data_6MQY # _entry.id 6MQY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6MQY pdb_00006mqy 10.2210/pdb6mqy/pdb WWPDB D_1000236883 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6MQY _pdbx_database_status.recvd_initial_deposition_date 2018-10-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ghanbarpour, A.' 1 ? 'Geiger, J.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Am. Chem. Soc.' _citation.journal_id_ASTM JACSAT _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 141 _citation.language ? _citation.page_first 1735 _citation.page_last 1741 _citation.title 'Mimicking Microbial Rhodopsin Isomerization in a Single Crystal.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacs.8b12493 _citation.pdbx_database_id_PubMed 30580520 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ghanbarpour, A.' 1 ? primary 'Nairat, M.' 2 ? primary 'Nosrati, M.' 3 ? primary 'Santos, E.M.' 4 ? primary 'Vasileiou, C.' 5 ? primary 'Dantus, M.' 6 ? primary 'Borhan, B.' 7 ? primary 'Geiger, J.H.' 8 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6MQY _cell.details ? _cell.formula_units_Z ? _cell.length_a 58.343 _cell.length_a_esd ? _cell.length_b 58.343 _cell.length_b_esd ? _cell.length_c 99.865 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6MQY _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cellular retinoic acid-binding protein 2' 15594.747 1 ? 'R111K, Y134F, T54V, R132Q, P39Y, R59Y, L121E' ? ? 2 non-polymer syn GLYCEROL 92.094 3 ? ? ? ? 3 non-polymer syn RETINAL 284.436 1 ? ? ? ? 4 water nat water 18.015 42 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cellular retinoic acid-binding protein II,CRABP-II' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKYAVEIKQEGDTFYIKVSTTVYTTEINFKVGEEFEEQTVDGRP CKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELIETMTADDVVCTQVFVRE ; _entity_poly.pdbx_seq_one_letter_code_can ;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKYAVEIKQEGDTFYIKVSTTVYTTEINFKVGEEFEEQTVDGRP CKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELIETMTADDVVCTQVFVRE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 ASN n 1 3 PHE n 1 4 SER n 1 5 GLY n 1 6 ASN n 1 7 TRP n 1 8 LYS n 1 9 ILE n 1 10 ILE n 1 11 ARG n 1 12 SER n 1 13 GLU n 1 14 ASN n 1 15 PHE n 1 16 GLU n 1 17 GLU n 1 18 LEU n 1 19 LEU n 1 20 LYS n 1 21 VAL n 1 22 LEU n 1 23 GLY n 1 24 VAL n 1 25 ASN n 1 26 VAL n 1 27 MET n 1 28 LEU n 1 29 ARG n 1 30 LYS n 1 31 ILE n 1 32 ALA n 1 33 VAL n 1 34 ALA n 1 35 ALA n 1 36 ALA n 1 37 SER n 1 38 LYS n 1 39 TYR n 1 40 ALA n 1 41 VAL n 1 42 GLU n 1 43 ILE n 1 44 LYS n 1 45 GLN n 1 46 GLU n 1 47 GLY n 1 48 ASP n 1 49 THR n 1 50 PHE n 1 51 TYR n 1 52 ILE n 1 53 LYS n 1 54 VAL n 1 55 SER n 1 56 THR n 1 57 THR n 1 58 VAL n 1 59 TYR n 1 60 THR n 1 61 THR n 1 62 GLU n 1 63 ILE n 1 64 ASN n 1 65 PHE n 1 66 LYS n 1 67 VAL n 1 68 GLY n 1 69 GLU n 1 70 GLU n 1 71 PHE n 1 72 GLU n 1 73 GLU n 1 74 GLN n 1 75 THR n 1 76 VAL n 1 77 ASP n 1 78 GLY n 1 79 ARG n 1 80 PRO n 1 81 CYS n 1 82 LYS n 1 83 SER n 1 84 LEU n 1 85 VAL n 1 86 LYS n 1 87 TRP n 1 88 GLU n 1 89 SER n 1 90 GLU n 1 91 ASN n 1 92 LYS n 1 93 MET n 1 94 VAL n 1 95 CYS n 1 96 GLU n 1 97 GLN n 1 98 LYS n 1 99 LEU n 1 100 LEU n 1 101 LYS n 1 102 GLY n 1 103 GLU n 1 104 GLY n 1 105 PRO n 1 106 LYS n 1 107 THR n 1 108 SER n 1 109 TRP n 1 110 THR n 1 111 LYS n 1 112 GLU n 1 113 LEU n 1 114 THR n 1 115 ASN n 1 116 ASP n 1 117 GLY n 1 118 GLU n 1 119 LEU n 1 120 ILE n 1 121 GLU n 1 122 THR n 1 123 MET n 1 124 THR n 1 125 ALA n 1 126 ASP n 1 127 ASP n 1 128 VAL n 1 129 VAL n 1 130 CYS n 1 131 THR n 1 132 GLN n 1 133 VAL n 1 134 PHE n 1 135 VAL n 1 136 ARG n 1 137 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 137 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CRABP2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Bacterial expression vector pBEN1-SGC' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 747347 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RABP2_HUMAN _struct_ref.pdbx_db_accession P29373 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP CKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6MQY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 137 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P29373 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 138 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 137 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6MQY TYR A 39 ? UNP P29373 PRO 40 'engineered mutation' 39 1 1 6MQY VAL A 54 ? UNP P29373 THR 55 'engineered mutation' 54 2 1 6MQY TYR A 59 ? UNP P29373 ARG 60 'engineered mutation' 59 3 1 6MQY LYS A 111 ? UNP P29373 ARG 112 'engineered mutation' 111 4 1 6MQY GLU A 121 ? UNP P29373 LEU 122 'engineered mutation' 121 5 1 6MQY GLN A 132 ? UNP P29373 ARG 133 'engineered mutation' 132 6 1 6MQY PHE A 134 ? UNP P29373 TYR 135 'engineered mutation' 134 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 RET non-polymer . RETINAL ? 'C20 H28 O' 284.436 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6MQY _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.15 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 60.91 _exptl_crystal.description Hexagonal _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 3350, D-Malic acid' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-12-21 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97911 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97911 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-D _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6MQY _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.9 _reflns.d_resolution_low 29.171 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 16010 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.4 _reflns.pdbx_Rmerge_I_obs 0.047 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 35.49 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.90 _reflns_shell.d_res_low 1.93 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1552 _reflns_shell.percent_possible_all 98.66 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.359 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.6 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.481 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6MQY _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.900 _refine.ls_d_res_low 29.171 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15994 _refine.ls_number_reflns_R_free 973 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.52 _refine.ls_percent_reflns_R_free 6.08 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1911 _refine.ls_R_factor_R_free 0.2170 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1893 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.39 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4YFP _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.80 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.08 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1093 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 38 _refine_hist.number_atoms_solvent 42 _refine_hist.number_atoms_total 1173 _refine_hist.d_res_high 1.900 _refine_hist.d_res_low 29.171 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 1164 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.871 ? 1570 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 12.253 ? 971 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.053 ? 176 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 198 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.9000 2.0002 . . 141 2100 99.00 . . . 0.2683 . 0.2225 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0002 2.1254 . . 136 2096 100.00 . . . 0.2262 . 0.1896 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1254 2.2895 . . 138 2121 100.00 . . . 0.2241 . 0.1782 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2895 2.5198 . . 139 2136 100.00 . . . 0.2459 . 0.2010 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5198 2.8841 . . 135 2148 100.00 . . . 0.2415 . 0.2070 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8841 3.6326 . . 137 2154 99.00 . . . 0.2128 . 0.1877 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6326 29.1749 . . 147 2266 100.00 . . . 0.1938 . 0.1794 . . . . . . . . . . # _struct.entry_id 6MQY _struct.title ;Crystal Structure of the 13-cis Product of All-trans Retinal-Bound R111K:Y134F:T54V:R132Q:P39Y:R59Y:L121E Mutant of Human Cellular Retinoic Acid Binding Protein II Irradiated with 400 nm Laser (30 seconds) at 1.9 Angstrom ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6MQY _struct_keywords.text 'iLBP, Rhodopsin mimic, LIPID BINDING PROTEIN' _struct_keywords.pdbx_keywords 'LIPID BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 14 ? LEU A 22 ? ASN A 14 LEU A 22 1 ? 9 HELX_P HELX_P2 AA2 ASN A 25 ? SER A 37 ? ASN A 25 SER A 37 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id LYS _struct_conn.ptnr1_label_seq_id 111 _struct_conn.ptnr1_label_atom_id NZ _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id E _struct_conn.ptnr2_label_comp_id RET _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C15 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id LYS _struct_conn.ptnr1_auth_seq_id 111 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id RET _struct_conn.ptnr2_auth_seq_id 204 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.250 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 10 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 60 ? LYS A 66 ? THR A 60 LYS A 66 AA1 2 THR A 49 ? SER A 55 ? THR A 49 SER A 55 AA1 3 ALA A 40 ? GLU A 46 ? ALA A 40 GLU A 46 AA1 4 GLY A 5 ? GLU A 13 ? GLY A 5 GLU A 13 AA1 5 VAL A 128 ? ARG A 136 ? VAL A 128 ARG A 136 AA1 6 GLU A 118 ? ALA A 125 ? GLU A 118 ALA A 125 AA1 7 THR A 107 ? LEU A 113 ? THR A 107 LEU A 113 AA1 8 LYS A 92 ? LEU A 99 ? LYS A 92 LEU A 99 AA1 9 PRO A 80 ? TRP A 87 ? PRO A 80 TRP A 87 AA1 10 PHE A 71 ? GLN A 74 ? PHE A 71 GLN A 74 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O PHE A 65 ? O PHE A 65 N PHE A 50 ? N PHE A 50 AA1 2 3 O LYS A 53 ? O LYS A 53 N GLU A 42 ? N GLU A 42 AA1 3 4 O VAL A 41 ? O VAL A 41 N TRP A 7 ? N TRP A 7 AA1 4 5 N ILE A 10 ? N ILE A 10 O VAL A 133 ? O VAL A 133 AA1 5 6 O CYS A 130 ? O CYS A 130 N MET A 123 ? N MET A 123 AA1 6 7 O ILE A 120 ? O ILE A 120 N GLU A 112 ? N GLU A 112 AA1 7 8 O TRP A 109 ? O TRP A 109 N CYS A 95 ? N CYS A 95 AA1 8 9 O VAL A 94 ? O VAL A 94 N LYS A 86 ? N LYS A 86 AA1 9 10 O SER A 83 ? O SER A 83 N PHE A 71 ? N PHE A 71 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A GOL 201 ? 8 'binding site for residue GOL A 201' AC2 Software A GOL 202 ? 5 'binding site for residue GOL A 202' AC3 Software A GOL 203 ? 3 'binding site for residue GOL A 203' AC4 Software A RET 204 ? 7 'binding site for residue RET A 204' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 PRO A 1 ? PRO A 1 . ? 1_555 ? 2 AC1 8 ASN A 2 ? ASN A 2 . ? 1_555 ? 3 AC1 8 GLU A 13 ? GLU A 13 . ? 3_454 ? 4 AC1 8 ASN A 14 ? ASN A 14 . ? 3_454 ? 5 AC1 8 GLU A 17 ? GLU A 17 . ? 3_454 ? 6 AC1 8 GLN A 45 ? GLN A 45 . ? 1_555 ? 7 AC1 8 GLU A 46 ? GLU A 46 . ? 1_555 ? 8 AC1 8 GLY A 47 ? GLY A 47 . ? 1_555 ? 9 AC2 5 GLU A 42 ? GLU A 42 . ? 1_555 ? 10 AC2 5 TYR A 51 ? TYR A 51 . ? 1_555 ? 11 AC2 5 ILE A 52 ? ILE A 52 . ? 1_555 ? 12 AC2 5 GLU A 62 ? GLU A 62 . ? 1_555 ? 13 AC2 5 ASN A 64 ? ASN A 64 . ? 1_555 ? 14 AC3 3 ILE A 10 ? ILE A 10 . ? 1_555 ? 15 AC3 3 THR A 49 ? THR A 49 . ? 2_565 ? 16 AC3 3 HOH F . ? HOH A 303 . ? 1_555 ? 17 AC4 7 MET A 27 ? MET A 27 . ? 4_465 ? 18 AC4 7 TYR A 39 ? TYR A 39 . ? 1_555 ? 19 AC4 7 ILE A 63 ? ILE A 63 . ? 1_555 ? 20 AC4 7 GLU A 73 ? GLU A 73 . ? 1_555 ? 21 AC4 7 TRP A 109 ? TRP A 109 . ? 1_555 ? 22 AC4 7 LYS A 111 ? LYS A 111 . ? 1_555 ? 23 AC4 7 GLU A 121 ? GLU A 121 . ? 1_555 ? # _atom_sites.entry_id 6MQY _atom_sites.fract_transf_matrix[1][1] 0.017140 _atom_sites.fract_transf_matrix[1][2] 0.009896 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019792 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010014 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 1 1 PRO PRO A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 TRP 7 7 7 TRP TRP A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 MET 27 27 27 MET MET A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 CYS 81 81 81 CYS CYS A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 TRP 87 87 87 TRP TRP A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 MET 93 93 93 MET MET A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 CYS 95 95 95 CYS CYS A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 TRP 109 109 109 TRP TRP A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 MET 123 123 123 MET MET A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 CYS 130 130 130 CYS CYS A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 GLN 132 132 132 GLN GLN A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 PHE 134 134 134 PHE PHE A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 GLU 137 137 137 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOL 1 201 1 GOL GOL A . C 2 GOL 1 202 2 GOL GOL A . D 2 GOL 1 203 4 GOL GOL A . E 3 RET 1 204 1 RET RET A . F 4 HOH 1 301 13 HOH HOH A . F 4 HOH 2 302 6 HOH HOH A . F 4 HOH 3 303 2 HOH HOH A . F 4 HOH 4 304 44 HOH HOH A . F 4 HOH 5 305 8 HOH HOH A . F 4 HOH 6 306 4 HOH HOH A . F 4 HOH 7 307 36 HOH HOH A . F 4 HOH 8 308 18 HOH HOH A . F 4 HOH 9 309 7 HOH HOH A . F 4 HOH 10 310 19 HOH HOH A . F 4 HOH 11 311 43 HOH HOH A . F 4 HOH 12 312 45 HOH HOH A . F 4 HOH 13 313 3 HOH HOH A . F 4 HOH 14 314 24 HOH HOH A . F 4 HOH 15 315 32 HOH HOH A . F 4 HOH 16 316 22 HOH HOH A . F 4 HOH 17 317 21 HOH HOH A . F 4 HOH 18 318 26 HOH HOH A . F 4 HOH 19 319 28 HOH HOH A . F 4 HOH 20 320 30 HOH HOH A . F 4 HOH 21 321 5 HOH HOH A . F 4 HOH 22 322 17 HOH HOH A . F 4 HOH 23 323 10 HOH HOH A . F 4 HOH 24 324 12 HOH HOH A . F 4 HOH 25 325 9 HOH HOH A . F 4 HOH 26 326 25 HOH HOH A . F 4 HOH 27 327 33 HOH HOH A . F 4 HOH 28 328 31 HOH HOH A . F 4 HOH 29 329 27 HOH HOH A . F 4 HOH 30 330 15 HOH HOH A . F 4 HOH 31 331 35 HOH HOH A . F 4 HOH 32 332 41 HOH HOH A . F 4 HOH 33 333 16 HOH HOH A . F 4 HOH 34 334 11 HOH HOH A . F 4 HOH 35 335 23 HOH HOH A . F 4 HOH 36 336 34 HOH HOH A . F 4 HOH 37 337 39 HOH HOH A . F 4 HOH 38 338 40 HOH HOH A . F 4 HOH 39 339 42 HOH HOH A . F 4 HOH 40 340 47 HOH HOH A . F 4 HOH 41 341 46 HOH HOH A . F 4 HOH 42 342 29 HOH HOH A . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E,F 2 1,2 A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 4520 ? 2 MORE -27 ? 2 'SSA (A^2)' 13330 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_465 y-1,x+1,-z -0.5000000000 0.8660254038 0.0000000000 -87.5145000000 0.8660254038 0.5000000000 0.0000000000 50.5265201330 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-01-09 2 'Structure model' 1 1 2019-02-13 3 'Structure model' 1 2 2019-12-18 4 'Structure model' 1 3 2023-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Author supporting evidence' 4 4 'Structure model' Advisory 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' pdbx_audit_support 3 4 'Structure model' chem_comp_atom 4 4 'Structure model' chem_comp_bond 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_initial_refinement_model 7 4 'Structure model' pdbx_unobs_or_zero_occ_atoms # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.year' 5 3 'Structure model' '_pdbx_audit_support.funding_organization' 6 4 'Structure model' '_database_2.pdbx_DOI' 7 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.11.1_2575)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 56 ? ? -124.66 -165.53 2 1 GLU A 73 ? ? -145.05 -158.85 3 1 ASP A 126 ? ? 51.97 -113.68 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A LYS 38 ? CE ? A LYS 38 CE 2 1 Y 0 A GLU 62 ? CD ? A GLU 62 CD 3 1 Y 0 A GLU 69 ? CD ? A GLU 69 CD 4 1 Y 0 A GLU 137 ? CD ? A GLU 137 CD # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 GOL C1 C N N 137 GOL O1 O N N 138 GOL C2 C N N 139 GOL O2 O N N 140 GOL C3 C N N 141 GOL O3 O N N 142 GOL H11 H N N 143 GOL H12 H N N 144 GOL HO1 H N N 145 GOL H2 H N N 146 GOL HO2 H N N 147 GOL H31 H N N 148 GOL H32 H N N 149 GOL HO3 H N N 150 HOH O O N N 151 HOH H1 H N N 152 HOH H2 H N N 153 ILE N N N N 154 ILE CA C N S 155 ILE C C N N 156 ILE O O N N 157 ILE CB C N S 158 ILE CG1 C N N 159 ILE CG2 C N N 160 ILE CD1 C N N 161 ILE OXT O N N 162 ILE H H N N 163 ILE H2 H N N 164 ILE HA H N N 165 ILE HB H N N 166 ILE HG12 H N N 167 ILE HG13 H N N 168 ILE HG21 H N N 169 ILE HG22 H N N 170 ILE HG23 H N N 171 ILE HD11 H N N 172 ILE HD12 H N N 173 ILE HD13 H N N 174 ILE HXT H N N 175 LEU N N N N 176 LEU CA C N S 177 LEU C C N N 178 LEU O O N N 179 LEU CB C N N 180 LEU CG C N N 181 LEU CD1 C N N 182 LEU CD2 C N N 183 LEU OXT O N N 184 LEU H H N N 185 LEU H2 H N N 186 LEU HA H N N 187 LEU HB2 H N N 188 LEU HB3 H N N 189 LEU HG H N N 190 LEU HD11 H N N 191 LEU HD12 H N N 192 LEU HD13 H N N 193 LEU HD21 H N N 194 LEU HD22 H N N 195 LEU HD23 H N N 196 LEU HXT H N N 197 LYS N N N N 198 LYS CA C N S 199 LYS C C N N 200 LYS O O N N 201 LYS CB C N N 202 LYS CG C N N 203 LYS CD C N N 204 LYS CE C N N 205 LYS NZ N N N 206 LYS OXT O N N 207 LYS H H N N 208 LYS H2 H N N 209 LYS HA H N N 210 LYS HB2 H N N 211 LYS HB3 H N N 212 LYS HG2 H N N 213 LYS HG3 H N N 214 LYS HD2 H N N 215 LYS HD3 H N N 216 LYS HE2 H N N 217 LYS HE3 H N N 218 LYS HZ1 H N N 219 LYS HZ2 H N N 220 LYS HZ3 H N N 221 LYS HXT H N N 222 MET N N N N 223 MET CA C N S 224 MET C C N N 225 MET O O N N 226 MET CB C N N 227 MET CG C N N 228 MET SD S N N 229 MET CE C N N 230 MET OXT O N N 231 MET H H N N 232 MET H2 H N N 233 MET HA H N N 234 MET HB2 H N N 235 MET HB3 H N N 236 MET HG2 H N N 237 MET HG3 H N N 238 MET HE1 H N N 239 MET HE2 H N N 240 MET HE3 H N N 241 MET HXT H N N 242 PHE N N N N 243 PHE CA C N S 244 PHE C C N N 245 PHE O O N N 246 PHE CB C N N 247 PHE CG C Y N 248 PHE CD1 C Y N 249 PHE CD2 C Y N 250 PHE CE1 C Y N 251 PHE CE2 C Y N 252 PHE CZ C Y N 253 PHE OXT O N N 254 PHE H H N N 255 PHE H2 H N N 256 PHE HA H N N 257 PHE HB2 H N N 258 PHE HB3 H N N 259 PHE HD1 H N N 260 PHE HD2 H N N 261 PHE HE1 H N N 262 PHE HE2 H N N 263 PHE HZ H N N 264 PHE HXT H N N 265 PRO N N N N 266 PRO CA C N S 267 PRO C C N N 268 PRO O O N N 269 PRO CB C N N 270 PRO CG C N N 271 PRO CD C N N 272 PRO OXT O N N 273 PRO H H N N 274 PRO HA H N N 275 PRO HB2 H N N 276 PRO HB3 H N N 277 PRO HG2 H N N 278 PRO HG3 H N N 279 PRO HD2 H N N 280 PRO HD3 H N N 281 PRO HXT H N N 282 RET C1 C N N 283 RET C2 C N N 284 RET C3 C N N 285 RET C4 C N N 286 RET C5 C N N 287 RET C6 C N N 288 RET C7 C N N 289 RET C8 C N N 290 RET C9 C N N 291 RET C10 C N N 292 RET C11 C N N 293 RET C12 C N N 294 RET C13 C N N 295 RET C14 C N N 296 RET C15 C N N 297 RET O1 O N N 298 RET C16 C N N 299 RET C17 C N N 300 RET C18 C N N 301 RET C19 C N N 302 RET C20 C N N 303 RET H21 H N N 304 RET H22 H N N 305 RET H31 H N N 306 RET H32 H N N 307 RET H41 H N N 308 RET H42 H N N 309 RET H7 H N N 310 RET H8 H N N 311 RET H10 H N N 312 RET H11 H N N 313 RET H12 H N N 314 RET H14 H N N 315 RET H15 H N N 316 RET H161 H N N 317 RET H162 H N N 318 RET H163 H N N 319 RET H171 H N N 320 RET H172 H N N 321 RET H173 H N N 322 RET H181 H N N 323 RET H182 H N N 324 RET H183 H N N 325 RET H191 H N N 326 RET H192 H N N 327 RET H193 H N N 328 RET H201 H N N 329 RET H202 H N N 330 RET H203 H N N 331 SER N N N N 332 SER CA C N S 333 SER C C N N 334 SER O O N N 335 SER CB C N N 336 SER OG O N N 337 SER OXT O N N 338 SER H H N N 339 SER H2 H N N 340 SER HA H N N 341 SER HB2 H N N 342 SER HB3 H N N 343 SER HG H N N 344 SER HXT H N N 345 THR N N N N 346 THR CA C N S 347 THR C C N N 348 THR O O N N 349 THR CB C N R 350 THR OG1 O N N 351 THR CG2 C N N 352 THR OXT O N N 353 THR H H N N 354 THR H2 H N N 355 THR HA H N N 356 THR HB H N N 357 THR HG1 H N N 358 THR HG21 H N N 359 THR HG22 H N N 360 THR HG23 H N N 361 THR HXT H N N 362 TRP N N N N 363 TRP CA C N S 364 TRP C C N N 365 TRP O O N N 366 TRP CB C N N 367 TRP CG C Y N 368 TRP CD1 C Y N 369 TRP CD2 C Y N 370 TRP NE1 N Y N 371 TRP CE2 C Y N 372 TRP CE3 C Y N 373 TRP CZ2 C Y N 374 TRP CZ3 C Y N 375 TRP CH2 C Y N 376 TRP OXT O N N 377 TRP H H N N 378 TRP H2 H N N 379 TRP HA H N N 380 TRP HB2 H N N 381 TRP HB3 H N N 382 TRP HD1 H N N 383 TRP HE1 H N N 384 TRP HE3 H N N 385 TRP HZ2 H N N 386 TRP HZ3 H N N 387 TRP HH2 H N N 388 TRP HXT H N N 389 TYR N N N N 390 TYR CA C N S 391 TYR C C N N 392 TYR O O N N 393 TYR CB C N N 394 TYR CG C Y N 395 TYR CD1 C Y N 396 TYR CD2 C Y N 397 TYR CE1 C Y N 398 TYR CE2 C Y N 399 TYR CZ C Y N 400 TYR OH O N N 401 TYR OXT O N N 402 TYR H H N N 403 TYR H2 H N N 404 TYR HA H N N 405 TYR HB2 H N N 406 TYR HB3 H N N 407 TYR HD1 H N N 408 TYR HD2 H N N 409 TYR HE1 H N N 410 TYR HE2 H N N 411 TYR HH H N N 412 TYR HXT H N N 413 VAL N N N N 414 VAL CA C N S 415 VAL C C N N 416 VAL O O N N 417 VAL CB C N N 418 VAL CG1 C N N 419 VAL CG2 C N N 420 VAL OXT O N N 421 VAL H H N N 422 VAL H2 H N N 423 VAL HA H N N 424 VAL HB H N N 425 VAL HG11 H N N 426 VAL HG12 H N N 427 VAL HG13 H N N 428 VAL HG21 H N N 429 VAL HG22 H N N 430 VAL HG23 H N N 431 VAL HXT H N N 432 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 GOL C1 O1 sing N N 129 GOL C1 C2 sing N N 130 GOL C1 H11 sing N N 131 GOL C1 H12 sing N N 132 GOL O1 HO1 sing N N 133 GOL C2 O2 sing N N 134 GOL C2 C3 sing N N 135 GOL C2 H2 sing N N 136 GOL O2 HO2 sing N N 137 GOL C3 O3 sing N N 138 GOL C3 H31 sing N N 139 GOL C3 H32 sing N N 140 GOL O3 HO3 sing N N 141 HOH O H1 sing N N 142 HOH O H2 sing N N 143 ILE N CA sing N N 144 ILE N H sing N N 145 ILE N H2 sing N N 146 ILE CA C sing N N 147 ILE CA CB sing N N 148 ILE CA HA sing N N 149 ILE C O doub N N 150 ILE C OXT sing N N 151 ILE CB CG1 sing N N 152 ILE CB CG2 sing N N 153 ILE CB HB sing N N 154 ILE CG1 CD1 sing N N 155 ILE CG1 HG12 sing N N 156 ILE CG1 HG13 sing N N 157 ILE CG2 HG21 sing N N 158 ILE CG2 HG22 sing N N 159 ILE CG2 HG23 sing N N 160 ILE CD1 HD11 sing N N 161 ILE CD1 HD12 sing N N 162 ILE CD1 HD13 sing N N 163 ILE OXT HXT sing N N 164 LEU N CA sing N N 165 LEU N H sing N N 166 LEU N H2 sing N N 167 LEU CA C sing N N 168 LEU CA CB sing N N 169 LEU CA HA sing N N 170 LEU C O doub N N 171 LEU C OXT sing N N 172 LEU CB CG sing N N 173 LEU CB HB2 sing N N 174 LEU CB HB3 sing N N 175 LEU CG CD1 sing N N 176 LEU CG CD2 sing N N 177 LEU CG HG sing N N 178 LEU CD1 HD11 sing N N 179 LEU CD1 HD12 sing N N 180 LEU CD1 HD13 sing N N 181 LEU CD2 HD21 sing N N 182 LEU CD2 HD22 sing N N 183 LEU CD2 HD23 sing N N 184 LEU OXT HXT sing N N 185 LYS N CA sing N N 186 LYS N H sing N N 187 LYS N H2 sing N N 188 LYS CA C sing N N 189 LYS CA CB sing N N 190 LYS CA HA sing N N 191 LYS C O doub N N 192 LYS C OXT sing N N 193 LYS CB CG sing N N 194 LYS CB HB2 sing N N 195 LYS CB HB3 sing N N 196 LYS CG CD sing N N 197 LYS CG HG2 sing N N 198 LYS CG HG3 sing N N 199 LYS CD CE sing N N 200 LYS CD HD2 sing N N 201 LYS CD HD3 sing N N 202 LYS CE NZ sing N N 203 LYS CE HE2 sing N N 204 LYS CE HE3 sing N N 205 LYS NZ HZ1 sing N N 206 LYS NZ HZ2 sing N N 207 LYS NZ HZ3 sing N N 208 LYS OXT HXT sing N N 209 MET N CA sing N N 210 MET N H sing N N 211 MET N H2 sing N N 212 MET CA C sing N N 213 MET CA CB sing N N 214 MET CA HA sing N N 215 MET C O doub N N 216 MET C OXT sing N N 217 MET CB CG sing N N 218 MET CB HB2 sing N N 219 MET CB HB3 sing N N 220 MET CG SD sing N N 221 MET CG HG2 sing N N 222 MET CG HG3 sing N N 223 MET SD CE sing N N 224 MET CE HE1 sing N N 225 MET CE HE2 sing N N 226 MET CE HE3 sing N N 227 MET OXT HXT sing N N 228 PHE N CA sing N N 229 PHE N H sing N N 230 PHE N H2 sing N N 231 PHE CA C sing N N 232 PHE CA CB sing N N 233 PHE CA HA sing N N 234 PHE C O doub N N 235 PHE C OXT sing N N 236 PHE CB CG sing N N 237 PHE CB HB2 sing N N 238 PHE CB HB3 sing N N 239 PHE CG CD1 doub Y N 240 PHE CG CD2 sing Y N 241 PHE CD1 CE1 sing Y N 242 PHE CD1 HD1 sing N N 243 PHE CD2 CE2 doub Y N 244 PHE CD2 HD2 sing N N 245 PHE CE1 CZ doub Y N 246 PHE CE1 HE1 sing N N 247 PHE CE2 CZ sing Y N 248 PHE CE2 HE2 sing N N 249 PHE CZ HZ sing N N 250 PHE OXT HXT sing N N 251 PRO N CA sing N N 252 PRO N CD sing N N 253 PRO N H sing N N 254 PRO CA C sing N N 255 PRO CA CB sing N N 256 PRO CA HA sing N N 257 PRO C O doub N N 258 PRO C OXT sing N N 259 PRO CB CG sing N N 260 PRO CB HB2 sing N N 261 PRO CB HB3 sing N N 262 PRO CG CD sing N N 263 PRO CG HG2 sing N N 264 PRO CG HG3 sing N N 265 PRO CD HD2 sing N N 266 PRO CD HD3 sing N N 267 PRO OXT HXT sing N N 268 RET C1 C2 sing N N 269 RET C1 C6 sing N N 270 RET C1 C16 sing N N 271 RET C1 C17 sing N N 272 RET C2 C3 sing N N 273 RET C2 H21 sing N N 274 RET C2 H22 sing N N 275 RET C3 C4 sing N N 276 RET C3 H31 sing N N 277 RET C3 H32 sing N N 278 RET C4 C5 sing N N 279 RET C4 H41 sing N N 280 RET C4 H42 sing N N 281 RET C5 C6 doub N N 282 RET C5 C18 sing N N 283 RET C6 C7 sing N N 284 RET C7 C8 doub N E 285 RET C7 H7 sing N N 286 RET C8 C9 sing N N 287 RET C8 H8 sing N N 288 RET C9 C10 doub N E 289 RET C9 C19 sing N N 290 RET C10 C11 sing N N 291 RET C10 H10 sing N N 292 RET C11 C12 doub N E 293 RET C11 H11 sing N N 294 RET C12 C13 sing N N 295 RET C12 H12 sing N N 296 RET C13 C14 doub N E 297 RET C13 C20 sing N N 298 RET C14 C15 sing N N 299 RET C14 H14 sing N N 300 RET C15 O1 doub N N 301 RET C15 H15 sing N N 302 RET C16 H161 sing N N 303 RET C16 H162 sing N N 304 RET C16 H163 sing N N 305 RET C17 H171 sing N N 306 RET C17 H172 sing N N 307 RET C17 H173 sing N N 308 RET C18 H181 sing N N 309 RET C18 H182 sing N N 310 RET C18 H183 sing N N 311 RET C19 H191 sing N N 312 RET C19 H192 sing N N 313 RET C19 H193 sing N N 314 RET C20 H201 sing N N 315 RET C20 H202 sing N N 316 RET C20 H203 sing N N 317 SER N CA sing N N 318 SER N H sing N N 319 SER N H2 sing N N 320 SER CA C sing N N 321 SER CA CB sing N N 322 SER CA HA sing N N 323 SER C O doub N N 324 SER C OXT sing N N 325 SER CB OG sing N N 326 SER CB HB2 sing N N 327 SER CB HB3 sing N N 328 SER OG HG sing N N 329 SER OXT HXT sing N N 330 THR N CA sing N N 331 THR N H sing N N 332 THR N H2 sing N N 333 THR CA C sing N N 334 THR CA CB sing N N 335 THR CA HA sing N N 336 THR C O doub N N 337 THR C OXT sing N N 338 THR CB OG1 sing N N 339 THR CB CG2 sing N N 340 THR CB HB sing N N 341 THR OG1 HG1 sing N N 342 THR CG2 HG21 sing N N 343 THR CG2 HG22 sing N N 344 THR CG2 HG23 sing N N 345 THR OXT HXT sing N N 346 TRP N CA sing N N 347 TRP N H sing N N 348 TRP N H2 sing N N 349 TRP CA C sing N N 350 TRP CA CB sing N N 351 TRP CA HA sing N N 352 TRP C O doub N N 353 TRP C OXT sing N N 354 TRP CB CG sing N N 355 TRP CB HB2 sing N N 356 TRP CB HB3 sing N N 357 TRP CG CD1 doub Y N 358 TRP CG CD2 sing Y N 359 TRP CD1 NE1 sing Y N 360 TRP CD1 HD1 sing N N 361 TRP CD2 CE2 doub Y N 362 TRP CD2 CE3 sing Y N 363 TRP NE1 CE2 sing Y N 364 TRP NE1 HE1 sing N N 365 TRP CE2 CZ2 sing Y N 366 TRP CE3 CZ3 doub Y N 367 TRP CE3 HE3 sing N N 368 TRP CZ2 CH2 doub Y N 369 TRP CZ2 HZ2 sing N N 370 TRP CZ3 CH2 sing Y N 371 TRP CZ3 HZ3 sing N N 372 TRP CH2 HH2 sing N N 373 TRP OXT HXT sing N N 374 TYR N CA sing N N 375 TYR N H sing N N 376 TYR N H2 sing N N 377 TYR CA C sing N N 378 TYR CA CB sing N N 379 TYR CA HA sing N N 380 TYR C O doub N N 381 TYR C OXT sing N N 382 TYR CB CG sing N N 383 TYR CB HB2 sing N N 384 TYR CB HB3 sing N N 385 TYR CG CD1 doub Y N 386 TYR CG CD2 sing Y N 387 TYR CD1 CE1 sing Y N 388 TYR CD1 HD1 sing N N 389 TYR CD2 CE2 doub Y N 390 TYR CD2 HD2 sing N N 391 TYR CE1 CZ doub Y N 392 TYR CE1 HE1 sing N N 393 TYR CE2 CZ sing Y N 394 TYR CE2 HE2 sing N N 395 TYR CZ OH sing N N 396 TYR OH HH sing N N 397 TYR OXT HXT sing N N 398 VAL N CA sing N N 399 VAL N H sing N N 400 VAL N H2 sing N N 401 VAL CA C sing N N 402 VAL CA CB sing N N 403 VAL CA HA sing N N 404 VAL C O doub N N 405 VAL C OXT sing N N 406 VAL CB CG1 sing N N 407 VAL CB CG2 sing N N 408 VAL CB HB sing N N 409 VAL CG1 HG11 sing N N 410 VAL CG1 HG12 sing N N 411 VAL CG1 HG13 sing N N 412 VAL CG2 HG21 sing N N 413 VAL CG2 HG22 sing N N 414 VAL CG2 HG23 sing N N 415 VAL OXT HXT sing N N 416 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Human Genome Research Institute (NIH/NHGRI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id RET _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id RET _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 RETINAL RET 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4YFP _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #