data_6MRS # _entry.id 6MRS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6MRS pdb_00006mrs 10.2210/pdb6mrs/pdb WWPDB D_1000236327 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-06-12 2 'Structure model' 1 1 2019-06-19 3 'Structure model' 1 2 2019-06-26 4 'Structure model' 1 3 2019-11-20 5 'Structure model' 1 4 2024-03-13 6 'Structure model' 1 5 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Author supporting evidence' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 6 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' pdbx_audit_support 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 8 6 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 3 'Structure model' '_citation.journal_volume' 10 3 'Structure model' '_citation.page_first' 11 3 'Structure model' '_citation.page_last' 12 4 'Structure model' '_pdbx_audit_support.funding_organization' 13 5 'Structure model' '_database_2.pdbx_DOI' 14 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6MRS _pdbx_database_status.recvd_initial_deposition_date 2018-10-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Koepnick, B.' 1 0000-0002-5792-8112 'Boykov, A.' 2 ? 'Baker, D.' 3 0000-0001-7896-6217 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nature _citation.journal_id_ASTM NATUAS _citation.journal_id_CSD 0006 _citation.journal_id_ISSN 1476-4687 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 570 _citation.language ? _citation.page_first 390 _citation.page_last 394 _citation.title 'De novo protein design by citizen scientists.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41586-019-1274-4 _citation.pdbx_database_id_PubMed 31168091 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Koepnick, B.' 1 ? primary 'Flatten, J.' 2 ? primary 'Husain, T.' 3 ? primary 'Ford, A.' 4 ? primary 'Silva, D.A.' 5 ? primary 'Bick, M.J.' 6 ? primary 'Bauer, A.' 7 ? primary 'Liu, G.' 8 ? primary 'Ishida, Y.' 9 ? primary 'Boykov, A.' 10 ? primary 'Estep, R.D.' 11 ? primary 'Kleinfelter, S.' 12 ? primary 'Norgard-Solano, T.' 13 ? primary 'Wei, L.' 14 ? primary 'Players, F.' 15 ? primary 'Montelione, G.T.' 16 ? primary 'DiMaio, F.' 17 ? primary 'Popovic, Z.' 18 ? primary 'Khatib, F.' 19 ? primary 'Cooper, S.' 20 ? primary 'Baker, D.' 21 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Peak6 8749.917 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 4 ? ? ? ? 3 water nat water 18.015 89 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSGRQEKVLKSIEETVRKMGVTMETHRSGNEVKVVIKGLHESQQEQLKKDVEETSKKQGVETRIEFHGDTVTIVVRE _entity_poly.pdbx_seq_one_letter_code_can GSGRQEKVLKSIEETVRKMGVTMETHRSGNEVKVVIKGLHESQQEQLKKDVEETSKKQGVETRIEFHGDTVTIVVRE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 GLY n 1 4 ARG n 1 5 GLN n 1 6 GLU n 1 7 LYS n 1 8 VAL n 1 9 LEU n 1 10 LYS n 1 11 SER n 1 12 ILE n 1 13 GLU n 1 14 GLU n 1 15 THR n 1 16 VAL n 1 17 ARG n 1 18 LYS n 1 19 MET n 1 20 GLY n 1 21 VAL n 1 22 THR n 1 23 MET n 1 24 GLU n 1 25 THR n 1 26 HIS n 1 27 ARG n 1 28 SER n 1 29 GLY n 1 30 ASN n 1 31 GLU n 1 32 VAL n 1 33 LYS n 1 34 VAL n 1 35 VAL n 1 36 ILE n 1 37 LYS n 1 38 GLY n 1 39 LEU n 1 40 HIS n 1 41 GLU n 1 42 SER n 1 43 GLN n 1 44 GLN n 1 45 GLU n 1 46 GLN n 1 47 LEU n 1 48 LYS n 1 49 LYS n 1 50 ASP n 1 51 VAL n 1 52 GLU n 1 53 GLU n 1 54 THR n 1 55 SER n 1 56 LYS n 1 57 LYS n 1 58 GLN n 1 59 GLY n 1 60 VAL n 1 61 GLU n 1 62 THR n 1 63 ARG n 1 64 ILE n 1 65 GLU n 1 66 PHE n 1 67 HIS n 1 68 GLY n 1 69 ASP n 1 70 THR n 1 71 VAL n 1 72 THR n 1 73 ILE n 1 74 VAL n 1 75 VAL n 1 76 ARG n 1 77 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 77 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 -1 GLY GLY A . n A 1 2 SER 2 0 0 SER SER A . n A 1 3 GLY 3 1 1 GLY GLY A . n A 1 4 ARG 4 2 2 ARG ARG A . n A 1 5 GLN 5 3 3 GLN GLN A . n A 1 6 GLU 6 4 4 GLU GLU A . n A 1 7 LYS 7 5 5 LYS LYS A . n A 1 8 VAL 8 6 6 VAL VAL A . n A 1 9 LEU 9 7 7 LEU LEU A . n A 1 10 LYS 10 8 8 LYS LYS A . n A 1 11 SER 11 9 9 SER SER A . n A 1 12 ILE 12 10 10 ILE ILE A . n A 1 13 GLU 13 11 11 GLU GLU A . n A 1 14 GLU 14 12 12 GLU GLU A . n A 1 15 THR 15 13 13 THR THR A . n A 1 16 VAL 16 14 14 VAL VAL A . n A 1 17 ARG 17 15 15 ARG ARG A . n A 1 18 LYS 18 16 16 LYS LYS A . n A 1 19 MET 19 17 17 MET MET A . n A 1 20 GLY 20 18 18 GLY GLY A . n A 1 21 VAL 21 19 19 VAL VAL A . n A 1 22 THR 22 20 20 THR THR A . n A 1 23 MET 23 21 21 MET MET A . n A 1 24 GLU 24 22 22 GLU GLU A . n A 1 25 THR 25 23 23 THR THR A . n A 1 26 HIS 26 24 24 HIS HIS A . n A 1 27 ARG 27 25 25 ARG ARG A . n A 1 28 SER 28 26 26 SER SER A . n A 1 29 GLY 29 27 27 GLY GLY A . n A 1 30 ASN 30 28 28 ASN ASN A . n A 1 31 GLU 31 29 29 GLU GLU A . n A 1 32 VAL 32 30 30 VAL VAL A . n A 1 33 LYS 33 31 31 LYS LYS A . n A 1 34 VAL 34 32 32 VAL VAL A . n A 1 35 VAL 35 33 33 VAL VAL A . n A 1 36 ILE 36 34 34 ILE ILE A . n A 1 37 LYS 37 35 35 LYS LYS A . n A 1 38 GLY 38 36 36 GLY GLY A . n A 1 39 LEU 39 37 37 LEU LEU A . n A 1 40 HIS 40 38 38 HIS HIS A . n A 1 41 GLU 41 39 39 GLU GLU A . n A 1 42 SER 42 40 40 SER SER A . n A 1 43 GLN 43 41 41 GLN GLN A . n A 1 44 GLN 44 42 42 GLN GLN A . n A 1 45 GLU 45 43 43 GLU GLU A . n A 1 46 GLN 46 44 44 GLN GLN A . n A 1 47 LEU 47 45 45 LEU LEU A . n A 1 48 LYS 48 46 46 LYS LYS A . n A 1 49 LYS 49 47 47 LYS LYS A . n A 1 50 ASP 50 48 48 ASP ASP A . n A 1 51 VAL 51 49 49 VAL VAL A . n A 1 52 GLU 52 50 50 GLU GLU A . n A 1 53 GLU 53 51 51 GLU GLU A . n A 1 54 THR 54 52 52 THR THR A . n A 1 55 SER 55 53 53 SER SER A . n A 1 56 LYS 56 54 54 LYS LYS A . n A 1 57 LYS 57 55 55 LYS LYS A . n A 1 58 GLN 58 56 56 GLN GLN A . n A 1 59 GLY 59 57 57 GLY GLY A . n A 1 60 VAL 60 58 58 VAL VAL A . n A 1 61 GLU 61 59 59 GLU GLU A . n A 1 62 THR 62 60 60 THR THR A . n A 1 63 ARG 63 61 61 ARG ARG A . n A 1 64 ILE 64 62 62 ILE ILE A . n A 1 65 GLU 65 63 63 GLU GLU A . n A 1 66 PHE 66 64 64 PHE PHE A . n A 1 67 HIS 67 65 65 HIS HIS A . n A 1 68 GLY 68 66 66 GLY GLY A . n A 1 69 ASP 69 67 67 ASP ASP A . n A 1 70 THR 70 68 68 THR THR A . n A 1 71 VAL 71 69 69 VAL VAL A . n A 1 72 THR 72 70 70 THR THR A . n A 1 73 ILE 73 71 71 ILE ILE A . n A 1 74 VAL 74 72 72 VAL VAL A . n A 1 75 VAL 75 73 73 VAL VAL A . n A 1 76 ARG 76 74 74 ARG ARG A . n A 1 77 GLU 77 75 75 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 101 1 SO4 SO4 A . C 2 SO4 1 102 2 SO4 SO4 A . D 2 SO4 1 103 3 SO4 SO4 A . E 2 SO4 1 104 4 SO4 SO4 A . F 3 HOH 1 201 76 HOH HOH A . F 3 HOH 2 202 57 HOH HOH A . F 3 HOH 3 203 32 HOH HOH A . F 3 HOH 4 204 74 HOH HOH A . F 3 HOH 5 205 41 HOH HOH A . F 3 HOH 6 206 71 HOH HOH A . F 3 HOH 7 207 4 HOH HOH A . F 3 HOH 8 208 17 HOH HOH A . F 3 HOH 9 209 72 HOH HOH A . F 3 HOH 10 210 34 HOH HOH A . F 3 HOH 11 211 78 HOH HOH A . F 3 HOH 12 212 6 HOH HOH A . F 3 HOH 13 213 13 HOH HOH A . F 3 HOH 14 214 29 HOH HOH A . F 3 HOH 15 215 19 HOH HOH A . F 3 HOH 16 216 65 HOH HOH A . F 3 HOH 17 217 16 HOH HOH A . F 3 HOH 18 218 36 HOH HOH A . F 3 HOH 19 219 15 HOH HOH A . F 3 HOH 20 220 42 HOH HOH A . F 3 HOH 21 221 14 HOH HOH A . F 3 HOH 22 222 31 HOH HOH A . F 3 HOH 23 223 22 HOH HOH A . F 3 HOH 24 224 48 HOH HOH A . F 3 HOH 25 225 49 HOH HOH A . F 3 HOH 26 226 75 HOH HOH A . F 3 HOH 27 227 23 HOH HOH A . F 3 HOH 28 228 25 HOH HOH A . F 3 HOH 29 229 2 HOH HOH A . F 3 HOH 30 230 51 HOH HOH A . F 3 HOH 31 231 94 HOH HOH A . F 3 HOH 32 232 1 HOH HOH A . F 3 HOH 33 233 12 HOH HOH A . F 3 HOH 34 234 3 HOH HOH A . F 3 HOH 35 235 24 HOH HOH A . F 3 HOH 36 236 9 HOH HOH A . F 3 HOH 37 237 8 HOH HOH A . F 3 HOH 38 238 7 HOH HOH A . F 3 HOH 39 239 5 HOH HOH A . F 3 HOH 40 240 37 HOH HOH A . F 3 HOH 41 241 35 HOH HOH A . F 3 HOH 42 242 85 HOH HOH A . F 3 HOH 43 243 20 HOH HOH A . F 3 HOH 44 244 10 HOH HOH A . F 3 HOH 45 245 26 HOH HOH A . F 3 HOH 46 246 39 HOH HOH A . F 3 HOH 47 247 11 HOH HOH A . F 3 HOH 48 248 43 HOH HOH A . F 3 HOH 49 249 45 HOH HOH A . F 3 HOH 50 250 77 HOH HOH A . F 3 HOH 51 251 30 HOH HOH A . F 3 HOH 52 252 83 HOH HOH A . F 3 HOH 53 253 53 HOH HOH A . F 3 HOH 54 254 61 HOH HOH A . F 3 HOH 55 255 44 HOH HOH A . F 3 HOH 56 256 28 HOH HOH A . F 3 HOH 57 257 70 HOH HOH A . F 3 HOH 58 258 38 HOH HOH A . F 3 HOH 59 259 69 HOH HOH A . F 3 HOH 60 260 93 HOH HOH A . F 3 HOH 61 261 90 HOH HOH A . F 3 HOH 62 262 18 HOH HOH A . F 3 HOH 63 263 60 HOH HOH A . F 3 HOH 64 264 56 HOH HOH A . F 3 HOH 65 265 47 HOH HOH A . F 3 HOH 66 266 59 HOH HOH A . F 3 HOH 67 267 50 HOH HOH A . F 3 HOH 68 268 46 HOH HOH A . F 3 HOH 69 269 27 HOH HOH A . F 3 HOH 70 270 67 HOH HOH A . F 3 HOH 71 271 89 HOH HOH A . F 3 HOH 72 272 63 HOH HOH A . F 3 HOH 73 273 62 HOH HOH A . F 3 HOH 74 274 21 HOH HOH A . F 3 HOH 75 275 82 HOH HOH A . F 3 HOH 76 276 58 HOH HOH A . F 3 HOH 77 277 68 HOH HOH A . F 3 HOH 78 278 54 HOH HOH A . F 3 HOH 79 279 91 HOH HOH A . F 3 HOH 80 280 40 HOH HOH A . F 3 HOH 81 281 73 HOH HOH A . F 3 HOH 82 282 55 HOH HOH A . F 3 HOH 83 283 33 HOH HOH A . F 3 HOH 84 284 92 HOH HOH A . F 3 HOH 85 285 52 HOH HOH A . F 3 HOH 86 286 66 HOH HOH A . F 3 HOH 87 287 88 HOH HOH A . F 3 HOH 88 288 81 HOH HOH A . F 3 HOH 89 289 64 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 8 ? CD ? A LYS 10 CD 2 1 Y 1 A LYS 8 ? CE ? A LYS 10 CE 3 1 Y 1 A LYS 8 ? NZ ? A LYS 10 NZ 4 1 Y 1 A LYS 16 ? CG ? A LYS 18 CG 5 1 Y 1 A LYS 16 ? CD ? A LYS 18 CD 6 1 Y 1 A LYS 16 ? CE ? A LYS 18 CE 7 1 Y 1 A LYS 16 ? NZ ? A LYS 18 NZ 8 1 Y 1 A ASN 28 ? OD1 ? A ASN 30 OD1 9 1 Y 1 A ASN 28 ? ND2 ? A ASN 30 ND2 10 1 Y 1 A GLU 63 ? CD ? A GLU 65 CD 11 1 Y 1 A GLU 63 ? OE1 ? A GLU 65 OE1 12 1 Y 1 A GLU 63 ? OE2 ? A GLU 65 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.13_2998: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? v715 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? v715 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.2. 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6MRS _cell.details ? _cell.formula_units_Z ? _cell.length_a 52.414 _cell.length_a_esd ? _cell.length_b 52.414 _cell.length_b_esd ? _cell.length_c 56.086 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6MRS _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6MRS _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.54 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.61 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M ammonium sulfate, 0.1 M Bis-Tris, pH 5.5, 25% w/v PEG3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-04-13 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'double-crystal Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.999989 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.2.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.999989 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.2.2 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6MRS _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.54 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12877 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.1 _reflns.pdbx_Rmerge_I_obs 0.087 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 27.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.987 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.092 _reflns.pdbx_Rpim_I_all 0.028 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.54 _reflns_shell.d_res_low 1.57 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.0 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 390 _reflns_shell.percent_possible_all 58.6 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.818 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 4.2 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared 0.430 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.917 _reflns_shell.pdbx_Rpim_I_all 0.400 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.730 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6MRS _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.541 _refine.ls_d_res_low 35.284 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12860 _refine.ls_number_reflns_R_free 1282 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.84 _refine.ls_percent_reflns_R_free 9.97 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1713 _refine.ls_R_factor_R_free 0.1975 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1682 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'Computational model generated by FoldIt software' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 20.88 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.16 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 599 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.number_atoms_solvent 89 _refine_hist.number_atoms_total 708 _refine_hist.d_res_high 1.541 _refine_hist.d_res_low 35.284 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 668 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.669 ? 905 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 17.093 ? 419 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.051 ? 105 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 116 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.5408 1.6025 . . 96 890 67.00 . . . 0.2881 . 0.2756 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6025 1.6754 . . 142 1268 96.00 . . . 0.2188 . 0.2356 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6754 1.7638 . . 139 1298 98.00 . . . 0.2148 . 0.1900 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7638 1.8743 . . 148 1337 98.00 . . . 0.1943 . 0.1838 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8743 2.0190 . . 147 1319 98.00 . . . 0.2160 . 0.1738 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0190 2.2221 . . 144 1321 99.00 . . . 0.1877 . 0.1510 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2221 2.5436 . . 149 1343 99.00 . . . 0.1571 . 0.1479 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5436 3.2043 . . 152 1367 99.00 . . . 0.1913 . 0.1644 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2043 35.2932 . . 165 1435 100.00 . . . 0.2054 . 0.1629 . . . . . . . . . . # _struct.entry_id 6MRS _struct.title 'De novo designed protein Peak6' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6MRS _struct_keywords.text 'De novo protein, Foldit' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6MRS _struct_ref.pdbx_db_accession 6MRS _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6MRS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 77 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 6MRS _struct_ref_seq.db_align_beg -1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 75 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -1 _struct_ref_seq.pdbx_auth_seq_align_end 75 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 580 ? 1 MORE -38 ? 1 'SSA (A^2)' 4820 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'Protein elutes as a monodisperse peak at the expected volume.' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 2 ? ARG A 17 ? SER A 0 ARG A 15 1 ? 16 HELX_P HELX_P2 AA2 HIS A 40 ? GLY A 59 ? HIS A 38 GLY A 57 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 MET A 23 ? ARG A 27 ? MET A 21 ARG A 25 AA1 2 GLU A 31 ? ILE A 36 ? GLU A 29 ILE A 34 AA1 3 THR A 70 ? ARG A 76 ? THR A 68 ARG A 74 AA1 4 THR A 62 ? HIS A 67 ? THR A 60 HIS A 65 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 24 ? N GLU A 22 O VAL A 35 ? O VAL A 33 AA1 2 3 N VAL A 34 ? N VAL A 32 O ILE A 73 ? O ILE A 71 AA1 3 4 O THR A 72 ? O THR A 70 N GLU A 65 ? N GLU A 63 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 101 ? 7 'binding site for residue SO4 A 101' AC2 Software A SO4 102 ? 8 'binding site for residue SO4 A 102' AC3 Software A SO4 103 ? 2 'binding site for residue SO4 A 103' AC4 Software A SO4 104 ? 5 'binding site for residue SO4 A 104' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 LYS A 7 ? LYS A 5 . ? 1_555 ? 2 AC1 7 GLU A 41 ? GLU A 39 . ? 4_565 ? 3 AC1 7 LYS A 57 ? LYS A 55 . ? 1_555 ? 4 AC1 7 GLN A 58 ? GLN A 56 . ? 1_555 ? 5 AC1 7 HOH F . ? HOH A 205 . ? 1_555 ? 6 AC1 7 HOH F . ? HOH A 206 . ? 1_555 ? 7 AC1 7 HOH F . ? HOH A 230 . ? 5_664 ? 8 AC2 8 SER A 11 ? SER A 9 . ? 1_555 ? 9 AC2 8 THR A 54 ? THR A 52 . ? 1_555 ? 10 AC2 8 LYS A 57 ? LYS A 55 . ? 1_555 ? 11 AC2 8 GLN A 58 ? GLN A 56 . ? 1_555 ? 12 AC2 8 GLY A 68 ? GLY A 66 . ? 4_565 ? 13 AC2 8 HOH F . ? HOH A 212 . ? 1_555 ? 14 AC2 8 HOH F . ? HOH A 226 . ? 1_555 ? 15 AC2 8 HOH F . ? HOH A 264 . ? 1_555 ? 16 AC3 2 ARG A 76 ? ARG A 74 . ? 4_465 ? 17 AC3 2 ARG A 76 ? ARG A 74 . ? 1_555 ? 18 AC4 5 LYS A 37 ? LYS A 35 . ? 1_555 ? 19 AC4 5 LYS A 48 ? LYS A 46 . ? 3_454 ? 20 AC4 5 HOH F . ? HOH A 215 . ? 1_555 ? 21 AC4 5 HOH F . ? HOH A 216 . ? 1_555 ? 22 AC4 5 HOH F . ? HOH A 240 . ? 1_555 ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 N _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLY _pdbx_validate_close_contact.auth_seq_id_1 -1 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OE1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GLU _pdbx_validate_close_contact.auth_seq_id_2 75 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.16 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O1 A SO4 103 ? ? 1_555 O4 A SO4 103 ? ? 4_465 1.06 2 1 S A SO4 103 ? ? 1_555 O1 A SO4 103 ? ? 4_465 1.46 3 1 S A SO4 103 ? ? 1_555 O4 A SO4 103 ? ? 4_465 1.46 4 1 S A SO4 103 ? ? 1_555 O2 A SO4 103 ? ? 4_465 1.47 5 1 O2 A SO4 103 ? ? 1_555 O4 A SO4 103 ? ? 4_465 1.62 6 1 O1 A SO4 103 ? ? 1_555 O2 A SO4 103 ? ? 4_465 1.69 7 1 O2 A SO4 103 ? ? 1_555 O3 A SO4 103 ? ? 4_465 2.07 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id LYS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 16 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 79.26 _pdbx_validate_torsion.psi -4.60 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A SO4 103 ? D SO4 . 2 1 A SO4 103 ? D SO4 . 3 1 A HOH 285 ? F HOH . # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -19.5547 23.1687 -9.2975 0.2038 0.1956 0.1539 -0.0390 -0.0352 0.0274 3.0423 7.4267 2.3467 -2.5988 -0.4732 0.8432 -0.1665 0.1186 0.1775 -0.3069 0.0843 0.0857 -0.2317 0.1714 -0.0091 'X-RAY DIFFRACTION' 2 ? refined -24.5106 14.3140 -9.4507 0.1485 0.1129 0.1107 0.0148 -0.0078 -0.0127 2.7793 2.9191 1.6219 -1.3096 0.8856 -0.6619 0.0117 0.1775 0.0956 -0.1873 -0.1194 -0.0386 0.0225 -0.0138 -0.0292 'X-RAY DIFFRACTION' 3 ? refined -21.3916 17.8415 -0.1100 0.1353 0.1174 0.1052 -0.0174 0.0127 -0.0071 1.6204 2.8887 0.8647 0.9171 0.8139 -0.2490 0.0009 0.0285 0.1090 -0.0429 -0.0625 -0.0143 -0.0088 0.0355 -0.0067 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid -1 through 14 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 15 through 38 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 39 through 75 ) ; # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 ASP N N N N 45 ASP CA C N S 46 ASP C C N N 47 ASP O O N N 48 ASP CB C N N 49 ASP CG C N N 50 ASP OD1 O N N 51 ASP OD2 O N N 52 ASP OXT O N N 53 ASP H H N N 54 ASP H2 H N N 55 ASP HA H N N 56 ASP HB2 H N N 57 ASP HB3 H N N 58 ASP HD2 H N N 59 ASP HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 HIS N N N N 110 HIS CA C N S 111 HIS C C N N 112 HIS O O N N 113 HIS CB C N N 114 HIS CG C Y N 115 HIS ND1 N Y N 116 HIS CD2 C Y N 117 HIS CE1 C Y N 118 HIS NE2 N Y N 119 HIS OXT O N N 120 HIS H H N N 121 HIS H2 H N N 122 HIS HA H N N 123 HIS HB2 H N N 124 HIS HB3 H N N 125 HIS HD1 H N N 126 HIS HD2 H N N 127 HIS HE1 H N N 128 HIS HE2 H N N 129 HIS HXT H N N 130 HOH O O N N 131 HOH H1 H N N 132 HOH H2 H N N 133 ILE N N N N 134 ILE CA C N S 135 ILE C C N N 136 ILE O O N N 137 ILE CB C N S 138 ILE CG1 C N N 139 ILE CG2 C N N 140 ILE CD1 C N N 141 ILE OXT O N N 142 ILE H H N N 143 ILE H2 H N N 144 ILE HA H N N 145 ILE HB H N N 146 ILE HG12 H N N 147 ILE HG13 H N N 148 ILE HG21 H N N 149 ILE HG22 H N N 150 ILE HG23 H N N 151 ILE HD11 H N N 152 ILE HD12 H N N 153 ILE HD13 H N N 154 ILE HXT H N N 155 LEU N N N N 156 LEU CA C N S 157 LEU C C N N 158 LEU O O N N 159 LEU CB C N N 160 LEU CG C N N 161 LEU CD1 C N N 162 LEU CD2 C N N 163 LEU OXT O N N 164 LEU H H N N 165 LEU H2 H N N 166 LEU HA H N N 167 LEU HB2 H N N 168 LEU HB3 H N N 169 LEU HG H N N 170 LEU HD11 H N N 171 LEU HD12 H N N 172 LEU HD13 H N N 173 LEU HD21 H N N 174 LEU HD22 H N N 175 LEU HD23 H N N 176 LEU HXT H N N 177 LYS N N N N 178 LYS CA C N S 179 LYS C C N N 180 LYS O O N N 181 LYS CB C N N 182 LYS CG C N N 183 LYS CD C N N 184 LYS CE C N N 185 LYS NZ N N N 186 LYS OXT O N N 187 LYS H H N N 188 LYS H2 H N N 189 LYS HA H N N 190 LYS HB2 H N N 191 LYS HB3 H N N 192 LYS HG2 H N N 193 LYS HG3 H N N 194 LYS HD2 H N N 195 LYS HD3 H N N 196 LYS HE2 H N N 197 LYS HE3 H N N 198 LYS HZ1 H N N 199 LYS HZ2 H N N 200 LYS HZ3 H N N 201 LYS HXT H N N 202 MET N N N N 203 MET CA C N S 204 MET C C N N 205 MET O O N N 206 MET CB C N N 207 MET CG C N N 208 MET SD S N N 209 MET CE C N N 210 MET OXT O N N 211 MET H H N N 212 MET H2 H N N 213 MET HA H N N 214 MET HB2 H N N 215 MET HB3 H N N 216 MET HG2 H N N 217 MET HG3 H N N 218 MET HE1 H N N 219 MET HE2 H N N 220 MET HE3 H N N 221 MET HXT H N N 222 PHE N N N N 223 PHE CA C N S 224 PHE C C N N 225 PHE O O N N 226 PHE CB C N N 227 PHE CG C Y N 228 PHE CD1 C Y N 229 PHE CD2 C Y N 230 PHE CE1 C Y N 231 PHE CE2 C Y N 232 PHE CZ C Y N 233 PHE OXT O N N 234 PHE H H N N 235 PHE H2 H N N 236 PHE HA H N N 237 PHE HB2 H N N 238 PHE HB3 H N N 239 PHE HD1 H N N 240 PHE HD2 H N N 241 PHE HE1 H N N 242 PHE HE2 H N N 243 PHE HZ H N N 244 PHE HXT H N N 245 SER N N N N 246 SER CA C N S 247 SER C C N N 248 SER O O N N 249 SER CB C N N 250 SER OG O N N 251 SER OXT O N N 252 SER H H N N 253 SER H2 H N N 254 SER HA H N N 255 SER HB2 H N N 256 SER HB3 H N N 257 SER HG H N N 258 SER HXT H N N 259 SO4 S S N N 260 SO4 O1 O N N 261 SO4 O2 O N N 262 SO4 O3 O N N 263 SO4 O4 O N N 264 THR N N N N 265 THR CA C N S 266 THR C C N N 267 THR O O N N 268 THR CB C N R 269 THR OG1 O N N 270 THR CG2 C N N 271 THR OXT O N N 272 THR H H N N 273 THR H2 H N N 274 THR HA H N N 275 THR HB H N N 276 THR HG1 H N N 277 THR HG21 H N N 278 THR HG22 H N N 279 THR HG23 H N N 280 THR HXT H N N 281 VAL N N N N 282 VAL CA C N S 283 VAL C C N N 284 VAL O O N N 285 VAL CB C N N 286 VAL CG1 C N N 287 VAL CG2 C N N 288 VAL OXT O N N 289 VAL H H N N 290 VAL H2 H N N 291 VAL HA H N N 292 VAL HB H N N 293 VAL HG11 H N N 294 VAL HG12 H N N 295 VAL HG13 H N N 296 VAL HG21 H N N 297 VAL HG22 H N N 298 VAL HG23 H N N 299 VAL HXT H N N 300 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 ASP N CA sing N N 43 ASP N H sing N N 44 ASP N H2 sing N N 45 ASP CA C sing N N 46 ASP CA CB sing N N 47 ASP CA HA sing N N 48 ASP C O doub N N 49 ASP C OXT sing N N 50 ASP CB CG sing N N 51 ASP CB HB2 sing N N 52 ASP CB HB3 sing N N 53 ASP CG OD1 doub N N 54 ASP CG OD2 sing N N 55 ASP OD2 HD2 sing N N 56 ASP OXT HXT sing N N 57 GLN N CA sing N N 58 GLN N H sing N N 59 GLN N H2 sing N N 60 GLN CA C sing N N 61 GLN CA CB sing N N 62 GLN CA HA sing N N 63 GLN C O doub N N 64 GLN C OXT sing N N 65 GLN CB CG sing N N 66 GLN CB HB2 sing N N 67 GLN CB HB3 sing N N 68 GLN CG CD sing N N 69 GLN CG HG2 sing N N 70 GLN CG HG3 sing N N 71 GLN CD OE1 doub N N 72 GLN CD NE2 sing N N 73 GLN NE2 HE21 sing N N 74 GLN NE2 HE22 sing N N 75 GLN OXT HXT sing N N 76 GLU N CA sing N N 77 GLU N H sing N N 78 GLU N H2 sing N N 79 GLU CA C sing N N 80 GLU CA CB sing N N 81 GLU CA HA sing N N 82 GLU C O doub N N 83 GLU C OXT sing N N 84 GLU CB CG sing N N 85 GLU CB HB2 sing N N 86 GLU CB HB3 sing N N 87 GLU CG CD sing N N 88 GLU CG HG2 sing N N 89 GLU CG HG3 sing N N 90 GLU CD OE1 doub N N 91 GLU CD OE2 sing N N 92 GLU OE2 HE2 sing N N 93 GLU OXT HXT sing N N 94 GLY N CA sing N N 95 GLY N H sing N N 96 GLY N H2 sing N N 97 GLY CA C sing N N 98 GLY CA HA2 sing N N 99 GLY CA HA3 sing N N 100 GLY C O doub N N 101 GLY C OXT sing N N 102 GLY OXT HXT sing N N 103 HIS N CA sing N N 104 HIS N H sing N N 105 HIS N H2 sing N N 106 HIS CA C sing N N 107 HIS CA CB sing N N 108 HIS CA HA sing N N 109 HIS C O doub N N 110 HIS C OXT sing N N 111 HIS CB CG sing N N 112 HIS CB HB2 sing N N 113 HIS CB HB3 sing N N 114 HIS CG ND1 sing Y N 115 HIS CG CD2 doub Y N 116 HIS ND1 CE1 doub Y N 117 HIS ND1 HD1 sing N N 118 HIS CD2 NE2 sing Y N 119 HIS CD2 HD2 sing N N 120 HIS CE1 NE2 sing Y N 121 HIS CE1 HE1 sing N N 122 HIS NE2 HE2 sing N N 123 HIS OXT HXT sing N N 124 HOH O H1 sing N N 125 HOH O H2 sing N N 126 ILE N CA sing N N 127 ILE N H sing N N 128 ILE N H2 sing N N 129 ILE CA C sing N N 130 ILE CA CB sing N N 131 ILE CA HA sing N N 132 ILE C O doub N N 133 ILE C OXT sing N N 134 ILE CB CG1 sing N N 135 ILE CB CG2 sing N N 136 ILE CB HB sing N N 137 ILE CG1 CD1 sing N N 138 ILE CG1 HG12 sing N N 139 ILE CG1 HG13 sing N N 140 ILE CG2 HG21 sing N N 141 ILE CG2 HG22 sing N N 142 ILE CG2 HG23 sing N N 143 ILE CD1 HD11 sing N N 144 ILE CD1 HD12 sing N N 145 ILE CD1 HD13 sing N N 146 ILE OXT HXT sing N N 147 LEU N CA sing N N 148 LEU N H sing N N 149 LEU N H2 sing N N 150 LEU CA C sing N N 151 LEU CA CB sing N N 152 LEU CA HA sing N N 153 LEU C O doub N N 154 LEU C OXT sing N N 155 LEU CB CG sing N N 156 LEU CB HB2 sing N N 157 LEU CB HB3 sing N N 158 LEU CG CD1 sing N N 159 LEU CG CD2 sing N N 160 LEU CG HG sing N N 161 LEU CD1 HD11 sing N N 162 LEU CD1 HD12 sing N N 163 LEU CD1 HD13 sing N N 164 LEU CD2 HD21 sing N N 165 LEU CD2 HD22 sing N N 166 LEU CD2 HD23 sing N N 167 LEU OXT HXT sing N N 168 LYS N CA sing N N 169 LYS N H sing N N 170 LYS N H2 sing N N 171 LYS CA C sing N N 172 LYS CA CB sing N N 173 LYS CA HA sing N N 174 LYS C O doub N N 175 LYS C OXT sing N N 176 LYS CB CG sing N N 177 LYS CB HB2 sing N N 178 LYS CB HB3 sing N N 179 LYS CG CD sing N N 180 LYS CG HG2 sing N N 181 LYS CG HG3 sing N N 182 LYS CD CE sing N N 183 LYS CD HD2 sing N N 184 LYS CD HD3 sing N N 185 LYS CE NZ sing N N 186 LYS CE HE2 sing N N 187 LYS CE HE3 sing N N 188 LYS NZ HZ1 sing N N 189 LYS NZ HZ2 sing N N 190 LYS NZ HZ3 sing N N 191 LYS OXT HXT sing N N 192 MET N CA sing N N 193 MET N H sing N N 194 MET N H2 sing N N 195 MET CA C sing N N 196 MET CA CB sing N N 197 MET CA HA sing N N 198 MET C O doub N N 199 MET C OXT sing N N 200 MET CB CG sing N N 201 MET CB HB2 sing N N 202 MET CB HB3 sing N N 203 MET CG SD sing N N 204 MET CG HG2 sing N N 205 MET CG HG3 sing N N 206 MET SD CE sing N N 207 MET CE HE1 sing N N 208 MET CE HE2 sing N N 209 MET CE HE3 sing N N 210 MET OXT HXT sing N N 211 PHE N CA sing N N 212 PHE N H sing N N 213 PHE N H2 sing N N 214 PHE CA C sing N N 215 PHE CA CB sing N N 216 PHE CA HA sing N N 217 PHE C O doub N N 218 PHE C OXT sing N N 219 PHE CB CG sing N N 220 PHE CB HB2 sing N N 221 PHE CB HB3 sing N N 222 PHE CG CD1 doub Y N 223 PHE CG CD2 sing Y N 224 PHE CD1 CE1 sing Y N 225 PHE CD1 HD1 sing N N 226 PHE CD2 CE2 doub Y N 227 PHE CD2 HD2 sing N N 228 PHE CE1 CZ doub Y N 229 PHE CE1 HE1 sing N N 230 PHE CE2 CZ sing Y N 231 PHE CE2 HE2 sing N N 232 PHE CZ HZ sing N N 233 PHE OXT HXT sing N N 234 SER N CA sing N N 235 SER N H sing N N 236 SER N H2 sing N N 237 SER CA C sing N N 238 SER CA CB sing N N 239 SER CA HA sing N N 240 SER C O doub N N 241 SER C OXT sing N N 242 SER CB OG sing N N 243 SER CB HB2 sing N N 244 SER CB HB3 sing N N 245 SER OG HG sing N N 246 SER OXT HXT sing N N 247 SO4 S O1 doub N N 248 SO4 S O2 doub N N 249 SO4 S O3 sing N N 250 SO4 S O4 sing N N 251 THR N CA sing N N 252 THR N H sing N N 253 THR N H2 sing N N 254 THR CA C sing N N 255 THR CA CB sing N N 256 THR CA HA sing N N 257 THR C O doub N N 258 THR C OXT sing N N 259 THR CB OG1 sing N N 260 THR CB CG2 sing N N 261 THR CB HB sing N N 262 THR OG1 HG1 sing N N 263 THR CG2 HG21 sing N N 264 THR CG2 HG22 sing N N 265 THR CG2 HG23 sing N N 266 THR OXT HXT sing N N 267 VAL N CA sing N N 268 VAL N H sing N N 269 VAL N H2 sing N N 270 VAL CA C sing N N 271 VAL CA CB sing N N 272 VAL CA HA sing N N 273 VAL C O doub N N 274 VAL C OXT sing N N 275 VAL CB CG1 sing N N 276 VAL CB CG2 sing N N 277 VAL CB HB sing N N 278 VAL CG1 HG11 sing N N 279 VAL CG1 HG12 sing N N 280 VAL CG1 HG13 sing N N 281 VAL CG2 HG21 sing N N 282 VAL CG2 HG22 sing N N 283 VAL CG2 HG23 sing N N 284 VAL OXT HXT sing N N 285 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Howard Hughes Medical Institute (HHMI)' 'United States' ? 1 'National Science Foundation (NSF, United States)' 'United States' DGE-1256082 2 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.details 'Computational model generated by FoldIt software' # _atom_sites.entry_id 6MRS _atom_sites.fract_transf_matrix[1][1] 0.019079 _atom_sites.fract_transf_matrix[1][2] 0.011015 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022030 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017830 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_