188 HIS ND1 N Y N 189 HIS CD2 C Y N 190 HIS CE1 C Y N 191 HIS NE2 N Y N 192 HIS OXT O N N 193 HIS H H N N 194 HIS H2 H N N 195 HIS HA H N N 196 HIS HB2 H N N 197 HIS HB3 H N N 198 HIS HD1 H N N 199 HIS HD2 H N N 200 HIS HE1 H N N 201 HIS HE2 H N N 202 HIS HXT H N N 203 HOH O O N N 204 HOH H1 H N N 205 HOH H2 H N N 206 ILE N N N N 207 ILE CA C N S 208 ILE C C N N 209 ILE O O N N 210 ILE CB C N S 211 ILE CG1 C N N 212 ILE CG2 C N N 213 ILE CD1 C N N 214 ILE OXT O N N 215 ILE H H N N 216 ILE H2 H N N 217 ILE HA H N N 218 ILE HB H N N 219 ILE HG12 H N N 220 ILE HG13 H N N 221 ILE HG21 H N N 222 ILE HG22 H N N 223 ILE HG23 H N N 224 ILE HD11 H N N 225 ILE HD12 H N N 226 ILE HD13 H N N 227 ILE HXT H N N 228 LEU N N N N 229 LEU CA C N S 230 LEU C C N N 231 LEU O O N N 232 LEU CB C N N 233 LEU CG C N N 234 LEU CD1 C N N 235 LEU CD2 C N N 236 LEU OXT O N N 237 LEU H H N N 238 LEU H2 H N N 239 LEU HA H N N 240 LEU HB2 H N N 241 LEU HB3 H N N 242 LEU HG H N N 243 LEU HD11 H N N 244 LEU HD12 H N N 245 LEU HD13 H N N 246 LEU HD21 H N N 247 LEU HD22 H N N 248 LEU HD23 H N N 249 LEU HXT H N N 250 LYS N N N N 251 LYS CA C N S 252 LYS C C N N 253 LYS O O N N 254 LYS CB C N N 255 LYS CG C N N 256 LYS CD C N N 257 LYS CE C N N 258 LYS NZ N N N 259 LYS OXT O N N 260 LYS H H N N 261 LYS H2 H N N 262 LYS HA H N N 263 LYS HB2 H N N 264 LYS HB3 H N N 265 LYS HG2 H N N 266 LYS HG3 H N N 267 LYS HD2 H N N 268 LYS HD3 H N N 269 LYS HE2 H N N 270 LYS HE3 H N N 271 LYS HZ1 H N N 272 LYS HZ2 H N N 273 LYS HZ3 H N N 274 LYS HXT H N N 275 MET N N N N 276 MET CA C N S 277 MET C C N N 278 MET O O N N 279 MET CB C N N 280 MET CG C N N 281 MET SD S N N 282 MET CE C N N 283 MET OXT O N N 284 MET H H N N 285 MET H2 H N N 286 MET HA H N N 287 MET HB2 H N N 288 MET HB3 H N N 289 MET HG2 H N N 290 MET HG3 H N N 291 MET HE1 H N N 292 MET HE2 H N N 293 MET HE3 H N N 294 MET HXT H N N 295 PHE N N N N 296 PHE CA C N S 297 PHE C C N N 298 PHE O O N N 299 PHE CB C N N 300 PHE CG C Y N 301 PHE CD1 C Y N 302 PHE CD2 C Y N 303 PHE CE1 C Y N 304 PHE CE2 C Y N 305 PHE CZ C Y N 306 PHE OXT O N N 307 PHE H H N N 308 PHE H2 H N N 309 PHE HA H N N 310 PHE HB2 H N N 311 PHE HB3 H N N 312 PHE HD1 H N N 313 PHE HD2 H N N 314 PHE HE1 H N N 315 PHE HE2 H N N 316 PHE HZ H N N 317 PHE HXT H N N 318 PRO N N N N 319 PRO CA C N S 320 PRO C C N N 321 PRO O O N N 322 PRO CB C N N 323 PRO CG C N N 324 PRO CD C N N 325 PRO OXT O N N 326 PRO H H N N 327 PRO HA H N N 328 PRO HB2 H N N 329 PRO HB3 H N N 330 PRO HG2 H N N 331 PRO HG3 H N N 332 PRO HD2 H N N 333 PRO HD3 H N N 334 PRO HXT H N N 335 SER N N N N 336 SER CA C N S 337 SER C C N N 338 SER O O N N 339 SER CB C N N 340 SER OG O N N 341 SER OXT O N N 342 SER H H N N 343 SER H2 H N N 344 SER HA H N N 345 SER HB2 H N N 346 SER HB3 H N N 347 SER HG H N N 348 SER HXT H N N 349 THR N N N N 350 THR CA C N S 351 THR C C N N 352 THR O O N N 353 THR CB C N R 354 THR OG1 O N N 355 THR CG2 C N N 356 THR OXT O N N 357 THR H H N N 358 THR H2 H N N 359 THR HA H N N 360 THR HB H N N 361 THR HG1 H N N 362 THR HG21 H N N 363 THR HG22 H N N 364 THR HG23 H N N 365 THR HXT H N N 366 TRP N N N N 367 TRP CA C N S 368 TRP C C N N 369 TRP O O N N 370 TRP CB C N N 371 TRP CG C Y N 372 TRP CD1 C Y N 373 TRP CD2 C Y N 374 TRP NE1 N Y N 375 TRP CE2 C Y N 376 TRP CE3 C Y N 377 TRP CZ2 C Y N 378 TRP CZ3 C Y N 379 TRP CH2 C Y N 380 TRP OXT O N N 381 TRP H H N N 382 TRP H2 H N N 383 TRP HA H N N 384 TRP HB2 H N N 385 TRP HB3 H N N 386 TRP HD1 H N N 387 TRP HE1 H N N 388 TRP HE3 H N N 389 TRP HZ2 H N N 390 TRP HZ3 H N N 391 TRP HH2 H N N 392 TRP HXT H N N 393 TYR N N N N 394 TYR CA C N S 395 TYR C C N N 396 TYR O O N N 397 TYR CB C N N 398 TYR CG C Y N 399 TYR CD1 C Y N 400 TYR CD2 C Y N 401 TYR CE1 C Y N 402 TYR CE2 C Y N 403 TYR CZ C Y N 404 TYR OH O N N 405 TYR OXT O N N 406 TYR H H N N 407 TYR H2 H N N 408 TYR HA H N N 409 TYR HB2 H N N 410 TYR HB3 H N N 411 TYR HD1 H N N 412 TYR HD2 H N N 413 TYR HE1 H N N 414 TYR HE2 H N N 415 TYR HH H N N 416 TYR HXT H N N 417 VAL N N N N 418 VAL CA C N S 419 VAL C C N N 420 VAL O O N N 421 VAL CB C N N 422 VAL CG1 C N N 423 VAL CG2 C N N 424 VAL OXT O N N 425 VAL H H N N 426 VAL H2 H N N 427 VAL HA H N N 428 VAL HB H N N 429 VAL HG11 H N N 430 VAL HG12 H N N 431 VAL HG13 H N N 432 VAL HG21 H N N 433 VAL HG22 H N N 434 VAL HG23 H N N 435 VAL HXT H N N 436 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 1CE O20 C12 doub N N 1 1CE C12 N7 sing N N 2 1CE C12 C11 sing N N 3 1CE N7 C6 sing N N 4 1CE N7 C8 sing N N 5 1CE C6 C3 sing N N 6 1CE C3 N2 doub Y N 7 1CE C3 N4 sing Y N 8 1CE N2 N1 sing Y N 9 1CE N4 N5 sing Y N 10 1CE N5 N1 doub Y N 11 1CE C11 C13 sing Y N 12 1CE C11 C10 doub Y N 13 1CE C13 C16 sing N N 14 1CE C13 C14 doub Y N 15 1CE C16 C17 sing N N 16 1CE C17 C18 sing N N 17 1CE C18 C19 sing N N 18 1CE C19 C14 sing N N 19 1CE C14 S15 sing Y N 20 1CE S15 C10 sing Y N 21 1CE C10 N9 sing N N 22 1CE N9 C8 doub N N 23 1CE C6 H6 sing N N 24 1CE C6 H6A sing N N 25 1CE N4 HN4 sing N N 26 1CE C16 H16 sing N N 27 1CE C16 H16A sing N N 28 1CE C17 H17 sing N N 29 1CE C17 H17A sing N N 30 1CE C18 H18 sing N N 31 1CE C18 H18A sing N N 32 1CE C19 H19 sing N N 33 1CE C19 H19A sing N N 34 1CE C8 H8 sing N N 35 ALA N CA sing N N 36 ALA N H sing N N 37 ALA N H2 sing N N 38 ALA CA C sing N N 39 ALA CA CB sing N N 40 ALA CA HA sing N N 41 ALA C O doub N N 42 ALA C OXT sing N N 43 ALA CB HB1 sing N N 44 ALA CB HB2 sing N N 45 ALA CB HB3 sing N N 46 ALA OXT HXT sing N N 47 ARG N CA sing N N 48 ARG N H sing N N 49 ARG N H2 sing N N 50 ARG CA C sing N N 51 ARG CA CB sing N N 52 ARG CA HA sing N N 53 ARG C O doub N N 54 ARG C OXT sing N N 55 ARG CB CG sing N N 56 ARG CB HB2 sing N N 57 ARG CB HB3 sing N N 58 ARG CG CD sing N N 59 ARG CG HG2 sing N N 60 ARG CG HG3 sing N N 61 ARG CD NE sing N N 62 ARG CD HD2 sing N N 63 ARG CD HD3 sing N N 64 ARG NE CZ sing N N 65 ARG NE HE sing N N 66 ARG CZ NH1 sing N N 67 ARG CZ NH2 doub N N 68 ARG NH1 HH11 sing N N 69 ARG NH1 HH12 sing N N 70 ARG NH2 HH21 sing N N 71 ARG NH2 HH22 sing N N 72 ARG OXT HXT sing N N 73 ASN N CA sing N N 74 ASN N H sing N N 75 ASN N H2 sing N N 76 ASN CA C sing N N 77 ASN CA CB sing N N 78 ASN CA HA sing N N 79 ASN C O doub N N 80 ASN C OXT sing N N 81 ASN CB CG sing N N 82 ASN CB HB2 sing N N 83 ASN CB HB3 sing N N 84 ASN CG OD1 doub N N 85 ASN CG ND2 sing N N 86 ASN ND2 HD21 sing N N 87 ASN ND2 HD22 sing N N 88 ASN OXT HXT sing N N 89 ASP N CA sing N N 90 ASP N H sing N N 91 ASP N H2 sing N N 92 ASP CA C sing N N 93 ASP CA CB sing N N 94 ASP CA HA sing N N 95 ASP C O doub N N 96 ASP C OXT sing N N 97 ASP CB CG sing N N 98 ASP CB HB2 sing N N 99 ASP CB HB3 sing N N 100 ASP CG OD1 doub N N 101 ASP CG OD2 sing N N 102 ASP OD2 HD2 sing N N 103 ASP OXT HXT sing N N 104 CYS N CA sing N N 105 CYS N H sing N N 106 CYS N H2 sing N N 107 CYS CA C sing N N 108 CYS CA CB sing N N 109 CYS CA HA sing N N 110 CYS C O doub N N 111 CYS C OXT sing N N 112 CYS CB SG sing N N 113 CYS CB HB2 sing N N 114 CYS CB HB3 sing N N 115 CYS SG HG sing N N 116 CYS OXT HXT sing N N 117 GLN N CA sing N N 118 GLN N H sing N N 119 GLN N H2 sing N N 120 GLN CA C sing N N 121 GLN CA CB sing N N 122 GLN CA HA sing N N 123 GLN C O doub N N 124 GLN C OXT sing N N 125 GLN CB CG sing N N 126 GLN CB HB2 sing N N 127 GLN CB HB3 sing N N 128 GLN CG CD sing N N 129 GLN CG HG2 sing N N 130 GLN CG HG3 sing N N 131 GLN CD OE1 doub N N 132 GLN CD NE2 sing N N 133 GLN NE2 HE21 sing N N 134 GLN NE2 HE22 sing N N 135 GLN OXT HXT sing N N 136 GLU N CA sing N N 137 GLU N H sing N N 138 GLU N H2 sing N N 139 GLU CA C sing N N 140 GLU CA CB sing N N 141 GLU CA HA sing N N 142 GLU C O doub N N 143 GLU C OXT sing N N 144 GLU CB CG sing N N 145 GLU CB HB2 sing N N 146 GLU CB HB3 sing N N 147 GLU CG CD sing N N 148 GLU CG HG2 sing N N 149 GLU CG HG3 sing N N 150 GLU CD OE1 doub N N 151 GLU CD OE2 sing N N 152 GLU OE2 HE2 sing N N 153 GLU OXT HXT sing N N 154 GLY N CA sing N N 155 GLY N H sing N N 156 GLY N H2 sing N N 157 GLY CA C sing N N 158 GLY CA HA2 sing N N 159 GLY CA HA3 sing N N 160 GLY C O doub N N 161 GLY C OXT sing N N 162 GLY OXT HXT sing N N 163 GOL C1 O1 sing N N 164 GOL C1 C2 sing N N 165 GOL C1 H11 sing N N 166 GOL C1 H12 sing N N 167 GOL O1 HO1 sing N N 168 GOL C2 O2 sing N N 169 GOL C2 C3 sing N N 170 GOL C2 H2 sing N N 171 GOL O2 HO2 sing N N 172 GOL C3 O3 sing N N 173 GOL C3 H31 sing N N 174 GOL C3 H32 sing N N 175 GOL O3 HO3 sing N N 176 HIS N CA sing N N 177 HIS N H sing N N 178 HIS N H2 sing N N 179 HIS CA C sing N N 180 HIS CA CB sing N N 181 HIS CA HA sing N N 182 HIS C O doub N N 183 HIS C OXT sing N N 184 HIS CB CG sing N N 185 HIS CB HB2 sing N N 186 HIS CB HB3 sing N N 187 HIS CG ND1 sing Y N 188 HIS CG CD2 doub Y N 189 HIS ND1 CE1 doub Y N 190 HIS ND1 HD1 sing N N 191 HIS CD2 NE2 sing Y N 192 HIS CD2 HD2 sing N N 193 HIS CE1 NE2 sing Y N 194 HIS CE1 HE1 sing N N 195 HIS NE2 HE2 sing N N 196 HIS OXT HXT sing N N 197 HOH O H1 sing N N 198 HOH O H2 sing N N 199 ILE N CA sing N N 200 ILE N H sing N N 201 ILE N H2 sing N N 202 ILE CA C sing N N 203 ILE CA CB sing N N 204 ILE CA HA sing N N 205 ILE C O doub N N 206 ILE C OXT sing N N 207 ILE CB CG1 sing N N 208 ILE CB CG2 sing N N 209 ILE CB HB sing N N 210 ILE CG1 CD1 sing N N 211 ILE CG1 HG12 sing N N 212 ILE CG1 HG13 sing N N 213 ILE CG2 HG21 sing N N 214 ILE CG2 HG22 sing N N 215 ILE CG2 HG23 sing N N 216 ILE CD1 HD11 sing N N 217 ILE CD1 HD12 sing N N 218 ILE CD1 HD13 sing N N 219 ILE OXT HXT sing N N 220 LEU N CA sing N N 221 LEU N H sing N N 222 LEU N H2 sing N N 223 LEU CA C sing N N 224 LEU CA CB sing N N 225 LEU CA HA sing N N 226 LEU C O doub N N 227 LEU C OXT sing N N 228 LEU CB CG sing N N 229 LEU CB HB2 sing N N 230 LEU CB HB3 sing N N 231 LEU CG CD1 sing N N 232 LEU CG CD2 sing N N 233 LEU CG HG sing N N 234 LEU CD1 HD11 sing N N 235 LEU CD1 HD12 sing N N 236 LEU CD1 HD13 sing N N 237 LEU CD2 HD21 sing N N 238 LEU CD2 HD22 sing N N 239 LEU CD2 HD23 sing N N 240 LEU OXT HXT sing N N 241 LYS N CA sing N N 242 LYS N H sing N N 243 LYS N H2 sing N N 244 LYS CA C sing N N 245 LYS CA CB sing N N 246 LYS CA HA sing N N 247 LYS C O doub N N 248 LYS C OXT sing N N 249 LYS CB CG sing N N 250 LYS CB HB2 sing N N 251 LYS CB HB3 sing N N 252 LYS CG CD sing N N 253 LYS CG HG2 sing N N 254 LYS CG HG3 sing N N 255 LYS CD CE sing N N 256 LYS CD HD2 sing N N 257 LYS CD HD3 sing N N 258 LYS CE NZ sing N N 259 LYS CE HE2 sing N N 260 LYS CE HE3 sing N N 261 LYS NZ HZ1 sing N N 262 LYS NZ HZ2 sing N N 263 LYS NZ HZ3 sing N N 264 LYS OXT HXT sing N N 265 MET N CA sing N N 266 MET N H sing N N 267 MET N H2 sing N N 268 MET CA C sing N N 269 MET CA CB sing N N 270 MET CA HA sing N N 271 MET C O doub N N 272 MET C OXT sing N N 273 MET CB CG sing N N 274 MET CB HB2 sing N N 275 MET CB HB3 sing N N 276 MET CG SD sing N N 277 MET CG HG2 sing N N 278 MET CG HG3 sing N N 279 MET SD CE sing N N 280 MET CE HE1 sing N N 281 MET CE HE2 sing N N 282 MET CE HE3 sing N N 283 MET OXT HXT sing N N 284 PHE N CA sing N N 285 PHE N H sing N N 286 PHE N H2 sing N N 287 PHE CA C sing N N 288 PHE CA CB sing N N 289 PHE CA HA sing N N 290 PHE C O doub N N 291 PHE C OXT sing N N 292 PHE CB CG sing N N 293 PHE CB HB2 sing N N 294 PHE CB HB3 sing N N 295 PHE CG CD1 doub Y N 296 PHE CG CD2 sing Y N 297 PHE CD1 CE1 sing Y N 298 PHE CD1 HD1 sing N N 299 PHE CD2 CE2 doub Y N 300 PHE CD2 HD2 sing N N 301 PHE CE1 CZ doub Y N 302 PHE CE1 HE1 sing N N 303 PHE CE2 CZ sing Y N 304 PHE CE2 HE2 sing N N 305 PHE CZ HZ sing N N 306 PHE OXT HXT sing N N 307 PRO N CA sing N N 308 PRO N CD sing N N 309 PRO N H sing N N 310 PRO CA C sing N N 311 PRO CA CB sing N N 312 PRO CA HA sing N N 313 PRO C O doub N N 314 PRO C OXT sing N N 315 PRO CB CG sing N N 316 PRO CB HB2 sing N N 317 PRO CB HB3 sing N N 318 PRO CG CD sing N N 319 PRO CG HG2 sing N N 320 PRO CG HG3 sing N N 321 PRO CD HD2 sing N N 322 PRO CD HD3 sing N N 323 PRO OXT HXT sing N N 324 SER N CA sing N N 325 SER N H sing N N 326 SER N H2 sing N N 327 SER CA C sing N N 328 SER CA CB sing N N 329 SER CA HA sing N N 330 SER C O doub N N 331 SER C OXT sing N N 332 SER CB OG sing N N 333 SER CB HB2 sing N N 334 SER CB HB3 sing N N 335 SER OG HG sing N N 336 SER OXT HXT sing N N 337 THR N CA sing N N 338 THR N H sing N N 339 THR N H2 sing N N 340 THR CA C sing N N 341 THR CA CB sing N N 342 THR CA HA sing N N 343 THR C O doub N N 344 THR C OXT sing N N 345 THR CB OG1 sing N N 346 THR CB CG2 sing N N 347 THR CB HB sing N N 348 THR OG1 HG1 sing N N 349 THR CG2 HG21 sing N N 350 THR CG2 HG22 sing N N 351 THR CG2 HG23 sing N N 352 THR OXT HXT sing N N 353 TRP N CA sing N N 354 TRP N H sing N N 355 TRP N H2 sing N N 356 TRP CA C sing N N 357 TRP CA CB sing N N 358 TRP CA HA sing N N 359 TRP C O doub N N 360 TRP C OXT sing N N 361 TRP CB CG sing N N 362 TRP CB HB2 sing N N 363 TRP CB HB3 sing N N 364 TRP CG CD1 doub Y N 365 TRP CG CD2 sing Y N 366 TRP CD1 NE1 sing Y N 367 TRP CD1 HD1 sing N N 368 TRP CD2 CE2 doub Y N 369 TRP CD2 CE3 sing Y N 370 TRP NE1 CE2 sing Y N 371 TRP NE1 HE1 sing N N 372 TRP CE2 CZ2 sing Y N 373 TRP CE3 CZ3 doub Y N 374 TRP CE3 HE3 sing N N 375 TRP CZ2 CH2 doub Y N 376 TRP CZ2 HZ2 sing N N 377 TRP CZ3 CH2 sing Y N 378 TRP CZ3 HZ3 sing N N 379 TRP CH2 HH2 sing N N 380 TRP OXT HXT sing N N 381 TYR N CA sing N N 382 TYR N H sing N N 383 TYR N H2 sing N N 384 TYR CA C sing N N 385 TYR CA CB sing N N 386 TYR CA HA sing N N 387 TYR C O doub N N 388 TYR C OXT sing N N 389 TYR CB CG sing N N 390 TYR CB HB2 sing N N 391 TYR CB HB3 sing N N 392 TYR CG CD1 doub Y N 393 TYR CG CD2 sing Y N 394 TYR CD1 CE1 sing Y N 395 TYR CD1 HD1 sing N N 396 TYR CD2 CE2 doub Y N 397 TYR CD2 HD2 sing N N 398 TYR CE1 CZ doub Y N 399 TYR CE1 HE1 sing N N 400 TYR CE2 CZ sing Y N 401 TYR CE2 HE2 sing N N 402 TYR CZ OH sing N N 403 TYR OH HH sing N N 404 TYR OXT HXT sing N N 405 VAL N CA sing N N 406 VAL N H sing N N 407 VAL N H2 sing N N 408 VAL CA C sing N N 409 VAL CA CB sing N N 410 VAL CA HA sing N N 411 VAL C O doub N N 412 VAL C OXT sing N N 413 VAL CB CG1 sing N N 414 VAL CB CG2 sing N N 415 VAL CB HB sing N N 416 VAL CG1 HG11 sing N N 417 VAL CG1 HG12 sing N N 418 VAL CG1 HG13 sing N N 419 VAL CG2 HG21 sing N N 420 VAL CG2 HG22 sing N N 421 VAL CG2 HG23 sing N N 422 VAL OXT HXT sing N N 423 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number AI103158 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 1CE _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 1CE _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '3-(1H-tetrazol-5-ylmethyl)-5,6,7,8-tetrahydro[1]benzothieno[2,3-d]pyrimidin-4(3H)-one' 1CE 3 GLYCEROL GOL 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3C5A _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #