data_6MRS # _entry.id 6MRS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.319 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6MRS WWPDB D_1000236327 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6MRS _pdbx_database_status.recvd_initial_deposition_date 2018-10-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Koepnick, B.' 1 0000-0002-5792-8112 'Boykov, A.' 2 ? 'Baker, D.' 3 0000-0001-7896-6217 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nature _citation.journal_id_ASTM NATUAS _citation.journal_id_CSD 0006 _citation.journal_id_ISSN 1476-4687 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 570 _citation.language ? _citation.page_first 390 _citation.page_last 394 _citation.title 'De novo protein design by citizen scientists.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41586-019-1274-4 _citation.pdbx_database_id_PubMed 31168091 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Koepnick, B.' 1 ? primary 'Flatten, J.' 2 ? primary 'Husain, T.' 3 ? primary 'Ford, A.' 4 ? primary 'Silva, D.A.' 5 ? primary 'Bick, M.J.' 6 ? primary 'Bauer, A.' 7 ? primary 'Liu, G.' 8 ? primary 'Ishida, Y.' 9 ? primary 'Boykov, A.' 10 ? primary 'Estep, R.D.' 11 ? primary 'Kleinfelter, S.' 12 ? primary 'Norgard-Solano, T.' 13 ? primary 'Wei, L.' 14 ? primary 'Players, F.' 15 ? primary 'Montelione, G.T.' 16 ? primary 'DiMaio, F.' 17 ? primary 'Popovic, Z.' 18 ? primary 'Khatib, F.' 19 ? primary 'Cooper, S.' 20 ? primary 'Baker, D.' 21 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6MRS _cell.details ? _cell.formula_units_Z ? _cell.length_a 52.414 _cell.length_a_esd ? _cell.length_b 52.414 _cell.length_b_esd ? _cell.length_c 56.086 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6MRS _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Peak6 8749.917 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 4 ? ? ? ? 3 water nat water 18.015 89 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSGRQEKVLKSIEETVRKMGVTMETHRSGNEVKVVIKGLHESQQEQLKKDVEETSKKQGVETRIEFHGDTVTIVVRE _entity_poly.pdbx_seq_one_letter_code_can GSGRQEKVLKSIEETVRKMGVTMETHRSGNEVKVVIKGLHESQQEQLKKDVEETSKKQGVETRIEFHGDTVTIVVRE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 GLY n 1 4 ARG n 1 5 GLN n 1 6 GLU n 1 7 LYS n 1 8 VAL n 1 9 LEU n 1 10 LYS n 1 11 SER n 1 12 ILE n 1 13 GLU n 1 14 GLU n 1 15 THR n 1 16 VAL n 1 17 ARG n 1 18 LYS n 1 19 MET n 1 20 GLY n 1 21 VAL n 1 22 THR n 1 23 MET n 1 24 GLU n 1 25 THR n 1 26 HIS n 1 27 ARG n 1 28 SER n 1 29 GLY n 1 30 ASN n 1 31 GLU n 1 32 VAL n 1 33 LYS n 1 34 VAL n 1 35 VAL n 1 36 ILE n 1 37 LYS n 1 38 GLY n 1 39 LEU n 1 40 HIS n 1 41 GLU n 1 42 SER n 1 43 GLN n 1 44 GLN n 1 45 GLU n 1 46 GLN n 1 47 LEU n 1 48 LYS n 1 49 LYS n 1 50 ASP n 1 51 VAL n 1 52 GLU n 1 53 GLU n 1 54 THR n 1 55 SER n 1 56 LYS n 1 57 LYS n 1 58 GLN n 1 59 GLY n 1 60 VAL n 1 61 GLU n 1 62 THR n 1 63 ARG n 1 64 ILE n 1 65 GLU n 1 66 PHE n 1 67 HIS n 1 68 GLY n 1 69 ASP n 1 70 THR n 1 71 VAL n 1 72 THR n 1 73 ILE n 1 74 VAL n 1 75 VAL n 1 76 ARG n 1 77 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 77 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6MRS _struct_ref.pdbx_db_accession 6MRS _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6MRS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 77 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 6MRS _struct_ref_seq.db_align_beg -1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 75 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -1 _struct_ref_seq.pdbx_auth_seq_align_end 75 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6MRS _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.54 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.61 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M ammonium sulfate, 0.1 M Bis-Tris, pH 5.5, 25% w/v PEG3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-04-13 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'double-crystal Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.999989 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.2.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.999989 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.2.2 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6MRS _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.54 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12877 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.1 _reflns.pdbx_Rmerge_I_obs 0.087 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 27.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.987 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.092 _reflns.pdbx_Rpim_I_all 0.028 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.54 _reflns_shell.d_res_low 1.57 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.0 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 390 _reflns_shell.percent_possible_all 58.6 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.818 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 4.2 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared 0.430 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.917 _reflns_shell.pdbx_Rpim_I_all 0.400 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.730 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6MRS _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.541 _refine.ls_d_res_low 35.284 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12860 _refine.ls_number_reflns_R_free 1282 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.84 _refine.ls_percent_reflns_R_free 9.97 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1713 _refine.ls_R_factor_R_free 0.1975 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1682 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'Computational model generated by FoldIt software' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 20.88 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.16 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 599 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.number_atoms_solvent 89 _refine_hist.number_atoms_total 708 _refine_hist.d_res_high 1.541 _refine_hist.d_res_low 35.284 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 668 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.669 ? 905 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 17.093 ? 419 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.051 ? 105 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 116 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.5408 1.6025 . . 96 890 67.00 . . . 0.2881 . 0.2756 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6025 1.6754 . . 142 1268 96.00 . . . 0.2188 . 0.2356 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6754 1.7638 . . 139 1298 98.00 . . . 0.2148 . 0.1900 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7638 1.8743 . . 148 1337 98.00 . . . 0.1943 . 0.1838 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8743 2.0190 . . 147 1319 98.00 . . . 0.2160 . 0.1738 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0190 2.2221 . . 144 1321 99.00 . . . 0.1877 . 0.1510 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2221 2.5436 . . 149 1343 99.00 . . . 0.1571 . 0.1479 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5436 3.2043 . . 152 1367 99.00 . . . 0.1913 . 0.1644 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2043 35.2932 . . 165 1435 100.00 . . . 0.2054 . 0.1629 . . . . . . . . . . # _struct.entry_id 6MRS _struct.title 'De novo designed protein Peak6' _struct.pdbx_descriptor Peak6 _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6MRS _struct_keywords.text 'De novo protein, Foldit' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 2 ? ARG A 17 ? SER A 0 ARG A 15 1 ? 16 HELX_P HELX_P2 AA2 HIS A 40 ? GLY A 59 ? HIS A 38 GLY A 57 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 MET A 23 ? ARG A 27 ? MET A 21 ARG A 25 AA1 2 GLU A 31 ? ILE A 36 ? GLU A 29 ILE A 34 AA1 3 THR A 70 ? ARG A 76 ? THR A 68 ARG A 74 AA1 4 THR A 62 ? HIS A 67 ? THR A 60 HIS A 65 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 24 ? N GLU A 22 O VAL A 35 ? O VAL A 33 AA1 2 3 N VAL A 34 ? N VAL A 32 O ILE A 73 ? O ILE A 71 AA1 3 4 O THR A 72 ? O THR A 70 N GLU A 65 ? N GLU A 63 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 101 ? 7 'binding site for residue SO4 A 101' AC2 Software A SO4 102 ? 8 'binding site for residue SO4 A 102' AC3 Software A SO4 103 ? 2 'binding site for residue SO4 A 103' AC4 Software A SO4 104 ? 5 'binding site for residue SO4 A 104' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 LYS A 7 ? LYS A 5 . ? 1_555 ? 2 AC1 7 GLU A 41 ? GLU A 39 . ? 4_565 ? 3 AC1 7 LYS A 57 ? LYS A 55 . ? 1_555 ? 4 AC1 7 GLN A 58 ? GLN A 56 . ? 1_555 ? 5 AC1 7 HOH F . ? HOH A 205 . ? 1_555 ? 6 AC1 7 HOH F . ? HOH A 206 . ? 1_555 ? 7 AC1 7 HOH F . ? HOH A 230 . ? 5_664 ? 8 AC2 8 SER A 11 ? SER A 9 . ? 1_555 ? 9 AC2 8 THR A 54 ? THR A 52 . ? 1_555 ? 10 AC2 8 LYS A 57 ? LYS A 55 . ? 1_555 ? 11 AC2 8 GLN A 58 ? GLN A 56 . ? 1_555 ? 12 AC2 8 GLY A 68 ? GLY A 66 . ? 4_565 ? 13 AC2 8 HOH F . ? HOH A 212 . ? 1_555 ? 14 AC2 8 HOH F . ? HOH A 226 . ? 1_555 ? 15 AC2 8 HOH F . ? HOH A 264 . ? 1_555 ? 16 AC3 2 ARG A 76 ? ARG A 74 . ? 4_465 ? 17 AC3 2 ARG A 76 ? ARG A 74 . ? 1_555 ? 18 AC4 5 LYS A 37 ? LYS A 35 . ? 1_555 ? 19 AC4 5 LYS A 48 ? LYS A 46 . ? 3_454 ? 20 AC4 5 HOH F . ? HOH A 215 . ? 1_555 ? 21 AC4 5 HOH F . ? HOH A 216 . ? 1_555 ? 22 AC4 5 HOH F . ? HOH A 240 . ? 1_555 ? # _atom_sites.entry_id 6MRS _atom_sites.fract_transf_matrix[1][1] 0.019079 _atom_sites.fract_transf_matrix[1][2] 0.011015 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022030 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017830 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 -1 GLY GLY A . n A 1 2 SER 2 0 0 SER SER A . n A 1 3 GLY 3 1 1 GLY GLY A . n A 1 4 ARG 4 2 2 ARG ARG A . n A 1 5 GLN 5 3 3 GLN GLN A . n A 1 6 GLU 6 4 4 GLU GLU A . n A 1 7 LYS 7 5 5 LYS LYS A . n A 1 8 VAL 8 6 6 VAL VAL A . n A 1 9 LEU 9 7 7 LEU LEU A . n A 1 10 LYS 10 8 8 LYS LYS A . n A 1 11 SER 11 9 9 SER SER A . n A 1 12 ILE 12 10 10 ILE ILE A . n A 1 13 GLU 13 11 11 GLU GLU A . n A 1 14 GLU 14 12 12 GLU GLU A . n A 1 15 THR 15 13 13 THR THR A . n A 1 16 VAL 16 14 14 VAL VAL A . n A 1 17 ARG 17 15 15 ARG ARG A . n A 1 18 LYS 18 16 16 LYS LYS A . n A 1 19 MET 19 17 17 MET MET A . n A 1 20 GLY 20 18 18 GLY GLY A . n A 1 21 VAL 21 19 19 VAL VAL A . n A 1 22 THR 22 20 20 THR THR A . n A 1 23 MET 23 21 21 MET MET A . n A 1 24 GLU 24 22 22 GLU GLU A . n A 1 25 THR 25 23 23 THR THR A . n A 1 26 HIS 26 24 24 HIS HIS A . n A 1 27 ARG 27 25 25 ARG ARG A . n A 1 28 SER 28 26 26 SER SER A . n A 1 29 GLY 29 27 27 GLY GLY A . n A 1 30 ASN 30 28 28 ASN ASN A . n A 1 31 GLU 31 29 29 GLU GLU A . n A 1 32 VAL 32 30 30 VAL VAL A . n A 1 33 LYS 33 31 31 LYS LYS A . n A 1 34 VAL 34 32 32 VAL VAL A . n A 1 35 VAL 35 33 33 VAL VAL A . n A 1 36 ILE 36 34 34 ILE ILE A . n A 1 37 LYS 37 35 35 LYS LYS A . n A 1 38 GLY 38 36 36 GLY GLY A . n A 1 39 LEU 39 37 37 LEU LEU A . n A 1 40 HIS 40 38 38 HIS HIS A . n A 1 41 GLU 41 39 39 GLU GLU A . n A 1 42 SER 42 40 40 SER SER A . n A 1 43 GLN 43 41 41 GLN GLN A . n A 1 44 GLN 44 42 42 GLN GLN A . n A 1 45 GLU 45 43 43 GLU GLU A . n A 1 46 GLN 46 44 44 GLN GLN A . n A 1 47 LEU 47 45 45 LEU LEU A . n A 1 48 LYS 48 46 46 LYS LYS A . n A 1 49 LYS 49 47 47 LYS LYS A . n A 1 50 ASP 50 48 48 ASP ASP A . n A 1 51 VAL 51 49 49 VAL VAL A . n A 1 52 GLU 52 50 50 GLU GLU A . n A 1 53 GLU 53 51 51 GLU GLU A . n A 1 54 THR 54 52 52 THR THR A . n A 1 55 SER 55 53 53 SER SER A . n A 1 56 LYS 56 54 54 LYS LYS A . n A 1 57 LYS 57 55 55 LYS LYS A . n A 1 58 GLN 58 56 56 GLN GLN A . n A 1 59 GLY 59 57 57 GLY GLY A . n A 1 60 VAL 60 58 58 VAL VAL A . n A 1 61 GLU 61 59 59 GLU GLU A . n A 1 62 THR 62 60 60 THR THR A . n A 1 63 ARG 63 61 61 ARG ARG A . n A 1 64 ILE 64 62 62 ILE ILE A . n A 1 65 GLU 65 63 63 GLU GLU A . n A 1 66 PHE 66 64 64 PHE PHE A . n A 1 67 HIS 67 65 65 HIS HIS A . n A 1 68 GLY 68 66 66 GLY GLY A . n A 1 69 ASP 69 67 67 ASP ASP A . n A 1 70 THR 70 68 68 THR THR A . n A 1 71 VAL 71 69 69 VAL VAL A . n A 1 72 THR 72 70 70 THR THR A . n A 1 73 ILE 73 71 71 ILE ILE A . n A 1 74 VAL 74 72 72 VAL VAL A . n A 1 75 VAL 75 73 73 VAL VAL A . n A 1 76 ARG 76 74 74 ARG ARG A . n A 1 77 GLU 77 75 75 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 101 1 SO4 SO4 A . C 2 SO4 1 102 2 SO4 SO4 A . D 2 SO4 1 103 3 SO4 SO4 A . E 2 SO4 1 104 4 SO4 SO4 A . F 3 HOH 1 201 76 HOH HOH A . F 3 HOH 2 202 57 HOH HOH A . F 3 HOH 3 203 32 HOH HOH A . F 3 HOH 4 204 74 HOH HOH A . F 3 HOH 5 205 41 HOH HOH A . F 3 HOH 6 206 71 HOH HOH A . F 3 HOH 7 207 4 HOH HOH A . F 3 HOH 8 208 17 HOH HOH A . F 3 HOH 9 209 72 HOH HOH A . F 3 HOH 10 210 34 HOH HOH A . F 3 HOH 11 211 78 HOH HOH A . F 3 HOH 12 212 6 HOH HOH A . F 3 HOH 13 213 13 HOH HOH A . F 3 HOH 14 214 29 HOH HOH A . F 3 HOH 15 215 19 HOH HOH A . F 3 HOH 16 216 65 HOH HOH A . F 3 HOH 17 217 16 HOH HOH A . F 3 HOH 18 218 36 HOH HOH A . F 3 HOH 19 219 15 HOH HOH A . F 3 HOH 20 220 42 HOH HOH A . F 3 HOH 21 221 14 HOH HOH A . F 3 HOH 22 222 31 HOH HOH A . F 3 HOH 23 223 22 HOH HOH A . F 3 HOH 24 224 48 HOH HOH A . F 3 HOH 25 225 49 HOH HOH A . F 3 HOH 26 226 75 HOH HOH A . F 3 HOH 27 227 23 HOH HOH A . F 3 HOH 28 228 25 HOH HOH A . F 3 HOH 29 229 2 HOH HOH A . F 3 HOH 30 230 51 HOH HOH A . F 3 HOH 31 231 94 HOH HOH A . F 3 HOH 32 232 1 HOH HOH A . F 3 HOH 33 233 12 HOH HOH A . F 3 HOH 34 234 3 HOH HOH A . F 3 HOH 35 235 24 HOH HOH A . F 3 HOH 36 236 9 HOH HOH A . F 3 HOH 37 237 8 HOH HOH A . F 3 HOH 38 238 7 HOH HOH A . F 3 HOH 39 239 5 HOH HOH A . F 3 HOH 40 240 37 HOH HOH A . F 3 HOH 41 241 35 HOH HOH A . F 3 HOH 42 242 85 HOH HOH A . F 3 HOH 43 243 20 HOH HOH A . F 3 HOH 44 244 10 HOH HOH A . F 3 HOH 45 245 26 HOH HOH A . F 3 HOH 46 246 39 HOH HOH A . F 3 HOH 47 247 11 HOH HOH A . F 3 HOH 48 248 43 HOH HOH A . F 3 HOH 49 249 45 HOH HOH A . F 3 HOH 50 250 77 HOH HOH A . F 3 HOH 51 251 30 HOH HOH A . F 3 HOH 52 252 83 HOH HOH A . F 3 HOH 53 253 53 HOH HOH A . F 3 HOH 54 254 61 HOH HOH A . F 3 HOH 55 255 44 HOH HOH A . F 3 HOH 56 256 28 HOH HOH A . F 3 HOH 57 257 70 HOH HOH A . F 3 HOH 58 258 38 HOH HOH A . F 3 HOH 59 259 69 HOH HOH A . F 3 HOH 60 260 93 HOH HOH A . F 3 HOH 61 261 90 HOH HOH A . F 3 HOH 62 262 18 HOH HOH A . F 3 HOH 63 263 60 HOH HOH A . F 3 HOH 64 264 56 HOH HOH A . F 3 HOH 65 265 47 HOH HOH A . F 3 HOH 66 266 59 HOH HOH A . F 3 HOH 67 267 50 HOH HOH A . F 3 HOH 68 268 46 HOH HOH A . F 3 HOH 69 269 27 HOH HOH A . F 3 HOH 70 270 67 HOH HOH A . F 3 HOH 71 271 89 HOH HOH A . F 3 HOH 72 272 63 HOH HOH A . F 3 HOH 73 273 62 HOH HOH A . F 3 HOH 74 274 21 HOH HOH A . F 3 HOH 75 275 82 HOH HOH A . F 3 HOH 76 276 58 HOH HOH A . F 3 HOH 77 277 68 HOH HOH A . F 3 HOH 78 278 54 HOH HOH A . F 3 HOH 79 279 91 HOH HOH A . F 3 HOH 80 280 40 HOH HOH A . F 3 HOH 81 281 73 HOH HOH A . F 3 HOH 82 282 55 HOH HOH A . F 3 HOH 83 283 33 HOH HOH A . F 3 HOH 84 284 92 HOH HOH A . F 3 HOH 85 285 52 HOH HOH A . F 3 HOH 86 286 66 HOH HOH A . F 3 HOH 87 287 88 HOH HOH A . F 3 HOH 88 288 81 HOH HOH A . F 3 HOH 89 289 64 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 580 ? 1 MORE -38 ? 1 'SSA (A^2)' 4820 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A SO4 103 ? D SO4 . 2 1 A SO4 103 ? D SO4 . 3 1 A HOH 285 ? F HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-06-12 2 'Structure model' 1 1 2019-06-19 3 'Structure model' 1 2 2019-06-26 4 'Structure model' 1 3 2019-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Author supporting evidence' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' pdbx_audit_support # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 3 'Structure model' '_citation.journal_volume' 10 3 'Structure model' '_citation.page_first' 11 3 'Structure model' '_citation.page_last' 12 4 'Structure model' '_pdbx_audit_support.funding_organization' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -19.5547 23.1687 -9.2975 0.2038 0.1956 0.1539 -0.0390 -0.0352 0.0274 3.0423 7.4267 2.3467 -2.5988 -0.4732 0.8432 -0.1665 0.1186 0.1775 -0.3069 0.0843 0.0857 -0.2317 0.1714 -0.0091 'X-RAY DIFFRACTION' 2 ? refined -24.5106 14.3140 -9.4507 0.1485 0.1129 0.1107 0.0148 -0.0078 -0.0127 2.7793 2.9191 1.6219 -1.3096 0.8856 -0.6619 0.0117 0.1775 0.0956 -0.1873 -0.1194 -0.0386 0.0225 -0.0138 -0.0292 'X-RAY DIFFRACTION' 3 ? refined -21.3916 17.8415 -0.1100 0.1353 0.1174 0.1052 -0.0174 0.0127 -0.0071 1.6204 2.8887 0.8647 0.9171 0.8139 -0.2490 0.0009 0.0285 0.1090 -0.0429 -0.0625 -0.0143 -0.0088 0.0355 -0.0067 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid -1 through 14 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 15 through 38 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 39 through 75 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.13_2998: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? v715 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? v715 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.2. 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 N _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLY _pdbx_validate_close_contact.auth_seq_id_1 -1 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OE1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GLU _pdbx_validate_close_contact.auth_seq_id_2 75 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.16 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O1 A SO4 103 ? ? 1_555 O4 A SO4 103 ? ? 4_465 1.06 2 1 S A SO4 103 ? ? 1_555 O1 A SO4 103 ? ? 4_465 1.46 3 1 S A SO4 103 ? ? 1_555 O4 A SO4 103 ? ? 4_465 1.46 4 1 S A SO4 103 ? ? 1_555 O2 A SO4 103 ? ? 4_465 1.47 5 1 O2 A SO4 103 ? ? 1_555 O4 A SO4 103 ? ? 4_465 1.62 6 1 O1 A SO4 103 ? ? 1_555 O2 A SO4 103 ? ? 4_465 1.69 7 1 O2 A SO4 103 ? ? 1_555 O3 A SO4 103 ? ? 4_465 2.07 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id LYS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 16 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 79.26 _pdbx_validate_torsion.psi -4.60 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 8 ? CD ? A LYS 10 CD 2 1 Y 1 A LYS 8 ? CE ? A LYS 10 CE 3 1 Y 1 A LYS 8 ? NZ ? A LYS 10 NZ 4 1 Y 1 A LYS 16 ? CG ? A LYS 18 CG 5 1 Y 1 A LYS 16 ? CD ? A LYS 18 CD 6 1 Y 1 A LYS 16 ? CE ? A LYS 18 CE 7 1 Y 1 A LYS 16 ? NZ ? A LYS 18 NZ 8 1 Y 1 A ASN 28 ? OD1 ? A ASN 30 OD1 9 1 Y 1 A ASN 28 ? ND2 ? A ASN 30 ND2 10 1 Y 1 A GLU 63 ? CD ? A GLU 65 CD 11 1 Y 1 A GLU 63 ? OE1 ? A GLU 65 OE1 12 1 Y 1 A GLU 63 ? OE2 ? A GLU 65 OE2 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Howard Hughes Medical Institute (HHMI)' 'United States' ? 1 'National Science Foundation (NSF, United States)' 'United States' DGE-1256082 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'Protein elutes as a monodisperse peak at the expected volume.' #