data_6MV7 # _entry.id 6MV7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.325 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6MV7 WWPDB D_1000237657 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6MV7 _pdbx_database_status.recvd_initial_deposition_date 2018-10-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Couture, J.-F.' 1 ? 'Doucet, N.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 0006-2960 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 59 _citation.language ? _citation.page_first 755 _citation.page_last 765 _citation.title 'Insights into Structural and Dynamical Changes Experienced by Human RNase 6 upon Ligand Binding.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.9b00888 _citation.pdbx_database_id_PubMed 31909602 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Narayanan, C.' 1 ? primary 'Bernard, D.N.' 2 ? primary 'Letourneau, M.' 3 ? primary 'Gagnon, J.' 4 ? primary 'Gagne, D.' 5 ? primary 'Bafna, K.' 6 ? primary 'Calmettes, C.' 7 ? primary 'Couture, J.F.' 8 ? primary 'Agarwal, P.K.' 9 0000-0002-3848-9492 primary 'Doucet, N.' 10 0000-0002-1952-9380 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6MV7 _cell.details ? _cell.formula_units_Z ? _cell.length_a 27.650 _cell.length_a_esd ? _cell.length_b 38.830 _cell.length_b_esd ? _cell.length_c 97.920 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6MV7 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ribonuclease K6' 14807.069 1 3.1.27.- ? ? ? 2 non-polymer syn 'ADENOSINE MONOPHOSPHATE' 347.221 1 ? ? ? ? 3 water nat water 18.015 27 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RNase K6' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MWPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMT DCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSIL ; _entity_poly.pdbx_seq_one_letter_code_can ;MWPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMT DCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSIL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 TRP n 1 3 PRO n 1 4 LYS n 1 5 ARG n 1 6 LEU n 1 7 THR n 1 8 LYS n 1 9 ALA n 1 10 HIS n 1 11 TRP n 1 12 PHE n 1 13 GLU n 1 14 ILE n 1 15 GLN n 1 16 HIS n 1 17 ILE n 1 18 GLN n 1 19 PRO n 1 20 SER n 1 21 PRO n 1 22 LEU n 1 23 GLN n 1 24 CYS n 1 25 ASN n 1 26 ARG n 1 27 ALA n 1 28 MET n 1 29 SER n 1 30 GLY n 1 31 ILE n 1 32 ASN n 1 33 ASN n 1 34 TYR n 1 35 THR n 1 36 GLN n 1 37 HIS n 1 38 CYS n 1 39 LYS n 1 40 HIS n 1 41 GLN n 1 42 ASN n 1 43 THR n 1 44 PHE n 1 45 LEU n 1 46 HIS n 1 47 ASP n 1 48 SER n 1 49 PHE n 1 50 GLN n 1 51 ASN n 1 52 VAL n 1 53 ALA n 1 54 ALA n 1 55 VAL n 1 56 CYS n 1 57 ASP n 1 58 LEU n 1 59 LEU n 1 60 SER n 1 61 ILE n 1 62 VAL n 1 63 CYS n 1 64 LYS n 1 65 ASN n 1 66 ARG n 1 67 ARG n 1 68 HIS n 1 69 ASN n 1 70 CYS n 1 71 HIS n 1 72 GLN n 1 73 SER n 1 74 SER n 1 75 LYS n 1 76 PRO n 1 77 VAL n 1 78 ASN n 1 79 MET n 1 80 THR n 1 81 ASP n 1 82 CYS n 1 83 ARG n 1 84 LEU n 1 85 THR n 1 86 SER n 1 87 GLY n 1 88 LYS n 1 89 TYR n 1 90 PRO n 1 91 GLN n 1 92 CYS n 1 93 ARG n 1 94 TYR n 1 95 SER n 1 96 ALA n 1 97 ALA n 1 98 ALA n 1 99 GLN n 1 100 TYR n 1 101 LYS n 1 102 PHE n 1 103 PHE n 1 104 ILE n 1 105 VAL n 1 106 ALA n 1 107 CYS n 1 108 ASP n 1 109 PRO n 1 110 PRO n 1 111 GLN n 1 112 LYS n 1 113 SER n 1 114 ASP n 1 115 PRO n 1 116 PRO n 1 117 TYR n 1 118 LYS n 1 119 LEU n 1 120 VAL n 1 121 PRO n 1 122 VAL n 1 123 HIS n 1 124 LEU n 1 125 ASP n 1 126 SER n 1 127 ILE n 1 128 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 128 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'RNASE6, RNS6' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RNAS6_HUMAN _struct_ref.pdbx_db_accession Q93091 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;WPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTD CRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSIL ; _struct_ref.pdbx_align_begin 24 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6MV7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 128 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q93091 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 150 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 127 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6MV7 _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q93091 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 AMP non-polymer . 'ADENOSINE MONOPHOSPHATE' ? 'C10 H14 N5 O7 P' 347.221 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6MV7 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.78 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 30.71 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 4000, 50mM Sodium phosphate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 300K' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-10-04 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 17-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 14.860 _reflns.entry_id 6MV7 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.59 _reflns.d_resolution_low 36.1 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 3537 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.4 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.046 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.6 _reflns_shell.d_res_low 2.71 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 308 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value 0.104 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 60.570 _refine.B_iso_mean 19.0356 _refine.B_iso_min 3.810 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6MV7 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5900 _refine.ls_d_res_low 36.0950 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 3537 _refine.ls_number_reflns_R_free 354 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.5000 _refine.ls_percent_reflns_R_free 10.0100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2204 _refine.ls_R_factor_R_free 0.2519 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2168 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.390 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6MV6 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.2800 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.5900 _refine_hist.d_res_low 36.0950 _refine_hist.number_atoms_solvent 27 _refine_hist.number_atoms_total 1063 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 128 _refine_hist.pdbx_B_iso_mean_ligand 32.27 _refine_hist.pdbx_B_iso_mean_solvent 17.32 _refine_hist.pdbx_number_atoms_protein 1013 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 23 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 1083 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.703 ? 1481 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.041 ? 157 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 189 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.497 ? 660 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.59 2.9645 . . 113 1013 97.0000 . . . 0.2931 0.0000 0.2460 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9645 3.7343 . . 115 1038 99.0000 . . . 0.2673 0.0000 0.2190 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7343 36.0950 . . 126 1132 100.0000 . . . 0.2198 0.0000 0.1998 . . . . . . . . . . . # _struct.entry_id 6MV7 _struct.title 'Crystal structure of RNAse 6' _struct.pdbx_descriptor 'Ribonuclease K6 (E.C.3.1.27.-)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6MV7 _struct_keywords.text 'rnase, nuclease, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 7 ? ILE A 17 ? THR A 6 ILE A 16 1 ? 11 HELX_P HELX_P2 AA2 GLN A 23 ? GLN A 36 ? GLN A 22 GLN A 35 1 ? 14 HELX_P HELX_P3 AA3 SER A 48 ? CYS A 56 ? SER A 47 CYS A 55 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 24 SG ? ? ? 1_555 A CYS 82 SG ? ? A CYS 23 A CYS 81 1_555 ? ? ? ? ? ? ? 2.031 ? disulf2 disulf ? ? A CYS 38 SG ? ? ? 1_555 A CYS 92 SG ? ? A CYS 37 A CYS 91 1_555 ? ? ? ? ? ? ? 2.032 ? disulf3 disulf ? ? A CYS 56 SG ? ? ? 1_555 A CYS 107 SG ? ? A CYS 55 A CYS 106 1_555 ? ? ? ? ? ? ? 2.027 ? disulf4 disulf ? ? A CYS 63 SG ? ? ? 1_555 A CYS 70 SG ? ? A CYS 62 A CYS 69 1_555 ? ? ? ? ? ? ? 2.029 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id TYR _struct_mon_prot_cis.label_seq_id 89 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id TYR _struct_mon_prot_cis.auth_seq_id 88 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 90 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 89 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 4.17 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 41 ? LEU A 45 ? GLN A 40 LEU A 44 AA1 2 VAL A 77 ? SER A 86 ? VAL A 76 SER A 85 AA1 3 ARG A 93 ? ASP A 108 ? ARG A 92 ASP A 107 AA1 4 CYS A 70 ? GLN A 72 ? CYS A 69 GLN A 71 AA1 5 SER A 60 ? ILE A 61 ? SER A 59 ILE A 60 AA2 1 GLN A 41 ? LEU A 45 ? GLN A 40 LEU A 44 AA2 2 VAL A 77 ? SER A 86 ? VAL A 76 SER A 85 AA2 3 ARG A 93 ? ASP A 108 ? ARG A 92 ASP A 107 AA2 4 VAL A 120 ? LEU A 128 ? VAL A 119 LEU A 127 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASN A 42 ? N ASN A 41 O CYS A 82 ? O CYS A 81 AA1 2 3 N MET A 79 ? N MET A 78 O GLN A 99 ? O GLN A 98 AA1 3 4 O VAL A 105 ? O VAL A 104 N HIS A 71 ? N HIS A 70 AA1 4 5 O CYS A 70 ? O CYS A 69 N ILE A 61 ? N ILE A 60 AA2 1 2 N ASN A 42 ? N ASN A 41 O CYS A 82 ? O CYS A 81 AA2 2 3 N MET A 79 ? N MET A 78 O GLN A 99 ? O GLN A 98 AA2 3 4 N ALA A 106 ? N ALA A 105 O VAL A 122 ? O VAL A 121 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id AMP _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 12 _struct_site.details 'binding site for residue AMP A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 12 LYS A 8 ? LYS A 7 . ? 1_555 ? 2 AC1 12 VAL A 62 ? VAL A 61 . ? 3_555 ? 3 AC1 12 CYS A 63 ? CYS A 62 . ? 1_555 ? 4 AC1 12 ASN A 65 ? ASN A 64 . ? 1_555 ? 5 AC1 12 ARG A 67 ? ARG A 66 . ? 1_555 ? 6 AC1 12 HIS A 68 ? HIS A 67 . ? 3_555 ? 7 AC1 12 ASN A 69 ? ASN A 68 . ? 1_555 ? 8 AC1 12 ALA A 106 ? ALA A 105 . ? 1_555 ? 9 AC1 12 ASP A 108 ? ASP A 107 . ? 1_555 ? 10 AC1 12 VAL A 122 ? VAL A 121 . ? 1_555 ? 11 AC1 12 HIS A 123 ? HIS A 122 . ? 1_555 ? 12 AC1 12 HOH C . ? HOH A 319 . ? 1_555 ? # _atom_sites.entry_id 6MV7 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.036166 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.025753 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010212 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 0 MET MET A . n A 1 2 TRP 2 1 1 TRP TRP A . n A 1 3 PRO 3 2 2 PRO PRO A . n A 1 4 LYS 4 3 3 LYS LYS A . n A 1 5 ARG 5 4 4 ARG ARG A . n A 1 6 LEU 6 5 5 LEU LEU A . n A 1 7 THR 7 6 6 THR THR A . n A 1 8 LYS 8 7 7 LYS LYS A . n A 1 9 ALA 9 8 8 ALA ALA A . n A 1 10 HIS 10 9 9 HIS HIS A . n A 1 11 TRP 11 10 10 TRP TRP A . n A 1 12 PHE 12 11 11 PHE PHE A . n A 1 13 GLU 13 12 12 GLU GLU A . n A 1 14 ILE 14 13 13 ILE ILE A . n A 1 15 GLN 15 14 14 GLN GLN A . n A 1 16 HIS 16 15 15 HIS HIS A . n A 1 17 ILE 17 16 16 ILE ILE A . n A 1 18 GLN 18 17 17 GLN GLN A . n A 1 19 PRO 19 18 18 PRO PRO A . n A 1 20 SER 20 19 19 SER SER A . n A 1 21 PRO 21 20 20 PRO PRO A . n A 1 22 LEU 22 21 21 LEU LEU A . n A 1 23 GLN 23 22 22 GLN GLN A . n A 1 24 CYS 24 23 23 CYS CYS A . n A 1 25 ASN 25 24 24 ASN ASN A . n A 1 26 ARG 26 25 25 ARG ARG A . n A 1 27 ALA 27 26 26 ALA ALA A . n A 1 28 MET 28 27 27 MET MET A . n A 1 29 SER 29 28 28 SER SER A . n A 1 30 GLY 30 29 29 GLY GLY A . n A 1 31 ILE 31 30 30 ILE ILE A . n A 1 32 ASN 32 31 31 ASN ASN A . n A 1 33 ASN 33 32 32 ASN ASN A . n A 1 34 TYR 34 33 33 TYR TYR A . n A 1 35 THR 35 34 34 THR THR A . n A 1 36 GLN 36 35 35 GLN GLN A . n A 1 37 HIS 37 36 36 HIS HIS A . n A 1 38 CYS 38 37 37 CYS CYS A . n A 1 39 LYS 39 38 38 LYS LYS A . n A 1 40 HIS 40 39 39 HIS HIS A . n A 1 41 GLN 41 40 40 GLN GLN A . n A 1 42 ASN 42 41 41 ASN ASN A . n A 1 43 THR 43 42 42 THR THR A . n A 1 44 PHE 44 43 43 PHE PHE A . n A 1 45 LEU 45 44 44 LEU LEU A . n A 1 46 HIS 46 45 45 HIS HIS A . n A 1 47 ASP 47 46 46 ASP ASP A . n A 1 48 SER 48 47 47 SER SER A . n A 1 49 PHE 49 48 48 PHE PHE A . n A 1 50 GLN 50 49 49 GLN GLN A . n A 1 51 ASN 51 50 50 ASN ASN A . n A 1 52 VAL 52 51 51 VAL VAL A . n A 1 53 ALA 53 52 52 ALA ALA A . n A 1 54 ALA 54 53 53 ALA ALA A . n A 1 55 VAL 55 54 54 VAL VAL A . n A 1 56 CYS 56 55 55 CYS CYS A . n A 1 57 ASP 57 56 56 ASP ASP A . n A 1 58 LEU 58 57 57 LEU LEU A . n A 1 59 LEU 59 58 58 LEU LEU A . n A 1 60 SER 60 59 59 SER SER A . n A 1 61 ILE 61 60 60 ILE ILE A . n A 1 62 VAL 62 61 61 VAL VAL A . n A 1 63 CYS 63 62 62 CYS CYS A . n A 1 64 LYS 64 63 63 LYS LYS A . n A 1 65 ASN 65 64 64 ASN ASN A . n A 1 66 ARG 66 65 65 ARG ARG A . n A 1 67 ARG 67 66 66 ARG ARG A . n A 1 68 HIS 68 67 67 HIS HIS A . n A 1 69 ASN 69 68 68 ASN ASN A . n A 1 70 CYS 70 69 69 CYS CYS A . n A 1 71 HIS 71 70 70 HIS HIS A . n A 1 72 GLN 72 71 71 GLN GLN A . n A 1 73 SER 73 72 72 SER SER A . n A 1 74 SER 74 73 73 SER SER A . n A 1 75 LYS 75 74 74 LYS LYS A . n A 1 76 PRO 76 75 75 PRO PRO A . n A 1 77 VAL 77 76 76 VAL VAL A . n A 1 78 ASN 78 77 77 ASN ASN A . n A 1 79 MET 79 78 78 MET MET A . n A 1 80 THR 80 79 79 THR THR A . n A 1 81 ASP 81 80 80 ASP ASP A . n A 1 82 CYS 82 81 81 CYS CYS A . n A 1 83 ARG 83 82 82 ARG ARG A . n A 1 84 LEU 84 83 83 LEU LEU A . n A 1 85 THR 85 84 84 THR THR A . n A 1 86 SER 86 85 85 SER SER A . n A 1 87 GLY 87 86 86 GLY GLY A . n A 1 88 LYS 88 87 87 LYS LYS A . n A 1 89 TYR 89 88 88 TYR TYR A . n A 1 90 PRO 90 89 89 PRO PRO A . n A 1 91 GLN 91 90 90 GLN GLN A . n A 1 92 CYS 92 91 91 CYS CYS A . n A 1 93 ARG 93 92 92 ARG ARG A . n A 1 94 TYR 94 93 93 TYR TYR A . n A 1 95 SER 95 94 94 SER SER A . n A 1 96 ALA 96 95 95 ALA ALA A . n A 1 97 ALA 97 96 96 ALA ALA A . n A 1 98 ALA 98 97 97 ALA ALA A . n A 1 99 GLN 99 98 98 GLN GLN A . n A 1 100 TYR 100 99 99 TYR TYR A . n A 1 101 LYS 101 100 100 LYS LYS A . n A 1 102 PHE 102 101 101 PHE PHE A . n A 1 103 PHE 103 102 102 PHE PHE A . n A 1 104 ILE 104 103 103 ILE ILE A . n A 1 105 VAL 105 104 104 VAL VAL A . n A 1 106 ALA 106 105 105 ALA ALA A . n A 1 107 CYS 107 106 106 CYS CYS A . n A 1 108 ASP 108 107 107 ASP ASP A . n A 1 109 PRO 109 108 108 PRO PRO A . n A 1 110 PRO 110 109 109 PRO PRO A . n A 1 111 GLN 111 110 110 GLN GLN A . n A 1 112 LYS 112 111 111 LYS LYS A . n A 1 113 SER 113 112 112 SER SER A . n A 1 114 ASP 114 113 113 ASP ASP A . n A 1 115 PRO 115 114 114 PRO PRO A . n A 1 116 PRO 116 115 115 PRO PRO A . n A 1 117 TYR 117 116 116 TYR TYR A . n A 1 118 LYS 118 117 117 LYS LYS A . n A 1 119 LEU 119 118 118 LEU LEU A . n A 1 120 VAL 120 119 119 VAL VAL A . n A 1 121 PRO 121 120 120 PRO PRO A . n A 1 122 VAL 122 121 121 VAL VAL A . n A 1 123 HIS 123 122 122 HIS HIS A . n A 1 124 LEU 124 123 123 LEU LEU A . n A 1 125 ASP 125 124 124 ASP ASP A . n A 1 126 SER 126 125 125 SER SER A . n A 1 127 ILE 127 126 126 ILE ILE A . n A 1 128 LEU 128 127 127 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 AMP 1 201 1 AMP AMP A . C 3 HOH 1 301 8 HOH HOH A . C 3 HOH 2 302 26 HOH HOH A . C 3 HOH 3 303 1 HOH HOH A . C 3 HOH 4 304 12 HOH HOH A . C 3 HOH 5 305 27 HOH HOH A . C 3 HOH 6 306 13 HOH HOH A . C 3 HOH 7 307 23 HOH HOH A . C 3 HOH 8 308 25 HOH HOH A . C 3 HOH 9 309 2 HOH HOH A . C 3 HOH 10 310 21 HOH HOH A . C 3 HOH 11 311 11 HOH HOH A . C 3 HOH 12 312 24 HOH HOH A . C 3 HOH 13 313 29 HOH HOH A . C 3 HOH 14 314 7 HOH HOH A . C 3 HOH 15 315 14 HOH HOH A . C 3 HOH 16 316 4 HOH HOH A . C 3 HOH 17 317 3 HOH HOH A . C 3 HOH 18 318 15 HOH HOH A . C 3 HOH 19 319 18 HOH HOH A . C 3 HOH 20 320 28 HOH HOH A . C 3 HOH 21 321 22 HOH HOH A . C 3 HOH 22 322 17 HOH HOH A . C 3 HOH 23 323 10 HOH HOH A . C 3 HOH 24 324 6 HOH HOH A . C 3 HOH 25 325 9 HOH HOH A . C 3 HOH 26 326 19 HOH HOH A . C 3 HOH 27 327 16 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-11-13 2 'Structure model' 2 0 2020-01-15 3 'Structure model' 2 1 2020-05-27 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'Structure model' author 'Coordinate replacement' 'Polymer geometry' 'Few ramachandran outliers were fixed.' # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Atomic model' 3 2 'Structure model' 'Author supporting evidence' 4 2 'Structure model' 'Data collection' 5 2 'Structure model' 'Refinement description' 6 2 'Structure model' 'Structure summary' 7 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' computing 3 2 'Structure model' pdbx_entity_instance_feature 4 2 'Structure model' pdbx_entry_details 5 2 'Structure model' pdbx_nonpoly_scheme 6 2 'Structure model' pdbx_unobs_or_zero_occ_atoms 7 2 'Structure model' pdbx_validate_close_contact 8 2 'Structure model' pdbx_validate_torsion 9 2 'Structure model' refine 10 2 'Structure model' refine_hist 11 2 'Structure model' refine_ls_restr 12 2 'Structure model' refine_ls_shell 13 2 'Structure model' reflns 14 2 'Structure model' reflns_shell 15 2 'Structure model' software 16 3 'Structure model' citation 17 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_nonpoly_scheme.auth_seq_num' 2 2 'Structure model' '_refine.B_iso_max' 3 2 'Structure model' '_refine.B_iso_mean' 4 2 'Structure model' '_refine.B_iso_min' 5 2 'Structure model' '_refine.pdbx_ls_cross_valid_method' 6 2 'Structure model' '_refine.pdbx_method_to_determine_struct' 7 2 'Structure model' '_refine.pdbx_starting_model' 8 2 'Structure model' '_refine_hist.cycle_id' 9 2 'Structure model' '_refine_hist.number_atoms_total' 10 2 'Structure model' '_refine_hist.pdbx_B_iso_mean_ligand' 11 2 'Structure model' '_refine_hist.pdbx_B_iso_mean_solvent' 12 2 'Structure model' '_refine_hist.pdbx_number_atoms_protein' 13 2 'Structure model' '_refine_hist.pdbx_number_residues_total' 14 2 'Structure model' '_refine_ls_restr.dev_ideal' 15 2 'Structure model' '_refine_ls_restr.number' 16 2 'Structure model' '_refine_ls_restr.type' 17 2 'Structure model' '_refine_ls_shell.R_factor_R_free_error' 18 2 'Structure model' '_refine_ls_shell.d_res_high' 19 2 'Structure model' '_refine_ls_shell.d_res_low' 20 2 'Structure model' '_reflns.B_iso_Wilson_estimate' 21 2 'Structure model' '_reflns_shell.number_unique_obs' 22 2 'Structure model' '_software.version' 23 3 'Structure model' '_citation.country' 24 3 'Structure model' '_citation.journal_abbrev' 25 3 'Structure model' '_citation.journal_id_ASTM' 26 3 'Structure model' '_citation.journal_id_CSD' 27 3 'Structure model' '_citation.journal_id_ISSN' 28 3 'Structure model' '_citation.journal_volume' 29 3 'Structure model' '_citation.page_first' 30 3 'Structure model' '_citation.page_last' 31 3 'Structure model' '_citation.pdbx_database_id_DOI' 32 3 'Structure model' '_citation.pdbx_database_id_PubMed' 33 3 'Structure model' '_citation.title' 34 3 'Structure model' '_citation.year' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10.1_2155 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 6MV7 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NZ _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 LYS _pdbx_validate_close_contact.auth_seq_id_1 117 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 301 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.08 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 CD2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HIS _pdbx_validate_symm_contact.auth_seq_id_1 67 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 NZ _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 LYS _pdbx_validate_symm_contact.auth_seq_id_2 111 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 3_445 _pdbx_validate_symm_contact.dist 2.06 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 3 ? CG ? A LYS 4 CG 2 1 Y 1 A LYS 3 ? CD ? A LYS 4 CD 3 1 Y 1 A LYS 3 ? CE ? A LYS 4 CE 4 1 Y 1 A LYS 3 ? NZ ? A LYS 4 NZ 5 1 Y 1 A GLN 17 ? CG ? A GLN 18 CG 6 1 Y 1 A GLN 17 ? CD ? A GLN 18 CD 7 1 Y 1 A GLN 17 ? OE1 ? A GLN 18 OE1 8 1 Y 1 A GLN 17 ? NE2 ? A GLN 18 NE2 9 1 Y 1 A SER 19 ? OG ? A SER 20 OG 10 1 Y 1 A ARG 25 ? CG ? A ARG 26 CG 11 1 Y 1 A ARG 25 ? CD ? A ARG 26 CD 12 1 Y 1 A ARG 25 ? NE ? A ARG 26 NE 13 1 Y 1 A ARG 25 ? CZ ? A ARG 26 CZ 14 1 Y 1 A ARG 25 ? NH1 ? A ARG 26 NH1 15 1 Y 1 A ARG 25 ? NH2 ? A ARG 26 NH2 16 1 Y 1 A LYS 74 ? CG ? A LYS 75 CG 17 1 Y 1 A LYS 74 ? CD ? A LYS 75 CD 18 1 Y 1 A LYS 74 ? CE ? A LYS 75 CE 19 1 Y 1 A LYS 74 ? NZ ? A LYS 75 NZ 20 1 Y 1 A LYS 87 ? CG ? A LYS 88 CG 21 1 Y 1 A LYS 87 ? CD ? A LYS 88 CD 22 1 Y 1 A LYS 87 ? CE ? A LYS 88 CE 23 1 Y 1 A LYS 87 ? NZ ? A LYS 88 NZ # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id AMP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id AMP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ADENOSINE MONOPHOSPHATE' AMP 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #