data_6N2L # _entry.id 6N2L # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6N2L pdb_00006n2l 10.2210/pdb6n2l/pdb WWPDB D_1000238066 ? ? # _pdbx_database_related.db_name TargetTrack _pdbx_database_related.details . _pdbx_database_related.db_id BuamA.00144.b _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6N2L _pdbx_database_status.recvd_initial_deposition_date 2018-11-13 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of a histone family protein DNA-binding protein from Burkholderia ambifaria' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Abendroth, J.' 1 ? primary 'Mayclin, S.J.' 2 ? primary 'Lorimer, D.' 3 ? primary 'Horanyi, P.S.' 4 ? primary 'Edwards, T.E.' 5 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6N2L _cell.details ? _cell.formula_units_Z ? _cell.length_a 38.210 _cell.length_a_esd ? _cell.length_b 71.400 _cell.length_b_esd ? _cell.length_c 76.730 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6N2L _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Histone family protein DNA-binding protein' 10653.248 1 ? ? BuamA.00144.b.B1 ? 2 water nat water 18.015 45 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAHHHHHHMNKQELIDAVAAQTGASKAQTGETLDTLLEVIKKAVSKGDAVQLIGFGSFGSGKRAARTGRNPKTGETIKIP AAKTVKFTAGKAFKDAVNKR ; _entity_poly.pdbx_seq_one_letter_code_can ;MAHHHHHHMNKQELIDAVAAQTGASKAQTGETLDTLLEVIKKAVSKGDAVQLIGFGSFGSGKRAARTGRNPKTGETIKIP AAKTVKFTAGKAFKDAVNKR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier BuamA.00144.b # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 MET n 1 10 ASN n 1 11 LYS n 1 12 GLN n 1 13 GLU n 1 14 LEU n 1 15 ILE n 1 16 ASP n 1 17 ALA n 1 18 VAL n 1 19 ALA n 1 20 ALA n 1 21 GLN n 1 22 THR n 1 23 GLY n 1 24 ALA n 1 25 SER n 1 26 LYS n 1 27 ALA n 1 28 GLN n 1 29 THR n 1 30 GLY n 1 31 GLU n 1 32 THR n 1 33 LEU n 1 34 ASP n 1 35 THR n 1 36 LEU n 1 37 LEU n 1 38 GLU n 1 39 VAL n 1 40 ILE n 1 41 LYS n 1 42 LYS n 1 43 ALA n 1 44 VAL n 1 45 SER n 1 46 LYS n 1 47 GLY n 1 48 ASP n 1 49 ALA n 1 50 VAL n 1 51 GLN n 1 52 LEU n 1 53 ILE n 1 54 GLY n 1 55 PHE n 1 56 GLY n 1 57 SER n 1 58 PHE n 1 59 GLY n 1 60 SER n 1 61 GLY n 1 62 LYS n 1 63 ARG n 1 64 ALA n 1 65 ALA n 1 66 ARG n 1 67 THR n 1 68 GLY n 1 69 ARG n 1 70 ASN n 1 71 PRO n 1 72 LYS n 1 73 THR n 1 74 GLY n 1 75 GLU n 1 76 THR n 1 77 ILE n 1 78 LYS n 1 79 ILE n 1 80 PRO n 1 81 ALA n 1 82 ALA n 1 83 LYS n 1 84 THR n 1 85 VAL n 1 86 LYS n 1 87 PHE n 1 88 THR n 1 89 ALA n 1 90 GLY n 1 91 LYS n 1 92 ALA n 1 93 PHE n 1 94 LYS n 1 95 ASP n 1 96 ALA n 1 97 VAL n 1 98 ASN n 1 99 LYS n 1 100 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 100 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BamMC406_0065 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain MC40-6 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Burkholderia ambifaria (strain MC40-6)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 398577 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name BuamA.00144.b.B1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B1YQ53_BURA4 _struct_ref.pdbx_db_accession B1YQ53 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNKQELIDAVAAQTGASKAQTGETLDTLLEVIKKAVSKGDAVQLIGFGSFGSGKRAARTGRNPKTGETIKIPAAKTVKFT AGKAFKDAVNKR ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6N2L _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 9 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 100 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B1YQ53 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 92 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 92 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6N2L MET A 1 ? UNP B1YQ53 ? ? 'expression tag' -7 1 1 6N2L ALA A 2 ? UNP B1YQ53 ? ? 'expression tag' -6 2 1 6N2L HIS A 3 ? UNP B1YQ53 ? ? 'expression tag' -5 3 1 6N2L HIS A 4 ? UNP B1YQ53 ? ? 'expression tag' -4 4 1 6N2L HIS A 5 ? UNP B1YQ53 ? ? 'expression tag' -3 5 1 6N2L HIS A 6 ? UNP B1YQ53 ? ? 'expression tag' -2 6 1 6N2L HIS A 7 ? UNP B1YQ53 ? ? 'expression tag' -1 7 1 6N2L HIS A 8 ? UNP B1YQ53 ? ? 'expression tag' 0 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6N2L _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.46 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.1 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 290 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;6.92 mg/mL BuamA.00144.b.B1.PS37906 with Microlytic MCSG1 screen, condition B8 (25.5% PEG4000, 15% glycerol, 170 mM sodium acetate), cryoprotection: direct, tray 272705 h3, puck ndf9-5 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU SATURN 944+' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-06-06 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'RIGAKU VARIMAX' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU FR-E+ SUPERBRIGHT' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 30.256 _reflns.entry_id 6N2L _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.850 _reflns.d_resolution_low 38.365 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9290 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 14.826 _reflns.pdbx_Rmerge_I_obs 0.064 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 28.260 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.989 _reflns.pdbx_scaling_rejects 20 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.066 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 137737 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.850 1.900 ? 4.720 ? ? ? ? 667 100 ? ? ? ? 0.506 ? ? ? ? ? ? ? ? 8.852 ? ? ? ? 0.537 ? ? 1 1 0.969 ? 1.900 1.950 ? 5.830 ? ? ? ? 654 99.500 ? ? ? ? 0.412 ? ? ? ? ? ? ? ? 9.185 ? ? ? ? 0.437 ? ? 2 1 0.960 ? 1.950 2.010 ? 8.740 ? ? ? ? 650 100.000 ? ? ? ? 0.261 ? ? ? ? ? ? ? ? 9.494 ? ? ? ? 0.276 ? ? 3 1 0.984 ? 2.010 2.070 ? 11.240 ? ? ? ? 607 99.800 ? ? ? ? 0.198 ? ? ? ? ? ? ? ? 9.870 ? ? ? ? 0.208 ? ? 4 1 0.990 ? 2.070 2.140 ? 15.350 ? ? ? ? 627 100.000 ? ? ? ? 0.147 ? ? ? ? ? ? ? ? 10.764 ? ? ? ? 0.155 ? ? 5 1 0.992 ? 2.140 2.210 ? 19.240 ? ? ? ? 564 100.000 ? ? ? ? 0.129 ? ? ? ? ? ? ? ? 13.046 ? ? ? ? 0.135 ? ? 6 1 0.994 ? 2.210 2.290 ? 21.980 ? ? ? ? 565 99.600 ? ? ? ? 0.109 ? ? ? ? ? ? ? ? 13.804 ? ? ? ? 0.113 ? ? 7 1 0.997 ? 2.290 2.390 ? 25.280 ? ? ? ? 567 100.000 ? ? ? ? 0.093 ? ? ? ? ? ? ? ? 14.434 ? ? ? ? 0.096 ? ? 8 1 0.998 ? 2.390 2.490 ? 26.210 ? ? ? ? 507 100.000 ? ? ? ? 0.093 ? ? ? ? ? ? ? ? 15.237 ? ? ? ? 0.096 ? ? 9 1 0.998 ? 2.490 2.620 ? 29.730 ? ? ? ? 499 100.000 ? ? ? ? 0.085 ? ? ? ? ? ? ? ? 16.222 ? ? ? ? 0.087 ? ? 10 1 0.998 ? 2.620 2.760 ? 33.810 ? ? ? ? 491 100.000 ? ? ? ? 0.078 ? ? ? ? ? ? ? ? 17.725 ? ? ? ? 0.080 ? ? 11 1 0.998 ? 2.760 2.930 ? 39.330 ? ? ? ? 455 100.000 ? ? ? ? 0.076 ? ? ? ? ? ? ? ? 20.826 ? ? ? ? 0.078 ? ? 12 1 0.999 ? 2.930 3.130 ? 46.600 ? ? ? ? 421 100.000 ? ? ? ? 0.066 ? ? ? ? ? ? ? ? 21.095 ? ? ? ? 0.068 ? ? 13 1 0.999 ? 3.130 3.380 ? 52.990 ? ? ? ? 413 100.000 ? ? ? ? 0.057 ? ? ? ? ? ? ? ? 20.857 ? ? ? ? 0.058 ? ? 14 1 0.999 ? 3.380 3.700 ? 56.170 ? ? ? ? 365 99.700 ? ? ? ? 0.055 ? ? ? ? ? ? ? ? 20.685 ? ? ? ? 0.056 ? ? 15 1 0.999 ? 3.700 4.140 ? 58.420 ? ? ? ? 337 100 ? ? ? ? 0.054 ? ? ? ? ? ? ? ? 20.344 ? ? ? ? 0.055 ? ? 16 1 0.999 ? 4.140 4.780 ? 59.220 ? ? ? ? 309 99.700 ? ? ? ? 0.051 ? ? ? ? ? ? ? ? 19.981 ? ? ? ? 0.053 ? ? 17 1 0.999 ? 4.780 5.850 ? 57.250 ? ? ? ? 257 100.000 ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 20.241 ? ? ? ? 0.053 ? ? 18 1 0.999 ? 5.850 8.270 ? 54.640 ? ? ? ? 206 100.000 ? ? ? ? 0.050 ? ? ? ? ? ? ? ? 19.777 ? ? ? ? 0.052 ? ? 19 1 0.999 ? 8.270 38.365 ? 56.230 ? ? ? ? 129 100.000 ? ? ? ? 0.048 ? ? ? ? ? ? ? ? 17.240 ? ? ? ? 0.050 ? ? 20 1 0.996 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 76.630 _refine.B_iso_mean 35.5458 _refine.B_iso_min 15.510 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6N2L _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.8500 _refine.ls_d_res_low 38.3650 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9284 _refine.ls_number_reflns_R_free 866 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8700 _refine.ls_percent_reflns_R_free 9.3300 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2495 _refine.ls_R_factor_R_free 0.2946 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2447 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB entry 1P71 as per MoRDa' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 0 _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.4100 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.8500 _refine_hist.d_res_low 38.3650 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 46 _refine_hist.number_atoms_total 666 _refine_hist.pdbx_number_residues_total 88 _refine_hist.pdbx_B_iso_mean_solvent 37.06 _refine_hist.pdbx_number_atoms_protein 620 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 634 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.643 ? 855 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 13.992 ? 377 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.039 ? 103 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 110 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.8500 1.9659 1512 . 135 1377 100.0000 . . . 0.3434 0.0000 0.2787 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 1.9659 2.1177 1527 . 119 1408 100.0000 . . . 0.3038 0.0000 0.2563 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.1177 2.3308 1515 . 172 1343 100.0000 . . . 0.3084 0.0000 0.2581 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.3308 2.6680 1531 . 147 1384 100.0000 . . . 0.3042 0.0000 0.2586 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.6680 3.3611 1567 . 125 1442 100.0000 . . . 0.3389 0.0000 0.2524 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 3.3611 38.3732 1632 . 168 1464 100.0000 . . . 0.2588 0.0000 0.2241 . . . . . . 6 . . . # _struct.entry_id 6N2L _struct.title 'Crystal structure of a histone family protein DNA-binding protein from Burkholderia ambifaria' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6N2L _struct_keywords.text ;SSGCID, Burkholderia ambifaria, Histone family, DNA binding protein, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease ; _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 10 ? GLY A 23 ? ASN A 2 GLY A 15 1 ? 14 HELX_P HELX_P2 AA2 SER A 25 ? LYS A 46 ? SER A 17 LYS A 38 1 ? 22 HELX_P HELX_P3 AA3 GLY A 90 ? ASN A 98 ? GLY A 82 ASN A 90 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 50 ? LEU A 52 ? VAL A 42 LEU A 44 AA1 2 GLY A 56 ? ARG A 63 ? GLY A 48 ARG A 55 AA1 3 ALA A 82 ? ALA A 89 ? ALA A 74 ALA A 81 AA2 1 ARG A 66 ? THR A 67 ? ARG A 58 THR A 59 AA2 2 LYS A 78 ? ILE A 79 ? LYS A 70 ILE A 71 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 52 ? N LEU A 44 O GLY A 56 ? O GLY A 48 AA1 2 3 N GLY A 59 ? N GLY A 51 O LYS A 86 ? O LYS A 78 AA2 1 2 N ARG A 66 ? N ARG A 58 O ILE A 79 ? O ILE A 71 # _atom_sites.entry_id 6N2L _atom_sites.fract_transf_matrix[1][1] 0.026171 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014006 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013033 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -7 ? ? ? A . n A 1 2 ALA 2 -6 ? ? ? A . n A 1 3 HIS 3 -5 ? ? ? A . n A 1 4 HIS 4 -4 ? ? ? A . n A 1 5 HIS 5 -3 -3 HIS HIS A . n A 1 6 HIS 6 -2 -2 HIS HIS A . n A 1 7 HIS 7 -1 -1 HIS HIS A . n A 1 8 HIS 8 0 0 HIS HIS A . n A 1 9 MET 9 1 1 MET MET A . n A 1 10 ASN 10 2 2 ASN ASN A . n A 1 11 LYS 11 3 3 LYS LYS A . n A 1 12 GLN 12 4 4 GLN GLN A . n A 1 13 GLU 13 5 5 GLU GLU A . n A 1 14 LEU 14 6 6 LEU LEU A . n A 1 15 ILE 15 7 7 ILE ILE A . n A 1 16 ASP 16 8 8 ASP ASP A . n A 1 17 ALA 17 9 9 ALA ALA A . n A 1 18 VAL 18 10 10 VAL VAL A . n A 1 19 ALA 19 11 11 ALA ALA A . n A 1 20 ALA 20 12 12 ALA ALA A . n A 1 21 GLN 21 13 13 GLN GLN A . n A 1 22 THR 22 14 14 THR THR A . n A 1 23 GLY 23 15 15 GLY GLY A . n A 1 24 ALA 24 16 16 ALA ALA A . n A 1 25 SER 25 17 17 SER SER A . n A 1 26 LYS 26 18 18 LYS LYS A . n A 1 27 ALA 27 19 19 ALA ALA A . n A 1 28 GLN 28 20 20 GLN GLN A . n A 1 29 THR 29 21 21 THR THR A . n A 1 30 GLY 30 22 22 GLY GLY A . n A 1 31 GLU 31 23 23 GLU GLU A . n A 1 32 THR 32 24 24 THR THR A . n A 1 33 LEU 33 25 25 LEU LEU A . n A 1 34 ASP 34 26 26 ASP ASP A . n A 1 35 THR 35 27 27 THR THR A . n A 1 36 LEU 36 28 28 LEU LEU A . n A 1 37 LEU 37 29 29 LEU LEU A . n A 1 38 GLU 38 30 30 GLU GLU A . n A 1 39 VAL 39 31 31 VAL VAL A . n A 1 40 ILE 40 32 32 ILE ILE A . n A 1 41 LYS 41 33 33 LYS LYS A . n A 1 42 LYS 42 34 34 LYS LYS A . n A 1 43 ALA 43 35 35 ALA ALA A . n A 1 44 VAL 44 36 36 VAL VAL A . n A 1 45 SER 45 37 37 SER SER A . n A 1 46 LYS 46 38 38 LYS LYS A . n A 1 47 GLY 47 39 39 GLY GLY A . n A 1 48 ASP 48 40 40 ASP ASP A . n A 1 49 ALA 49 41 41 ALA ALA A . n A 1 50 VAL 50 42 42 VAL VAL A . n A 1 51 GLN 51 43 43 GLN GLN A . n A 1 52 LEU 52 44 44 LEU LEU A . n A 1 53 ILE 53 45 45 ILE ILE A . n A 1 54 GLY 54 46 46 GLY GLY A . n A 1 55 PHE 55 47 47 PHE PHE A . n A 1 56 GLY 56 48 48 GLY GLY A . n A 1 57 SER 57 49 49 SER SER A . n A 1 58 PHE 58 50 50 PHE PHE A . n A 1 59 GLY 59 51 51 GLY GLY A . n A 1 60 SER 60 52 52 SER SER A . n A 1 61 GLY 61 53 53 GLY GLY A . n A 1 62 LYS 62 54 54 LYS LYS A . n A 1 63 ARG 63 55 55 ARG ARG A . n A 1 64 ALA 64 56 56 ALA ALA A . n A 1 65 ALA 65 57 57 ALA ALA A . n A 1 66 ARG 66 58 58 ARG ARG A . n A 1 67 THR 67 59 59 THR THR A . n A 1 68 GLY 68 60 60 GLY GLY A . n A 1 69 ARG 69 61 ? ? ? A . n A 1 70 ASN 70 62 ? ? ? A . n A 1 71 PRO 71 63 ? ? ? A . n A 1 72 LYS 72 64 ? ? ? A . n A 1 73 THR 73 65 ? ? ? A . n A 1 74 GLY 74 66 ? ? ? A . n A 1 75 GLU 75 67 ? ? ? A . n A 1 76 THR 76 68 68 THR THR A . n A 1 77 ILE 77 69 69 ILE ILE A . n A 1 78 LYS 78 70 70 LYS LYS A . n A 1 79 ILE 79 71 71 ILE ILE A . n A 1 80 PRO 80 72 72 PRO PRO A . n A 1 81 ALA 81 73 73 ALA ALA A . n A 1 82 ALA 82 74 74 ALA ALA A . n A 1 83 LYS 83 75 75 LYS LYS A . n A 1 84 THR 84 76 76 THR THR A . n A 1 85 VAL 85 77 77 VAL VAL A . n A 1 86 LYS 86 78 78 LYS LYS A . n A 1 87 PHE 87 79 79 PHE PHE A . n A 1 88 THR 88 80 80 THR THR A . n A 1 89 ALA 89 81 81 ALA ALA A . n A 1 90 GLY 90 82 82 GLY GLY A . n A 1 91 LYS 91 83 83 LYS LYS A . n A 1 92 ALA 92 84 84 ALA ALA A . n A 1 93 PHE 93 85 85 PHE PHE A . n A 1 94 LYS 94 86 86 LYS LYS A . n A 1 95 ASP 95 87 87 ASP ASP A . n A 1 96 ALA 96 88 88 ALA ALA A . n A 1 97 VAL 97 89 89 VAL VAL A . n A 1 98 ASN 98 90 90 ASN ASN A . n A 1 99 LYS 99 91 91 LYS LYS A . n A 1 100 ARG 100 92 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NIAID, National Institute of Allergy and Infectious Diseases' _pdbx_SG_project.full_name_of_center 'Seattle Structural Genomics Center for Infectious Disease' _pdbx_SG_project.initial_of_center SSGCID # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 101 45 HOH HOH A . B 2 HOH 2 102 39 HOH HOH A . B 2 HOH 3 103 35 HOH HOH A . B 2 HOH 4 104 37 HOH HOH A . B 2 HOH 5 105 59 HOH HOH A . B 2 HOH 6 106 14 HOH HOH A . B 2 HOH 7 107 47 HOH HOH A . B 2 HOH 8 108 13 HOH HOH A . B 2 HOH 9 109 32 HOH HOH A . B 2 HOH 10 110 15 HOH HOH A . B 2 HOH 11 111 17 HOH HOH A . B 2 HOH 12 112 12 HOH HOH A . B 2 HOH 13 113 53 HOH HOH A . B 2 HOH 14 114 44 HOH HOH A . B 2 HOH 15 115 58 HOH HOH A . B 2 HOH 16 116 22 HOH HOH A . B 2 HOH 17 117 6 HOH HOH A . B 2 HOH 18 118 50 HOH HOH A . B 2 HOH 19 119 43 HOH HOH A . B 2 HOH 20 120 41 HOH HOH A . B 2 HOH 21 121 18 HOH HOH A . B 2 HOH 22 122 16 HOH HOH A . B 2 HOH 23 123 8 HOH HOH A . B 2 HOH 24 124 60 HOH HOH A . B 2 HOH 25 125 38 HOH HOH A . B 2 HOH 26 126 56 HOH HOH A . B 2 HOH 27 127 19 HOH HOH A . B 2 HOH 28 128 9 HOH HOH A . B 2 HOH 29 129 21 HOH HOH A . B 2 HOH 30 130 51 HOH HOH A . B 2 HOH 31 131 34 HOH HOH A . B 2 HOH 32 132 40 HOH HOH A . B 2 HOH 33 133 24 HOH HOH A . B 2 HOH 34 134 48 HOH HOH A . B 2 HOH 35 135 33 HOH HOH A . B 2 HOH 36 136 27 HOH HOH A . B 2 HOH 37 137 3 HOH HOH A . B 2 HOH 38 138 55 HOH HOH A . B 2 HOH 39 139 57 HOH HOH A . B 2 HOH 40 140 36 HOH HOH A . B 2 HOH 41 141 11 HOH HOH A . B 2 HOH 42 142 52 HOH HOH A . B 2 HOH 43 143 30 HOH HOH A . B 2 HOH 44 144 49 HOH HOH A . B 2 HOH 45 145 54 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4610 ? 1 MORE -40 ? 1 'SSA (A^2)' 9770 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 131 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-12-05 2 'Structure model' 1 1 2018-12-19 3 'Structure model' 1 2 2023-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' refine_ls_restr 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined -2.4794 15.2127 4.0997 0.2722 0.3003 0.5924 0.0057 -0.0161 0.0974 2.4315 5.4878 2.4137 3.6488 0.1677 0.3334 -0.0216 0.0513 -0.0689 -0.2940 -0.2765 -0.3980 0.3695 0.0898 0.2609 'X-RAY DIFFRACTION' 2 ? refined -16.7184 8.8702 1.7722 0.2062 0.2985 0.6105 0.0004 0.0278 0.2335 6.5253 3.9241 3.0596 2.8411 1.4813 0.7607 0.1863 -0.0377 -0.0897 -0.1732 0.0708 0.1611 0.2299 0.0699 -0.1204 'X-RAY DIFFRACTION' 3 ? refined -12.1668 -3.5057 5.3173 0.1825 0.2887 0.3642 0.0311 0.0131 0.2631 2.1895 3.1669 0.8545 -1.9124 0.0899 -0.6578 -0.1299 0.1586 0.0121 -0.0767 -0.0549 0.2447 0.2592 -0.0432 -0.0480 'X-RAY DIFFRACTION' 4 ? refined -3.3759 -7.8528 -4.4493 0.2344 0.2459 0.4395 -0.0120 -0.0724 0.1988 0.9134 7.1457 2.6614 -2.1131 1.4655 -2.8989 0.1384 -0.0368 -0.1420 0.0010 -0.1189 0.2607 -0.5220 0.4602 0.0309 'X-RAY DIFFRACTION' 5 ? refined 5.6485 -8.5744 1.4224 0.2776 0.3760 0.3864 0.0931 0.0315 0.2271 4.1666 3.4005 2.4334 -2.5080 2.6906 -2.1215 0.1097 -0.0798 0.0732 -0.0564 -0.0484 -0.1171 0.0720 0.3343 0.2976 'X-RAY DIFFRACTION' 6 ? refined 19.8640 -10.3120 14.1870 0.3665 0.9087 0.5875 -0.0181 -0.2072 0.1217 3.1163 2.1255 3.8398 2.1163 3.4590 2.3239 0.2381 0.0525 -0.2603 -0.9214 0.0351 -1.0835 0.9071 0.1306 0.5191 'X-RAY DIFFRACTION' 7 ? refined 5.2922 -5.9120 1.5169 0.1991 0.3175 0.3217 0.0442 0.0368 0.2353 2.3423 6.0299 3.5095 -2.9348 2.5950 -4.3550 0.0146 -0.0272 0.0693 -0.1038 -0.0662 -0.0302 -0.1122 0.3734 0.0721 'X-RAY DIFFRACTION' 8 ? refined 1.9646 6.9476 -11.5730 0.2472 0.4306 0.2591 0.0020 -0.0396 0.2526 2.6502 6.1220 5.4952 0.4415 -0.3939 1.0663 0.0303 -0.2111 0.1865 0.2675 0.2393 -0.1141 -0.7508 -0.3171 0.2360 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A -3 A 2 ;chain 'A' and (resid -3 through 2 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 3 A 17 ;chain 'A' and (resid 3 through 17 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 18 A 37 ;chain 'A' and (resid 18 through 37 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 38 A 47 ;chain 'A' and (resid 38 through 47 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 48 A 55 ;chain 'A' and (resid 48 through 55 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 6 6 A 56 A 73 ;chain 'A' and (resid 56 through 73 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 7 7 A 74 A 81 ;chain 'A' and (resid 74 through 81 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 8 8 A 82 A 91 ;chain 'A' and (resid 82 through 91 ) ; ? ? ? ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MoRDa ? ? ? . 5 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 6 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OG1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 THR _pdbx_validate_close_contact.auth_seq_id_1 21 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 101 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A -2 ? ? -67.76 -70.52 2 1 PHE A 47 ? ? -130.65 -69.74 3 1 ASN A 90 ? ? -104.60 79.84 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 20 ? CG ? A GLN 28 CG 2 1 Y 1 A GLN 20 ? CD ? A GLN 28 CD 3 1 Y 1 A GLN 20 ? OE1 ? A GLN 28 OE1 4 1 Y 1 A GLN 20 ? NE2 ? A GLN 28 NE2 5 1 Y 1 A LYS 34 ? CG ? A LYS 42 CG 6 1 Y 1 A LYS 34 ? CD ? A LYS 42 CD 7 1 Y 1 A LYS 34 ? CE ? A LYS 42 CE 8 1 Y 1 A LYS 34 ? NZ ? A LYS 42 NZ 9 1 Y 1 A ARG 58 ? CG ? A ARG 66 CG 10 1 Y 1 A ARG 58 ? CD ? A ARG 66 CD 11 1 Y 1 A ARG 58 ? NE ? A ARG 66 NE 12 1 Y 1 A ARG 58 ? CZ ? A ARG 66 CZ 13 1 Y 1 A ARG 58 ? NH1 ? A ARG 66 NH1 14 1 Y 1 A ARG 58 ? NH2 ? A ARG 66 NH2 15 1 Y 1 A THR 68 ? OG1 ? A THR 76 OG1 16 1 Y 1 A THR 68 ? CG2 ? A THR 76 CG2 17 1 Y 1 A LYS 70 ? CG ? A LYS 78 CG 18 1 Y 1 A LYS 70 ? CD ? A LYS 78 CD 19 1 Y 1 A LYS 70 ? CE ? A LYS 78 CE 20 1 Y 1 A LYS 70 ? NZ ? A LYS 78 NZ 21 1 Y 1 A LYS 78 ? CG ? A LYS 86 CG 22 1 Y 1 A LYS 78 ? CD ? A LYS 86 CD 23 1 Y 1 A LYS 78 ? CE ? A LYS 86 CE 24 1 Y 1 A LYS 78 ? NZ ? A LYS 86 NZ 25 1 Y 1 A LYS 91 ? CG ? A LYS 99 CG 26 1 Y 1 A LYS 91 ? CD ? A LYS 99 CD 27 1 Y 1 A LYS 91 ? CE ? A LYS 99 CE 28 1 Y 1 A LYS 91 ? NZ ? A LYS 99 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -7 ? A MET 1 2 1 Y 1 A ALA -6 ? A ALA 2 3 1 Y 1 A HIS -5 ? A HIS 3 4 1 Y 1 A HIS -4 ? A HIS 4 5 1 Y 1 A ARG 61 ? A ARG 69 6 1 Y 1 A ASN 62 ? A ASN 70 7 1 Y 1 A PRO 63 ? A PRO 71 8 1 Y 1 A LYS 64 ? A LYS 72 9 1 Y 1 A THR 65 ? A THR 73 10 1 Y 1 A GLY 66 ? A GLY 74 11 1 Y 1 A GLU 67 ? A GLU 75 12 1 Y 1 A ARG 92 ? A ARG 100 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 THR N N N N 290 THR CA C N S 291 THR C C N N 292 THR O O N N 293 THR CB C N R 294 THR OG1 O N N 295 THR CG2 C N N 296 THR OXT O N N 297 THR H H N N 298 THR H2 H N N 299 THR HA H N N 300 THR HB H N N 301 THR HG1 H N N 302 THR HG21 H N N 303 THR HG22 H N N 304 THR HG23 H N N 305 THR HXT H N N 306 VAL N N N N 307 VAL CA C N S 308 VAL C C N N 309 VAL O O N N 310 VAL CB C N N 311 VAL CG1 C N N 312 VAL CG2 C N N 313 VAL OXT O N N 314 VAL H H N N 315 VAL H2 H N N 316 VAL HA H N N 317 VAL HB H N N 318 VAL HG11 H N N 319 VAL HG12 H N N 320 VAL HG13 H N N 321 VAL HG21 H N N 322 VAL HG22 H N N 323 VAL HG23 H N N 324 VAL HXT H N N 325 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 VAL N CA sing N N 293 VAL N H sing N N 294 VAL N H2 sing N N 295 VAL CA C sing N N 296 VAL CA CB sing N N 297 VAL CA HA sing N N 298 VAL C O doub N N 299 VAL C OXT sing N N 300 VAL CB CG1 sing N N 301 VAL CB CG2 sing N N 302 VAL CB HB sing N N 303 VAL CG1 HG11 sing N N 304 VAL CG1 HG12 sing N N 305 VAL CG1 HG13 sing N N 306 VAL CG2 HG21 sing N N 307 VAL CG2 HG22 sing N N 308 VAL CG2 HG23 sing N N 309 VAL OXT HXT sing N N 310 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1P71 _pdbx_initial_refinement_model.details 'PDB entry 1P71 as per MoRDa' # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #