data_6N4U
# 
_entry.id   6N4U 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.398 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   6N4U         pdb_00006n4u 10.2210/pdb6n4u/pdb 
WWPDB D_1000238148 ?            ?                   
EMDB  EMD-0343     ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2019-02-06 
2 'Structure model' 1 1 2019-03-13 
3 'Structure model' 1 2 2019-12-18 
4 'Structure model' 1 3 2023-10-11 
5 'Structure model' 1 4 2024-11-06 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'            
2 2 'Structure model' 'Database references'        
3 3 'Structure model' 'Author supporting evidence' 
4 4 'Structure model' 'Data collection'            
5 4 'Structure model' 'Database references'        
6 4 'Structure model' 'Refinement description'     
7 5 'Structure model' 'Data collection'            
8 5 'Structure model' 'Structure summary'          
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  2 'Structure model' citation                      
2  3 'Structure model' pdbx_audit_support            
3  4 'Structure model' chem_comp_atom                
4  4 'Structure model' chem_comp_bond                
5  4 'Structure model' database_2                    
6  4 'Structure model' em_3d_fitting_list            
7  4 'Structure model' pdbx_initial_refinement_model 
8  5 'Structure model' em_admin                      
9  5 'Structure model' pdbx_entry_details            
10 5 'Structure model' pdbx_modification_feature     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.journal_volume'                 
2  2 'Structure model' '_citation.page_first'                     
3  2 'Structure model' '_citation.page_last'                      
4  2 'Structure model' '_citation.year'                           
5  3 'Structure model' '_pdbx_audit_support.funding_organization' 
6  4 'Structure model' '_database_2.pdbx_DOI'                     
7  4 'Structure model' '_database_2.pdbx_database_accession'      
8  4 'Structure model' '_em_3d_fitting_list.accession_code'       
9  4 'Structure model' '_em_3d_fitting_list.source_name'          
10 4 'Structure model' '_em_3d_fitting_list.type'                 
11 5 'Structure model' '_em_admin.last_update'                    
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6N4U 
_pdbx_database_status.recvd_initial_deposition_date   2018-11-20 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'MicroED structure of Proteinase K at 2.75A resolution from a single milled crystal.' 
_pdbx_database_related.db_id          EMD-0343 
_pdbx_database_related.content_type   'associated EM volume' 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Martynowycz, M.W.' 1 0000-0003-0055-230X 
'Zhao, W.'          2 0000-0002-4441-9722 
'Hattne, J.'        3 0000-0002-8936-0912 
'Jensen, G.J.'      4 0000-0003-1556-4864 
'Gonen, T.'         5 0000-0002-9254-4069 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Structure 
_citation.journal_id_ASTM           STRUE6 
_citation.journal_id_CSD            2005 
_citation.journal_id_ISSN           1878-4186 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            27 
_citation.language                  ? 
_citation.page_first                545 
_citation.page_last                 548.e2 
_citation.title                     'Collection of Continuous Rotation MicroED Data from Ion Beam-Milled Crystals of Any Size.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.str.2018.12.003 
_citation.pdbx_database_id_PubMed   30661853 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Martynowycz, M.W.' 1 ? 
primary 'Zhao, W.'          2 ? 
primary 'Hattne, J.'        3 ? 
primary 'Jensen, G.J.'      4 ? 
primary 'Gonen, T.'         5 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Proteinase K' 28958.791 1  3.4.21.64 ? ? ? 
2 non-polymer syn 'CALCIUM ION'  40.078    2  ?         ? ? ? 
3 non-polymer syn 'SULFATE ION'  96.063    1  ?         ? ? ? 
4 water       nat water          18.015    23 ?         ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Endopeptidase K,Tritirachium alkaline proteinase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSR
TYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAG
NNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTL
GKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSR
TYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAG
NNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTL
GKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CALCIUM ION' CA  
3 'SULFATE ION' SO4 
4 water         HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ALA n 
1 3   GLN n 
1 4   THR n 
1 5   ASN n 
1 6   ALA n 
1 7   PRO n 
1 8   TRP n 
1 9   GLY n 
1 10  LEU n 
1 11  ALA n 
1 12  ARG n 
1 13  ILE n 
1 14  SER n 
1 15  SER n 
1 16  THR n 
1 17  SER n 
1 18  PRO n 
1 19  GLY n 
1 20  THR n 
1 21  SER n 
1 22  THR n 
1 23  TYR n 
1 24  TYR n 
1 25  TYR n 
1 26  ASP n 
1 27  GLU n 
1 28  SER n 
1 29  ALA n 
1 30  GLY n 
1 31  GLN n 
1 32  GLY n 
1 33  SER n 
1 34  CYS n 
1 35  VAL n 
1 36  TYR n 
1 37  VAL n 
1 38  ILE n 
1 39  ASP n 
1 40  THR n 
1 41  GLY n 
1 42  ILE n 
1 43  GLU n 
1 44  ALA n 
1 45  SER n 
1 46  HIS n 
1 47  PRO n 
1 48  GLU n 
1 49  PHE n 
1 50  GLU n 
1 51  GLY n 
1 52  ARG n 
1 53  ALA n 
1 54  GLN n 
1 55  MET n 
1 56  VAL n 
1 57  LYS n 
1 58  THR n 
1 59  TYR n 
1 60  TYR n 
1 61  TYR n 
1 62  SER n 
1 63  SER n 
1 64  ARG n 
1 65  ASP n 
1 66  GLY n 
1 67  ASN n 
1 68  GLY n 
1 69  HIS n 
1 70  GLY n 
1 71  THR n 
1 72  HIS n 
1 73  CYS n 
1 74  ALA n 
1 75  GLY n 
1 76  THR n 
1 77  VAL n 
1 78  GLY n 
1 79  SER n 
1 80  ARG n 
1 81  THR n 
1 82  TYR n 
1 83  GLY n 
1 84  VAL n 
1 85  ALA n 
1 86  LYS n 
1 87  LYS n 
1 88  THR n 
1 89  GLN n 
1 90  LEU n 
1 91  PHE n 
1 92  GLY n 
1 93  VAL n 
1 94  LYS n 
1 95  VAL n 
1 96  LEU n 
1 97  ASP n 
1 98  ASP n 
1 99  ASN n 
1 100 GLY n 
1 101 SER n 
1 102 GLY n 
1 103 GLN n 
1 104 TYR n 
1 105 SER n 
1 106 THR n 
1 107 ILE n 
1 108 ILE n 
1 109 ALA n 
1 110 GLY n 
1 111 MET n 
1 112 ASP n 
1 113 PHE n 
1 114 VAL n 
1 115 ALA n 
1 116 SER n 
1 117 ASP n 
1 118 LYS n 
1 119 ASN n 
1 120 ASN n 
1 121 ARG n 
1 122 ASN n 
1 123 CYS n 
1 124 PRO n 
1 125 LYS n 
1 126 GLY n 
1 127 VAL n 
1 128 VAL n 
1 129 ALA n 
1 130 SER n 
1 131 LEU n 
1 132 SER n 
1 133 LEU n 
1 134 GLY n 
1 135 GLY n 
1 136 GLY n 
1 137 TYR n 
1 138 SER n 
1 139 SER n 
1 140 SER n 
1 141 VAL n 
1 142 ASN n 
1 143 SER n 
1 144 ALA n 
1 145 ALA n 
1 146 ALA n 
1 147 ARG n 
1 148 LEU n 
1 149 GLN n 
1 150 SER n 
1 151 SER n 
1 152 GLY n 
1 153 VAL n 
1 154 MET n 
1 155 VAL n 
1 156 ALA n 
1 157 VAL n 
1 158 ALA n 
1 159 ALA n 
1 160 GLY n 
1 161 ASN n 
1 162 ASN n 
1 163 ASN n 
1 164 ALA n 
1 165 ASP n 
1 166 ALA n 
1 167 ARG n 
1 168 ASN n 
1 169 TYR n 
1 170 SER n 
1 171 PRO n 
1 172 ALA n 
1 173 SER n 
1 174 GLU n 
1 175 PRO n 
1 176 SER n 
1 177 VAL n 
1 178 CYS n 
1 179 THR n 
1 180 VAL n 
1 181 GLY n 
1 182 ALA n 
1 183 SER n 
1 184 ASP n 
1 185 ARG n 
1 186 TYR n 
1 187 ASP n 
1 188 ARG n 
1 189 ARG n 
1 190 SER n 
1 191 SER n 
1 192 PHE n 
1 193 SER n 
1 194 ASN n 
1 195 TYR n 
1 196 GLY n 
1 197 SER n 
1 198 VAL n 
1 199 LEU n 
1 200 ASP n 
1 201 ILE n 
1 202 PHE n 
1 203 GLY n 
1 204 PRO n 
1 205 GLY n 
1 206 THR n 
1 207 ASP n 
1 208 ILE n 
1 209 LEU n 
1 210 SER n 
1 211 THR n 
1 212 TRP n 
1 213 ILE n 
1 214 GLY n 
1 215 GLY n 
1 216 SER n 
1 217 THR n 
1 218 ARG n 
1 219 SER n 
1 220 ILE n 
1 221 SER n 
1 222 GLY n 
1 223 THR n 
1 224 SER n 
1 225 MET n 
1 226 ALA n 
1 227 THR n 
1 228 PRO n 
1 229 HIS n 
1 230 VAL n 
1 231 ALA n 
1 232 GLY n 
1 233 LEU n 
1 234 ALA n 
1 235 ALA n 
1 236 TYR n 
1 237 LEU n 
1 238 MET n 
1 239 THR n 
1 240 LEU n 
1 241 GLY n 
1 242 LYS n 
1 243 THR n 
1 244 THR n 
1 245 ALA n 
1 246 ALA n 
1 247 SER n 
1 248 ALA n 
1 249 CYS n 
1 250 ARG n 
1 251 TYR n 
1 252 ILE n 
1 253 ALA n 
1 254 ASP n 
1 255 THR n 
1 256 ALA n 
1 257 ASN n 
1 258 LYS n 
1 259 GLY n 
1 260 ASP n 
1 261 LEU n 
1 262 SER n 
1 263 ASN n 
1 264 ILE n 
1 265 PRO n 
1 266 PHE n 
1 267 GLY n 
1 268 THR n 
1 269 VAL n 
1 270 ASN n 
1 271 LEU n 
1 272 LEU n 
1 273 ALA n 
1 274 TYR n 
1 275 ASN n 
1 276 ASN n 
1 277 TYR n 
1 278 GLN n 
1 279 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   279 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 PROK 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Engyodontium album' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     37998 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Engyodontium album' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     37998 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   1   ALA ALA A . n 
A 1 2   ALA 2   2   2   ALA ALA A . n 
A 1 3   GLN 3   3   3   GLN GLN A . n 
A 1 4   THR 4   4   4   THR THR A . n 
A 1 5   ASN 5   5   5   ASN ASN A . n 
A 1 6   ALA 6   6   6   ALA ALA A . n 
A 1 7   PRO 7   7   7   PRO PRO A . n 
A 1 8   TRP 8   8   8   TRP TRP A . n 
A 1 9   GLY 9   9   9   GLY GLY A . n 
A 1 10  LEU 10  10  10  LEU LEU A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  ARG 12  12  12  ARG ARG A . n 
A 1 13  ILE 13  13  13  ILE ILE A . n 
A 1 14  SER 14  14  14  SER SER A . n 
A 1 15  SER 15  15  15  SER SER A . n 
A 1 16  THR 16  16  16  THR THR A . n 
A 1 17  SER 17  17  17  SER SER A . n 
A 1 18  PRO 18  18  18  PRO PRO A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  THR 20  20  20  THR THR A . n 
A 1 21  SER 21  21  21  SER SER A . n 
A 1 22  THR 22  22  22  THR THR A . n 
A 1 23  TYR 23  23  23  TYR TYR A . n 
A 1 24  TYR 24  24  24  TYR TYR A . n 
A 1 25  TYR 25  25  25  TYR TYR A . n 
A 1 26  ASP 26  26  26  ASP ASP A . n 
A 1 27  GLU 27  27  27  GLU GLU A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  GLY 30  30  30  GLY GLY A . n 
A 1 31  GLN 31  31  31  GLN GLN A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  SER 33  33  33  SER SER A . n 
A 1 34  CYS 34  34  34  CYS CYS A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  TYR 36  36  36  TYR TYR A . n 
A 1 37  VAL 37  37  37  VAL VAL A . n 
A 1 38  ILE 38  38  38  ILE ILE A . n 
A 1 39  ASP 39  39  39  ASP ASP A . n 
A 1 40  THR 40  40  40  THR THR A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ILE 42  42  42  ILE ILE A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  SER 45  45  45  SER SER A . n 
A 1 46  HIS 46  46  46  HIS HIS A . n 
A 1 47  PRO 47  47  47  PRO PRO A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  PHE 49  49  49  PHE PHE A . n 
A 1 50  GLU 50  50  50  GLU GLU A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  ARG 52  52  52  ARG ARG A . n 
A 1 53  ALA 53  53  53  ALA ALA A . n 
A 1 54  GLN 54  54  54  GLN GLN A . n 
A 1 55  MET 55  55  55  MET MET A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  LYS 57  57  57  LYS LYS A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  TYR 59  59  59  TYR TYR A . n 
A 1 60  TYR 60  60  60  TYR TYR A . n 
A 1 61  TYR 61  61  61  TYR TYR A . n 
A 1 62  SER 62  62  62  SER SER A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  ARG 64  64  64  ARG ARG A . n 
A 1 65  ASP 65  65  65  ASP ASP A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  ASN 67  67  67  ASN ASN A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  HIS 69  69  69  HIS HIS A . n 
A 1 70  GLY 70  70  70  GLY GLY A . n 
A 1 71  THR 71  71  71  THR THR A . n 
A 1 72  HIS 72  72  72  HIS HIS A . n 
A 1 73  CYS 73  73  73  CYS CYS A . n 
A 1 74  ALA 74  74  74  ALA ALA A . n 
A 1 75  GLY 75  75  75  GLY GLY A . n 
A 1 76  THR 76  76  76  THR THR A . n 
A 1 77  VAL 77  77  77  VAL VAL A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  ARG 80  80  80  ARG ARG A . n 
A 1 81  THR 81  81  81  THR THR A . n 
A 1 82  TYR 82  82  82  TYR TYR A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  VAL 84  84  84  VAL VAL A . n 
A 1 85  ALA 85  85  85  ALA ALA A . n 
A 1 86  LYS 86  86  86  LYS LYS A . n 
A 1 87  LYS 87  87  87  LYS LYS A . n 
A 1 88  THR 88  88  88  THR THR A . n 
A 1 89  GLN 89  89  89  GLN GLN A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  PHE 91  91  91  PHE PHE A . n 
A 1 92  GLY 92  92  92  GLY GLY A . n 
A 1 93  VAL 93  93  93  VAL VAL A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  VAL 95  95  95  VAL VAL A . n 
A 1 96  LEU 96  96  96  LEU LEU A . n 
A 1 97  ASP 97  97  97  ASP ASP A . n 
A 1 98  ASP 98  98  98  ASP ASP A . n 
A 1 99  ASN 99  99  99  ASN ASN A . n 
A 1 100 GLY 100 100 100 GLY GLY A . n 
A 1 101 SER 101 101 101 SER SER A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 GLN 103 103 103 GLN GLN A . n 
A 1 104 TYR 104 104 104 TYR TYR A . n 
A 1 105 SER 105 105 105 SER SER A . n 
A 1 106 THR 106 106 106 THR THR A . n 
A 1 107 ILE 107 107 107 ILE ILE A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 GLY 110 110 110 GLY GLY A . n 
A 1 111 MET 111 111 111 MET MET A . n 
A 1 112 ASP 112 112 112 ASP ASP A . n 
A 1 113 PHE 113 113 113 PHE PHE A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 ALA 115 115 115 ALA ALA A . n 
A 1 116 SER 116 116 116 SER SER A . n 
A 1 117 ASP 117 117 117 ASP ASP A . n 
A 1 118 LYS 118 118 118 LYS LYS A . n 
A 1 119 ASN 119 119 119 ASN ASN A . n 
A 1 120 ASN 120 120 120 ASN ASN A . n 
A 1 121 ARG 121 121 121 ARG ARG A . n 
A 1 122 ASN 122 122 122 ASN ASN A . n 
A 1 123 CYS 123 123 123 CYS CYS A . n 
A 1 124 PRO 124 124 124 PRO PRO A . n 
A 1 125 LYS 125 125 125 LYS LYS A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 SER 130 130 130 SER SER A . n 
A 1 131 LEU 131 131 131 LEU LEU A . n 
A 1 132 SER 132 132 132 SER SER A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 GLY 134 134 134 GLY GLY A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 GLY 136 136 136 GLY GLY A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 SER 138 138 138 SER SER A . n 
A 1 139 SER 139 139 139 SER SER A . n 
A 1 140 SER 140 140 140 SER SER A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 ASN 142 142 142 ASN ASN A . n 
A 1 143 SER 143 143 143 SER SER A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 ALA 146 146 146 ALA ALA A . n 
A 1 147 ARG 147 147 147 ARG ARG A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 GLN 149 149 149 GLN GLN A . n 
A 1 150 SER 150 150 150 SER SER A . n 
A 1 151 SER 151 151 151 SER SER A . n 
A 1 152 GLY 152 152 152 GLY GLY A . n 
A 1 153 VAL 153 153 153 VAL VAL A . n 
A 1 154 MET 154 154 154 MET MET A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 ALA 156 156 156 ALA ALA A . n 
A 1 157 VAL 157 157 157 VAL VAL A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 ALA 159 159 159 ALA ALA A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 ASN 161 161 161 ASN ASN A . n 
A 1 162 ASN 162 162 162 ASN ASN A . n 
A 1 163 ASN 163 163 163 ASN ASN A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 ASP 165 165 165 ASP ASP A . n 
A 1 166 ALA 166 166 166 ALA ALA A . n 
A 1 167 ARG 167 167 167 ARG ARG A . n 
A 1 168 ASN 168 168 168 ASN ASN A . n 
A 1 169 TYR 169 169 169 TYR TYR A . n 
A 1 170 SER 170 170 170 SER SER A . n 
A 1 171 PRO 171 171 171 PRO PRO A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 SER 173 173 173 SER SER A . n 
A 1 174 GLU 174 174 174 GLU GLU A . n 
A 1 175 PRO 175 175 175 PRO PRO A . n 
A 1 176 SER 176 176 176 SER SER A . n 
A 1 177 VAL 177 177 177 VAL VAL A . n 
A 1 178 CYS 178 178 178 CYS CYS A . n 
A 1 179 THR 179 179 179 THR THR A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 GLY 181 181 181 GLY GLY A . n 
A 1 182 ALA 182 182 182 ALA ALA A . n 
A 1 183 SER 183 183 183 SER SER A . n 
A 1 184 ASP 184 184 184 ASP ASP A . n 
A 1 185 ARG 185 185 185 ARG ARG A . n 
A 1 186 TYR 186 186 186 TYR TYR A . n 
A 1 187 ASP 187 187 187 ASP ASP A . n 
A 1 188 ARG 188 188 188 ARG ARG A . n 
A 1 189 ARG 189 189 189 ARG ARG A . n 
A 1 190 SER 190 190 190 SER SER A . n 
A 1 191 SER 191 191 191 SER SER A . n 
A 1 192 PHE 192 192 192 PHE PHE A . n 
A 1 193 SER 193 193 193 SER SER A . n 
A 1 194 ASN 194 194 194 ASN ASN A . n 
A 1 195 TYR 195 195 195 TYR TYR A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 SER 197 197 197 SER SER A . n 
A 1 198 VAL 198 198 198 VAL VAL A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 ASP 200 200 200 ASP ASP A . n 
A 1 201 ILE 201 201 201 ILE ILE A . n 
A 1 202 PHE 202 202 202 PHE PHE A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 PRO 204 204 204 PRO PRO A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 THR 206 206 206 THR THR A . n 
A 1 207 ASP 207 207 207 ASP ASP A . n 
A 1 208 ILE 208 208 208 ILE ILE A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 SER 210 210 210 SER SER A . n 
A 1 211 THR 211 211 211 THR THR A . n 
A 1 212 TRP 212 212 212 TRP TRP A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 GLY 215 215 215 GLY GLY A . n 
A 1 216 SER 216 216 216 SER SER A . n 
A 1 217 THR 217 217 217 THR THR A . n 
A 1 218 ARG 218 218 218 ARG ARG A . n 
A 1 219 SER 219 219 219 SER SER A . n 
A 1 220 ILE 220 220 220 ILE ILE A . n 
A 1 221 SER 221 221 221 SER SER A . n 
A 1 222 GLY 222 222 222 GLY GLY A . n 
A 1 223 THR 223 223 223 THR THR A . n 
A 1 224 SER 224 224 224 SER SER A . n 
A 1 225 MET 225 225 225 MET MET A . n 
A 1 226 ALA 226 226 226 ALA ALA A . n 
A 1 227 THR 227 227 227 THR THR A . n 
A 1 228 PRO 228 228 228 PRO PRO A . n 
A 1 229 HIS 229 229 229 HIS HIS A . n 
A 1 230 VAL 230 230 230 VAL VAL A . n 
A 1 231 ALA 231 231 231 ALA ALA A . n 
A 1 232 GLY 232 232 232 GLY GLY A . n 
A 1 233 LEU 233 233 233 LEU LEU A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 ALA 235 235 235 ALA ALA A . n 
A 1 236 TYR 236 236 236 TYR TYR A . n 
A 1 237 LEU 237 237 237 LEU LEU A . n 
A 1 238 MET 238 238 238 MET MET A . n 
A 1 239 THR 239 239 239 THR THR A . n 
A 1 240 LEU 240 240 240 LEU LEU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 LYS 242 242 242 LYS LYS A . n 
A 1 243 THR 243 243 243 THR THR A . n 
A 1 244 THR 244 244 244 THR THR A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 ALA 246 246 246 ALA ALA A . n 
A 1 247 SER 247 247 247 SER SER A . n 
A 1 248 ALA 248 248 248 ALA ALA A . n 
A 1 249 CYS 249 249 249 CYS CYS A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 TYR 251 251 251 TYR TYR A . n 
A 1 252 ILE 252 252 252 ILE ILE A . n 
A 1 253 ALA 253 253 253 ALA ALA A . n 
A 1 254 ASP 254 254 254 ASP ASP A . n 
A 1 255 THR 255 255 255 THR THR A . n 
A 1 256 ALA 256 256 256 ALA ALA A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 LYS 258 258 258 LYS LYS A . n 
A 1 259 GLY 259 259 259 GLY GLY A . n 
A 1 260 ASP 260 260 260 ASP ASP A . n 
A 1 261 LEU 261 261 261 LEU LEU A . n 
A 1 262 SER 262 262 262 SER SER A . n 
A 1 263 ASN 263 263 263 ASN ASN A . n 
A 1 264 ILE 264 264 264 ILE ILE A . n 
A 1 265 PRO 265 265 265 PRO PRO A . n 
A 1 266 PHE 266 266 266 PHE PHE A . n 
A 1 267 GLY 267 267 267 GLY GLY A . n 
A 1 268 THR 268 268 268 THR THR A . n 
A 1 269 VAL 269 269 269 VAL VAL A . n 
A 1 270 ASN 270 270 270 ASN ASN A . n 
A 1 271 LEU 271 271 271 LEU LEU A . n 
A 1 272 LEU 272 272 272 LEU LEU A . n 
A 1 273 ALA 273 273 273 ALA ALA A . n 
A 1 274 TYR 274 274 274 TYR TYR A . n 
A 1 275 ASN 275 275 275 ASN ASN A . n 
A 1 276 ASN 276 276 276 ASN ASN A . n 
A 1 277 TYR 277 277 277 TYR TYR A . n 
A 1 278 GLN 278 278 278 GLN GLN A . n 
A 1 279 ALA 279 279 279 ALA ALA A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CA  1  301 2  CA  CA  A . 
C 2 CA  1  302 3  CA  CA  A . 
D 3 SO4 1  303 1  SO4 SO4 A . 
E 4 HOH 1  401 6  HOH HOH A . 
E 4 HOH 2  402 45 HOH HOH A . 
E 4 HOH 3  403 3  HOH HOH A . 
E 4 HOH 4  404 13 HOH HOH A . 
E 4 HOH 5  405 4  HOH HOH A . 
E 4 HOH 6  406 11 HOH HOH A . 
E 4 HOH 7  407 40 HOH HOH A . 
E 4 HOH 8  408 38 HOH HOH A . 
E 4 HOH 9  409 37 HOH HOH A . 
E 4 HOH 10 410 7  HOH HOH A . 
E 4 HOH 11 411 19 HOH HOH A . 
E 4 HOH 12 412 12 HOH HOH A . 
E 4 HOH 13 413 50 HOH HOH A . 
E 4 HOH 14 414 53 HOH HOH A . 
E 4 HOH 15 415 9  HOH HOH A . 
E 4 HOH 16 416 25 HOH HOH A . 
E 4 HOH 17 417 30 HOH HOH A . 
E 4 HOH 18 418 33 HOH HOH A . 
E 4 HOH 19 419 54 HOH HOH A . 
E 4 HOH 20 420 31 HOH HOH A . 
E 4 HOH 21 421 44 HOH HOH A . 
E 4 HOH 22 422 14 HOH HOH A . 
E 4 HOH 23 423 26 HOH HOH A . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A ARG 64 ? NE  ? A ARG 64 NE  
2 1 Y 1 A ARG 64 ? CZ  ? A ARG 64 CZ  
3 1 Y 1 A ARG 64 ? NH1 ? A ARG 64 NH1 
4 1 Y 1 A ARG 64 ? NH2 ? A ARG 64 NH2 
# 
_software.citation_id            ? 
_software.classification         refinement 
_software.compiler_name          ? 
_software.compiler_version       ? 
_software.contact_author         ? 
_software.contact_author_email   ? 
_software.date                   ? 
_software.description            ? 
_software.dependencies           ? 
_software.hardware               ? 
_software.language               ? 
_software.location               ? 
_software.mods                   ? 
_software.name                   PHENIX 
_software.os                     ? 
_software.os_version             ? 
_software.type                   ? 
_software.version                '(1.14_3260: ???)' 
_software.pdbx_ordinal           1 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6N4U 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     67.460 
_cell.length_a_esd                 ? 
_cell.length_b                     67.460 
_cell.length_b_esd                 ? 
_cell.length_c                     106.670 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6N4U 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6N4U 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON CRYSTALLOGRAPHY' 
_exptl.method_details             ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6N4U 
_refine.pdbx_refine_id                           'ELECTRON CRYSTALLOGRAPHY' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.750 
_refine.ls_d_res_low                             43.546 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     6008 
_refine.ls_number_reflns_R_free                  383 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    87.76 
_refine.ls_percent_reflns_R_free                 6.37 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2393 
_refine.ls_R_factor_R_free                       0.2626 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2377 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      6CL7 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            'From 5I9S' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 24.25 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.36 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON CRYSTALLOGRAPHY' ? 0.005  ? 2072 ? f_bond_d           ? ? 
'ELECTRON CRYSTALLOGRAPHY' ? 0.697  ? 2818 ? f_angle_d          ? ? 
'ELECTRON CRYSTALLOGRAPHY' ? 14.908 ? 720  ? f_dihedral_angle_d ? ? 
'ELECTRON CRYSTALLOGRAPHY' ? 0.044  ? 312  ? f_chiral_restr     ? ? 
'ELECTRON CRYSTALLOGRAPHY' ? 0.004  ? 370  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'ELECTRON CRYSTALLOGRAPHY' 2.7504 3.1483  . . 124 1831 89.00 . . . 0.3362 . 0.3032 . . . . . . . . . . 
'ELECTRON CRYSTALLOGRAPHY' 3.1483 3.9661  . . 126 1870 88.00 . . . 0.2560 . 0.2408 . . . . . . . . . . 
'ELECTRON CRYSTALLOGRAPHY' 3.9661 43.5511 . . 133 1924 87.00 . . . 0.2331 . 0.2047 . . . . . . . . . . 
# 
_struct.entry_id                     6N4U 
_struct.title                        'MicroED structure of Proteinase K at 2.75A resolution from a single milled crystal.' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6N4U 
_struct_keywords.text            'broad-spectrum serum proteinase, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PRTK_PARAQ 
_struct_ref.pdbx_db_accession          P06873 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSR
TYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAG
NNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTL
GKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
;
_struct_ref.pdbx_align_begin           106 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6N4U 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 279 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P06873 
_struct_ref_seq.db_align_beg                  106 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  384 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       279 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             6N4U 
_struct_ref_seq_dif.mon_id                       ASP 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      207 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P06873 
_struct_ref_seq_dif.db_mon_id                    SER 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          312 
_struct_ref_seq_dif.details                      conflict 
_struct_ref_seq_dif.pdbx_auth_seq_num            207 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 260   ? 
1 MORE         -21   ? 
1 'SSA (A^2)'  10120 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 PRO A 7   ? SER A 14  ? PRO A 7   SER A 14  1 ? 8  
HELX_P HELX_P2 AA2 GLY A 68  ? SER A 79  ? GLY A 68  SER A 79  1 ? 12 
HELX_P HELX_P3 AA3 GLN A 103 ? LYS A 118 ? GLN A 103 LYS A 118 1 ? 16 
HELX_P HELX_P4 AA4 ASN A 119 ? ARG A 121 ? ASN A 119 ARG A 121 5 ? 3  
HELX_P HELX_P5 AA5 SER A 138 ? SER A 151 ? SER A 138 SER A 151 1 ? 14 
HELX_P HELX_P6 AA6 ASP A 165 ? ARG A 167 ? ASP A 165 ARG A 167 5 ? 3  
HELX_P HELX_P7 AA7 GLY A 222 ? LEU A 240 ? GLY A 222 LEU A 240 1 ? 19 
HELX_P HELX_P8 AA8 THR A 244 ? ALA A 246 ? THR A 244 ALA A 246 5 ? 3  
HELX_P HELX_P9 AA9 SER A 247 ? THR A 255 ? SER A 247 THR A 255 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ? ? A CYS 34  SG  ? ? ? 1_555 A CYS 123 SG ? ? A CYS 34  A CYS 123 1_555 ? ? ? ? ? ? ? 2.025 ? ? 
disulf2 disulf ? ? A CYS 178 SG  ? ? ? 1_555 A CYS 249 SG ? ? A CYS 178 A CYS 249 1_555 ? ? ? ? ? ? ? 2.036 ? ? 
metalc1 metalc ? ? A ASP 39  OD2 ? ? ? 1_555 B CA  .   CA ? ? A ASP 39  A CA  301 1_555 ? ? ? ? ? ? ? 2.961 ? ? 
metalc2 metalc ? ? A HIS 69  O   ? ? ? 1_555 B CA  .   CA ? ? A HIS 69  A CA  301 1_555 ? ? ? ? ? ? ? 2.646 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
_pdbx_struct_conn_angle.id                    1 
_pdbx_struct_conn_angle.ptnr1_label_atom_id   OD2 
_pdbx_struct_conn_angle.ptnr1_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr1_label_asym_id   A 
_pdbx_struct_conn_angle.ptnr1_label_comp_id   ASP 
_pdbx_struct_conn_angle.ptnr1_label_seq_id    39 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id    ASP 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id     39 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr1_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr2_label_atom_id   CA 
_pdbx_struct_conn_angle.ptnr2_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr2_label_asym_id   B 
_pdbx_struct_conn_angle.ptnr2_label_comp_id   CA 
_pdbx_struct_conn_angle.ptnr2_label_seq_id    . 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id    CA 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id     301 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr2_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr3_label_atom_id   O 
_pdbx_struct_conn_angle.ptnr3_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr3_label_asym_id   A 
_pdbx_struct_conn_angle.ptnr3_label_comp_id   HIS 
_pdbx_struct_conn_angle.ptnr3_label_seq_id    69 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id    HIS 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id     69 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr3_symmetry        1_555 
_pdbx_struct_conn_angle.value                 100.2 
_pdbx_struct_conn_angle.value_esd             ? 
# 
loop_
_pdbx_modification_feature.ordinal 
_pdbx_modification_feature.label_comp_id 
_pdbx_modification_feature.label_asym_id 
_pdbx_modification_feature.label_seq_id 
_pdbx_modification_feature.label_alt_id 
_pdbx_modification_feature.modified_residue_label_comp_id 
_pdbx_modification_feature.modified_residue_label_asym_id 
_pdbx_modification_feature.modified_residue_label_seq_id 
_pdbx_modification_feature.modified_residue_label_alt_id 
_pdbx_modification_feature.auth_comp_id 
_pdbx_modification_feature.auth_asym_id 
_pdbx_modification_feature.auth_seq_id 
_pdbx_modification_feature.PDB_ins_code 
_pdbx_modification_feature.symmetry 
_pdbx_modification_feature.modified_residue_auth_comp_id 
_pdbx_modification_feature.modified_residue_auth_asym_id 
_pdbx_modification_feature.modified_residue_auth_seq_id 
_pdbx_modification_feature.modified_residue_PDB_ins_code 
_pdbx_modification_feature.modified_residue_symmetry 
_pdbx_modification_feature.comp_id_linking_atom 
_pdbx_modification_feature.modified_residue_id_linking_atom 
_pdbx_modification_feature.modified_residue_id 
_pdbx_modification_feature.ref_pcm_id 
_pdbx_modification_feature.ref_comp_id 
_pdbx_modification_feature.type 
_pdbx_modification_feature.category 
1 CYS A 34  ? CYS A 123 ? CYS A 34  ? 1_555 CYS A 123 ? 1_555 SG SG . . . None 'Disulfide bridge' 
2 CYS A 178 ? CYS A 249 ? CYS A 178 ? 1_555 CYS A 249 ? 1_555 SG SG . . . None 'Disulfide bridge' 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           170 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            170 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    171 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     171 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -2.70 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 7 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? parallel      
AA2 2 3 ? parallel      
AA2 3 4 ? parallel      
AA2 4 5 ? parallel      
AA2 5 6 ? parallel      
AA2 6 7 ? parallel      
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ALA A 2   ? GLN A 3   ? ALA A 2   GLN A 3   
AA1 2 TYR A 23  ? TYR A 24  ? TYR A 23  TYR A 24  
AA2 1 ALA A 53  ? THR A 58  ? ALA A 53  THR A 58  
AA2 2 GLN A 89  ? LYS A 94  ? GLN A 89  LYS A 94  
AA2 3 SER A 33  ? ASP A 39  ? SER A 33  ASP A 39  
AA2 4 GLY A 126 ? LEU A 131 ? GLY A 126 LEU A 131 
AA2 5 VAL A 153 ? ALA A 158 ? VAL A 153 ALA A 158 
AA2 6 CYS A 178 ? SER A 183 ? CYS A 178 SER A 183 
AA2 7 ILE A 201 ? PRO A 204 ? ILE A 201 PRO A 204 
AA3 1 GLY A 135 ? GLY A 136 ? GLY A 135 GLY A 136 
AA3 2 TYR A 169 ? SER A 170 ? TYR A 169 SER A 170 
AA4 1 ILE A 208 ? TRP A 212 ? ILE A 208 TRP A 212 
AA4 2 SER A 216 ? ILE A 220 ? SER A 216 ILE A 220 
AA5 1 ASN A 257 ? LYS A 258 ? ASN A 257 LYS A 258 
AA5 2 LEU A 271 ? LEU A 272 ? LEU A 271 LEU A 272 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLN A 3   ? N GLN A 3   O TYR A 23  ? O TYR A 23  
AA2 1 2 N GLN A 54  ? N GLN A 54  O GLY A 92  ? O GLY A 92  
AA2 2 3 O PHE A 91  ? O PHE A 91  N VAL A 37  ? N VAL A 37  
AA2 3 4 N TYR A 36  ? N TYR A 36  O VAL A 128 ? O VAL A 128 
AA2 4 5 N ALA A 129 ? N ALA A 129 O ALA A 156 ? O ALA A 156 
AA2 5 6 N VAL A 157 ? N VAL A 157 O CYS A 178 ? O CYS A 178 
AA2 6 7 N SER A 183 ? N SER A 183 O GLY A 203 ? O GLY A 203 
AA3 1 2 N GLY A 135 ? N GLY A 135 O SER A 170 ? O SER A 170 
AA4 1 2 N TRP A 212 ? N TRP A 212 O SER A 216 ? O SER A 216 
AA5 1 2 N ASN A 257 ? N ASN A 257 O LEU A 272 ? O LEU A 272 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A CA  301 ? 4 'binding site for residue CA A 301'  
AC2 Software A CA  302 ? 1 'binding site for residue CA A 302'  
AC3 Software A SO4 303 ? 3 'binding site for residue SO4 A 303' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 ASP A 39  ? ASP A 39  . ? 1_555 ? 
2 AC1 4 HIS A 69  ? HIS A 69  . ? 1_555 ? 
3 AC1 4 CYS A 73  ? CYS A 73  . ? 1_555 ? 
4 AC1 4 MET A 225 ? MET A 225 . ? 1_555 ? 
5 AC2 1 ASN A 270 ? ASN A 270 . ? 1_555 ? 
6 AC3 3 PRO A 7   ? PRO A 7   . ? 1_555 ? 
7 AC3 3 TRP A 8   ? TRP A 8   . ? 1_555 ? 
8 AC3 3 ARG A 185 ? ARG A 185 . ? 1_555 ? 
# 
_pdbx_entry_details.entry_id                   6N4U 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 39  ? ? -148.09 -133.69 
2 1 TYR A 60  ? ? -116.92 -139.04 
3 1 ALA A 85  ? ? -104.04 78.45   
4 1 ASP A 98  ? ? -62.47  0.52    
5 1 ASN A 161 ? ? -106.82 46.79   
6 1 ALA A 256 ? ? -82.30  -159.94 
7 1 ASN A 270 ? ? -119.53 66.91   
# 
_em_3d_fitting.entry_id          6N4U 
_em_3d_fitting.id                1 
_em_3d_fitting.details           ? 
_em_3d_fitting.overall_b_value   21.10 
_em_3d_fitting.ref_protocol      'RIGID BODY FIT' 
_em_3d_fitting.ref_space         RECIPROCAL 
_em_3d_fitting.target_criteria   R 
_em_3d_fitting.method            ? 
# 
_em_3d_fitting_list.3d_fitting_id                 1 
_em_3d_fitting_list.id                            1 
_em_3d_fitting_list.details                       ? 
_em_3d_fitting_list.pdb_chain_id                  ? 
_em_3d_fitting_list.pdb_chain_residue_range       ? 
_em_3d_fitting_list.pdb_entry_id                  5I9S 
_em_3d_fitting_list.initial_refinement_model_id   ? 
_em_3d_fitting_list.chain_id                      ? 
_em_3d_fitting_list.chain_residue_range           ? 
_em_3d_fitting_list.source_name                   PDB 
_em_3d_fitting_list.type                          'experimental model' 
_em_3d_fitting_list.accession_code                5I9S 
# 
_em_3d_reconstruction.entry_id                    6N4U 
_em_3d_reconstruction.id                          1 
_em_3d_reconstruction.algorithm                   ? 
_em_3d_reconstruction.details                     ? 
_em_3d_reconstruction.refinement_type             ? 
_em_3d_reconstruction.image_processing_id         1 
_em_3d_reconstruction.num_class_averages          ? 
_em_3d_reconstruction.num_particles               ? 
_em_3d_reconstruction.resolution                  2.75 
_em_3d_reconstruction.resolution_method           'DIFFRACTION PATTERN/LAYERLINES' 
_em_3d_reconstruction.symmetry_type               '3D CRYSTAL' 
_em_3d_reconstruction.method                      ? 
_em_3d_reconstruction.nominal_pixel_size          ? 
_em_3d_reconstruction.actual_pixel_size           ? 
_em_3d_reconstruction.magnification_calibration   ? 
# 
_em_buffer.id            1 
_em_buffer.details       ? 
_em_buffer.pH            7.5 
_em_buffer.specimen_id   1 
_em_buffer.name          ? 
# 
_em_entity_assembly.id                   1 
_em_entity_assembly.parent_id            0 
_em_entity_assembly.details              ? 
_em_entity_assembly.name                 'Proteinase K' 
_em_entity_assembly.source               NATURAL 
_em_entity_assembly.type                 'ORGANELLE OR CELLULAR COMPONENT' 
_em_entity_assembly.entity_id_list       1 
_em_entity_assembly.synonym              ? 
_em_entity_assembly.oligomeric_details   ? 
# 
_em_image_scans.entry_id                6N4U 
_em_image_scans.id                      1 
_em_image_scans.dimension_height        4096 
_em_image_scans.dimension_width         4096 
_em_image_scans.frames_per_image        ? 
_em_image_scans.image_recording_id      1 
_em_image_scans.sampling_size           28 
_em_image_scans.scanner_model           ? 
_em_image_scans.used_frames_per_image   ? 
_em_image_scans.citation_id             ? 
_em_image_scans.number_digital_images   ? 
_em_image_scans.od_range                ? 
_em_image_scans.quant_bit_size          ? 
_em_image_scans.details                 ? 
# 
_em_imaging.id                              1 
_em_imaging.entry_id                        6N4U 
_em_imaging.accelerating_voltage            200 
_em_imaging.alignment_procedure             BASIC 
_em_imaging.c2_aperture_diameter            100 
_em_imaging.calibrated_defocus_max          ? 
_em_imaging.calibrated_defocus_min          ? 
_em_imaging.calibrated_magnification        ? 
_em_imaging.cryogen                         NITROGEN 
_em_imaging.details                         ? 
_em_imaging.electron_source                 'FIELD EMISSION GUN' 
_em_imaging.illumination_mode               'FLOOD BEAM' 
_em_imaging.microscope_model                'FEI TALOS ARCTICA' 
_em_imaging.mode                            DIFFRACTION 
_em_imaging.nominal_cs                      ? 
_em_imaging.nominal_defocus_max             ? 
_em_imaging.nominal_defocus_min             ? 
_em_imaging.nominal_magnification           ? 
_em_imaging.recording_temperature_maximum   90 
_em_imaging.recording_temperature_minimum   77 
_em_imaging.residual_tilt                   ? 
_em_imaging.specimen_holder_model           'FEI TITAN KRIOS AUTOGRID HOLDER' 
_em_imaging.specimen_id                     1 
_em_imaging.citation_id                     ? 
_em_imaging.date                            ? 
_em_imaging.temperature                     ? 
_em_imaging.tilt_angle_min                  ? 
_em_imaging.tilt_angle_max                  ? 
_em_imaging.astigmatism                     ? 
_em_imaging.detector_distance               ? 
_em_imaging.electron_beam_tilt_params       ? 
_em_imaging.specimen_holder_type            ? 
# 
_em_sample_support.id               1 
_em_sample_support.specimen_id      1 
_em_sample_support.details          ? 
_em_sample_support.grid_material    COPPER 
_em_sample_support.grid_mesh_size   200 
_em_sample_support.grid_type        'Quantifoil R2/2' 
_em_sample_support.method           ? 
_em_sample_support.film_material    ? 
# 
_em_vitrification.id                    1 
_em_vitrification.specimen_id           1 
_em_vitrification.chamber_temperature   273.0 
_em_vitrification.cryogen_name          ETHANE 
_em_vitrification.details               ? 
_em_vitrification.humidity              100 
_em_vitrification.instrument            'FEI VITROBOT MARK IV' 
_em_vitrification.entry_id              6N4U 
_em_vitrification.citation_id           ? 
_em_vitrification.method                ? 
_em_vitrification.temp                  ? 
_em_vitrification.time_resolved_state   ? 
# 
_em_experiment.entry_id                6N4U 
_em_experiment.id                      1 
_em_experiment.aggregation_state       '3D ARRAY' 
_em_experiment.reconstruction_method   CRYSTALLOGRAPHY 
_em_experiment.entity_assembly_id      1 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
CA  CA   CA N N 74  
CYS N    N  N N 75  
CYS CA   C  N R 76  
CYS C    C  N N 77  
CYS O    O  N N 78  
CYS CB   C  N N 79  
CYS SG   S  N N 80  
CYS OXT  O  N N 81  
CYS H    H  N N 82  
CYS H2   H  N N 83  
CYS HA   H  N N 84  
CYS HB2  H  N N 85  
CYS HB3  H  N N 86  
CYS HG   H  N N 87  
CYS HXT  H  N N 88  
GLN N    N  N N 89  
GLN CA   C  N S 90  
GLN C    C  N N 91  
GLN O    O  N N 92  
GLN CB   C  N N 93  
GLN CG   C  N N 94  
GLN CD   C  N N 95  
GLN OE1  O  N N 96  
GLN NE2  N  N N 97  
GLN OXT  O  N N 98  
GLN H    H  N N 99  
GLN H2   H  N N 100 
GLN HA   H  N N 101 
GLN HB2  H  N N 102 
GLN HB3  H  N N 103 
GLN HG2  H  N N 104 
GLN HG3  H  N N 105 
GLN HE21 H  N N 106 
GLN HE22 H  N N 107 
GLN HXT  H  N N 108 
GLU N    N  N N 109 
GLU CA   C  N S 110 
GLU C    C  N N 111 
GLU O    O  N N 112 
GLU CB   C  N N 113 
GLU CG   C  N N 114 
GLU CD   C  N N 115 
GLU OE1  O  N N 116 
GLU OE2  O  N N 117 
GLU OXT  O  N N 118 
GLU H    H  N N 119 
GLU H2   H  N N 120 
GLU HA   H  N N 121 
GLU HB2  H  N N 122 
GLU HB3  H  N N 123 
GLU HG2  H  N N 124 
GLU HG3  H  N N 125 
GLU HE2  H  N N 126 
GLU HXT  H  N N 127 
GLY N    N  N N 128 
GLY CA   C  N N 129 
GLY C    C  N N 130 
GLY O    O  N N 131 
GLY OXT  O  N N 132 
GLY H    H  N N 133 
GLY H2   H  N N 134 
GLY HA2  H  N N 135 
GLY HA3  H  N N 136 
GLY HXT  H  N N 137 
HIS N    N  N N 138 
HIS CA   C  N S 139 
HIS C    C  N N 140 
HIS O    O  N N 141 
HIS CB   C  N N 142 
HIS CG   C  Y N 143 
HIS ND1  N  Y N 144 
HIS CD2  C  Y N 145 
HIS CE1  C  Y N 146 
HIS NE2  N  Y N 147 
HIS OXT  O  N N 148 
HIS H    H  N N 149 
HIS H2   H  N N 150 
HIS HA   H  N N 151 
HIS HB2  H  N N 152 
HIS HB3  H  N N 153 
HIS HD1  H  N N 154 
HIS HD2  H  N N 155 
HIS HE1  H  N N 156 
HIS HE2  H  N N 157 
HIS HXT  H  N N 158 
HOH O    O  N N 159 
HOH H1   H  N N 160 
HOH H2   H  N N 161 
ILE N    N  N N 162 
ILE CA   C  N S 163 
ILE C    C  N N 164 
ILE O    O  N N 165 
ILE CB   C  N S 166 
ILE CG1  C  N N 167 
ILE CG2  C  N N 168 
ILE CD1  C  N N 169 
ILE OXT  O  N N 170 
ILE H    H  N N 171 
ILE H2   H  N N 172 
ILE HA   H  N N 173 
ILE HB   H  N N 174 
ILE HG12 H  N N 175 
ILE HG13 H  N N 176 
ILE HG21 H  N N 177 
ILE HG22 H  N N 178 
ILE HG23 H  N N 179 
ILE HD11 H  N N 180 
ILE HD12 H  N N 181 
ILE HD13 H  N N 182 
ILE HXT  H  N N 183 
LEU N    N  N N 184 
LEU CA   C  N S 185 
LEU C    C  N N 186 
LEU O    O  N N 187 
LEU CB   C  N N 188 
LEU CG   C  N N 189 
LEU CD1  C  N N 190 
LEU CD2  C  N N 191 
LEU OXT  O  N N 192 
LEU H    H  N N 193 
LEU H2   H  N N 194 
LEU HA   H  N N 195 
LEU HB2  H  N N 196 
LEU HB3  H  N N 197 
LEU HG   H  N N 198 
LEU HD11 H  N N 199 
LEU HD12 H  N N 200 
LEU HD13 H  N N 201 
LEU HD21 H  N N 202 
LEU HD22 H  N N 203 
LEU HD23 H  N N 204 
LEU HXT  H  N N 205 
LYS N    N  N N 206 
LYS CA   C  N S 207 
LYS C    C  N N 208 
LYS O    O  N N 209 
LYS CB   C  N N 210 
LYS CG   C  N N 211 
LYS CD   C  N N 212 
LYS CE   C  N N 213 
LYS NZ   N  N N 214 
LYS OXT  O  N N 215 
LYS H    H  N N 216 
LYS H2   H  N N 217 
LYS HA   H  N N 218 
LYS HB2  H  N N 219 
LYS HB3  H  N N 220 
LYS HG2  H  N N 221 
LYS HG3  H  N N 222 
LYS HD2  H  N N 223 
LYS HD3  H  N N 224 
LYS HE2  H  N N 225 
LYS HE3  H  N N 226 
LYS HZ1  H  N N 227 
LYS HZ2  H  N N 228 
LYS HZ3  H  N N 229 
LYS HXT  H  N N 230 
MET N    N  N N 231 
MET CA   C  N S 232 
MET C    C  N N 233 
MET O    O  N N 234 
MET CB   C  N N 235 
MET CG   C  N N 236 
MET SD   S  N N 237 
MET CE   C  N N 238 
MET OXT  O  N N 239 
MET H    H  N N 240 
MET H2   H  N N 241 
MET HA   H  N N 242 
MET HB2  H  N N 243 
MET HB3  H  N N 244 
MET HG2  H  N N 245 
MET HG3  H  N N 246 
MET HE1  H  N N 247 
MET HE2  H  N N 248 
MET HE3  H  N N 249 
MET HXT  H  N N 250 
PHE N    N  N N 251 
PHE CA   C  N S 252 
PHE C    C  N N 253 
PHE O    O  N N 254 
PHE CB   C  N N 255 
PHE CG   C  Y N 256 
PHE CD1  C  Y N 257 
PHE CD2  C  Y N 258 
PHE CE1  C  Y N 259 
PHE CE2  C  Y N 260 
PHE CZ   C  Y N 261 
PHE OXT  O  N N 262 
PHE H    H  N N 263 
PHE H2   H  N N 264 
PHE HA   H  N N 265 
PHE HB2  H  N N 266 
PHE HB3  H  N N 267 
PHE HD1  H  N N 268 
PHE HD2  H  N N 269 
PHE HE1  H  N N 270 
PHE HE2  H  N N 271 
PHE HZ   H  N N 272 
PHE HXT  H  N N 273 
PRO N    N  N N 274 
PRO CA   C  N S 275 
PRO C    C  N N 276 
PRO O    O  N N 277 
PRO CB   C  N N 278 
PRO CG   C  N N 279 
PRO CD   C  N N 280 
PRO OXT  O  N N 281 
PRO H    H  N N 282 
PRO HA   H  N N 283 
PRO HB2  H  N N 284 
PRO HB3  H  N N 285 
PRO HG2  H  N N 286 
PRO HG3  H  N N 287 
PRO HD2  H  N N 288 
PRO HD3  H  N N 289 
PRO HXT  H  N N 290 
SER N    N  N N 291 
SER CA   C  N S 292 
SER C    C  N N 293 
SER O    O  N N 294 
SER CB   C  N N 295 
SER OG   O  N N 296 
SER OXT  O  N N 297 
SER H    H  N N 298 
SER H2   H  N N 299 
SER HA   H  N N 300 
SER HB2  H  N N 301 
SER HB3  H  N N 302 
SER HG   H  N N 303 
SER HXT  H  N N 304 
SO4 S    S  N N 305 
SO4 O1   O  N N 306 
SO4 O2   O  N N 307 
SO4 O3   O  N N 308 
SO4 O4   O  N N 309 
THR N    N  N N 310 
THR CA   C  N S 311 
THR C    C  N N 312 
THR O    O  N N 313 
THR CB   C  N R 314 
THR OG1  O  N N 315 
THR CG2  C  N N 316 
THR OXT  O  N N 317 
THR H    H  N N 318 
THR H2   H  N N 319 
THR HA   H  N N 320 
THR HB   H  N N 321 
THR HG1  H  N N 322 
THR HG21 H  N N 323 
THR HG22 H  N N 324 
THR HG23 H  N N 325 
THR HXT  H  N N 326 
TRP N    N  N N 327 
TRP CA   C  N S 328 
TRP C    C  N N 329 
TRP O    O  N N 330 
TRP CB   C  N N 331 
TRP CG   C  Y N 332 
TRP CD1  C  Y N 333 
TRP CD2  C  Y N 334 
TRP NE1  N  Y N 335 
TRP CE2  C  Y N 336 
TRP CE3  C  Y N 337 
TRP CZ2  C  Y N 338 
TRP CZ3  C  Y N 339 
TRP CH2  C  Y N 340 
TRP OXT  O  N N 341 
TRP H    H  N N 342 
TRP H2   H  N N 343 
TRP HA   H  N N 344 
TRP HB2  H  N N 345 
TRP HB3  H  N N 346 
TRP HD1  H  N N 347 
TRP HE1  H  N N 348 
TRP HE3  H  N N 349 
TRP HZ2  H  N N 350 
TRP HZ3  H  N N 351 
TRP HH2  H  N N 352 
TRP HXT  H  N N 353 
TYR N    N  N N 354 
TYR CA   C  N S 355 
TYR C    C  N N 356 
TYR O    O  N N 357 
TYR CB   C  N N 358 
TYR CG   C  Y N 359 
TYR CD1  C  Y N 360 
TYR CD2  C  Y N 361 
TYR CE1  C  Y N 362 
TYR CE2  C  Y N 363 
TYR CZ   C  Y N 364 
TYR OH   O  N N 365 
TYR OXT  O  N N 366 
TYR H    H  N N 367 
TYR H2   H  N N 368 
TYR HA   H  N N 369 
TYR HB2  H  N N 370 
TYR HB3  H  N N 371 
TYR HD1  H  N N 372 
TYR HD2  H  N N 373 
TYR HE1  H  N N 374 
TYR HE2  H  N N 375 
TYR HH   H  N N 376 
TYR HXT  H  N N 377 
VAL N    N  N N 378 
VAL CA   C  N S 379 
VAL C    C  N N 380 
VAL O    O  N N 381 
VAL CB   C  N N 382 
VAL CG1  C  N N 383 
VAL CG2  C  N N 384 
VAL OXT  O  N N 385 
VAL H    H  N N 386 
VAL H2   H  N N 387 
VAL HA   H  N N 388 
VAL HB   H  N N 389 
VAL HG11 H  N N 390 
VAL HG12 H  N N 391 
VAL HG13 H  N N 392 
VAL HG21 H  N N 393 
VAL HG22 H  N N 394 
VAL HG23 H  N N 395 
VAL HXT  H  N N 396 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
HOH O   H1   sing N N 150 
HOH O   H2   sing N N 151 
ILE N   CA   sing N N 152 
ILE N   H    sing N N 153 
ILE N   H2   sing N N 154 
ILE CA  C    sing N N 155 
ILE CA  CB   sing N N 156 
ILE CA  HA   sing N N 157 
ILE C   O    doub N N 158 
ILE C   OXT  sing N N 159 
ILE CB  CG1  sing N N 160 
ILE CB  CG2  sing N N 161 
ILE CB  HB   sing N N 162 
ILE CG1 CD1  sing N N 163 
ILE CG1 HG12 sing N N 164 
ILE CG1 HG13 sing N N 165 
ILE CG2 HG21 sing N N 166 
ILE CG2 HG22 sing N N 167 
ILE CG2 HG23 sing N N 168 
ILE CD1 HD11 sing N N 169 
ILE CD1 HD12 sing N N 170 
ILE CD1 HD13 sing N N 171 
ILE OXT HXT  sing N N 172 
LEU N   CA   sing N N 173 
LEU N   H    sing N N 174 
LEU N   H2   sing N N 175 
LEU CA  C    sing N N 176 
LEU CA  CB   sing N N 177 
LEU CA  HA   sing N N 178 
LEU C   O    doub N N 179 
LEU C   OXT  sing N N 180 
LEU CB  CG   sing N N 181 
LEU CB  HB2  sing N N 182 
LEU CB  HB3  sing N N 183 
LEU CG  CD1  sing N N 184 
LEU CG  CD2  sing N N 185 
LEU CG  HG   sing N N 186 
LEU CD1 HD11 sing N N 187 
LEU CD1 HD12 sing N N 188 
LEU CD1 HD13 sing N N 189 
LEU CD2 HD21 sing N N 190 
LEU CD2 HD22 sing N N 191 
LEU CD2 HD23 sing N N 192 
LEU OXT HXT  sing N N 193 
LYS N   CA   sing N N 194 
LYS N   H    sing N N 195 
LYS N   H2   sing N N 196 
LYS CA  C    sing N N 197 
LYS CA  CB   sing N N 198 
LYS CA  HA   sing N N 199 
LYS C   O    doub N N 200 
LYS C   OXT  sing N N 201 
LYS CB  CG   sing N N 202 
LYS CB  HB2  sing N N 203 
LYS CB  HB3  sing N N 204 
LYS CG  CD   sing N N 205 
LYS CG  HG2  sing N N 206 
LYS CG  HG3  sing N N 207 
LYS CD  CE   sing N N 208 
LYS CD  HD2  sing N N 209 
LYS CD  HD3  sing N N 210 
LYS CE  NZ   sing N N 211 
LYS CE  HE2  sing N N 212 
LYS CE  HE3  sing N N 213 
LYS NZ  HZ1  sing N N 214 
LYS NZ  HZ2  sing N N 215 
LYS NZ  HZ3  sing N N 216 
LYS OXT HXT  sing N N 217 
MET N   CA   sing N N 218 
MET N   H    sing N N 219 
MET N   H2   sing N N 220 
MET CA  C    sing N N 221 
MET CA  CB   sing N N 222 
MET CA  HA   sing N N 223 
MET C   O    doub N N 224 
MET C   OXT  sing N N 225 
MET CB  CG   sing N N 226 
MET CB  HB2  sing N N 227 
MET CB  HB3  sing N N 228 
MET CG  SD   sing N N 229 
MET CG  HG2  sing N N 230 
MET CG  HG3  sing N N 231 
MET SD  CE   sing N N 232 
MET CE  HE1  sing N N 233 
MET CE  HE2  sing N N 234 
MET CE  HE3  sing N N 235 
MET OXT HXT  sing N N 236 
PHE N   CA   sing N N 237 
PHE N   H    sing N N 238 
PHE N   H2   sing N N 239 
PHE CA  C    sing N N 240 
PHE CA  CB   sing N N 241 
PHE CA  HA   sing N N 242 
PHE C   O    doub N N 243 
PHE C   OXT  sing N N 244 
PHE CB  CG   sing N N 245 
PHE CB  HB2  sing N N 246 
PHE CB  HB3  sing N N 247 
PHE CG  CD1  doub Y N 248 
PHE CG  CD2  sing Y N 249 
PHE CD1 CE1  sing Y N 250 
PHE CD1 HD1  sing N N 251 
PHE CD2 CE2  doub Y N 252 
PHE CD2 HD2  sing N N 253 
PHE CE1 CZ   doub Y N 254 
PHE CE1 HE1  sing N N 255 
PHE CE2 CZ   sing Y N 256 
PHE CE2 HE2  sing N N 257 
PHE CZ  HZ   sing N N 258 
PHE OXT HXT  sing N N 259 
PRO N   CA   sing N N 260 
PRO N   CD   sing N N 261 
PRO N   H    sing N N 262 
PRO CA  C    sing N N 263 
PRO CA  CB   sing N N 264 
PRO CA  HA   sing N N 265 
PRO C   O    doub N N 266 
PRO C   OXT  sing N N 267 
PRO CB  CG   sing N N 268 
PRO CB  HB2  sing N N 269 
PRO CB  HB3  sing N N 270 
PRO CG  CD   sing N N 271 
PRO CG  HG2  sing N N 272 
PRO CG  HG3  sing N N 273 
PRO CD  HD2  sing N N 274 
PRO CD  HD3  sing N N 275 
PRO OXT HXT  sing N N 276 
SER N   CA   sing N N 277 
SER N   H    sing N N 278 
SER N   H2   sing N N 279 
SER CA  C    sing N N 280 
SER CA  CB   sing N N 281 
SER CA  HA   sing N N 282 
SER C   O    doub N N 283 
SER C   OXT  sing N N 284 
SER CB  OG   sing N N 285 
SER CB  HB2  sing N N 286 
SER CB  HB3  sing N N 287 
SER OG  HG   sing N N 288 
SER OXT HXT  sing N N 289 
SO4 S   O1   doub N N 290 
SO4 S   O2   doub N N 291 
SO4 S   O3   sing N N 292 
SO4 S   O4   sing N N 293 
THR N   CA   sing N N 294 
THR N   H    sing N N 295 
THR N   H2   sing N N 296 
THR CA  C    sing N N 297 
THR CA  CB   sing N N 298 
THR CA  HA   sing N N 299 
THR C   O    doub N N 300 
THR C   OXT  sing N N 301 
THR CB  OG1  sing N N 302 
THR CB  CG2  sing N N 303 
THR CB  HB   sing N N 304 
THR OG1 HG1  sing N N 305 
THR CG2 HG21 sing N N 306 
THR CG2 HG22 sing N N 307 
THR CG2 HG23 sing N N 308 
THR OXT HXT  sing N N 309 
TRP N   CA   sing N N 310 
TRP N   H    sing N N 311 
TRP N   H2   sing N N 312 
TRP CA  C    sing N N 313 
TRP CA  CB   sing N N 314 
TRP CA  HA   sing N N 315 
TRP C   O    doub N N 316 
TRP C   OXT  sing N N 317 
TRP CB  CG   sing N N 318 
TRP CB  HB2  sing N N 319 
TRP CB  HB3  sing N N 320 
TRP CG  CD1  doub Y N 321 
TRP CG  CD2  sing Y N 322 
TRP CD1 NE1  sing Y N 323 
TRP CD1 HD1  sing N N 324 
TRP CD2 CE2  doub Y N 325 
TRP CD2 CE3  sing Y N 326 
TRP NE1 CE2  sing Y N 327 
TRP NE1 HE1  sing N N 328 
TRP CE2 CZ2  sing Y N 329 
TRP CE3 CZ3  doub Y N 330 
TRP CE3 HE3  sing N N 331 
TRP CZ2 CH2  doub Y N 332 
TRP CZ2 HZ2  sing N N 333 
TRP CZ3 CH2  sing Y N 334 
TRP CZ3 HZ3  sing N N 335 
TRP CH2 HH2  sing N N 336 
TRP OXT HXT  sing N N 337 
TYR N   CA   sing N N 338 
TYR N   H    sing N N 339 
TYR N   H2   sing N N 340 
TYR CA  C    sing N N 341 
TYR CA  CB   sing N N 342 
TYR CA  HA   sing N N 343 
TYR C   O    doub N N 344 
TYR C   OXT  sing N N 345 
TYR CB  CG   sing N N 346 
TYR CB  HB2  sing N N 347 
TYR CB  HB3  sing N N 348 
TYR CG  CD1  doub Y N 349 
TYR CG  CD2  sing Y N 350 
TYR CD1 CE1  sing Y N 351 
TYR CD1 HD1  sing N N 352 
TYR CD2 CE2  doub Y N 353 
TYR CD2 HD2  sing N N 354 
TYR CE1 CZ   doub Y N 355 
TYR CE1 HE1  sing N N 356 
TYR CE2 CZ   sing Y N 357 
TYR CE2 HE2  sing N N 358 
TYR CZ  OH   sing N N 359 
TYR OH  HH   sing N N 360 
TYR OXT HXT  sing N N 361 
VAL N   CA   sing N N 362 
VAL N   H    sing N N 363 
VAL N   H2   sing N N 364 
VAL CA  C    sing N N 365 
VAL CA  CB   sing N N 366 
VAL CA  HA   sing N N 367 
VAL C   O    doub N N 368 
VAL C   OXT  sing N N 369 
VAL CB  CG1  sing N N 370 
VAL CB  CG2  sing N N 371 
VAL CB  HB   sing N N 372 
VAL CG1 HG11 sing N N 373 
VAL CG1 HG12 sing N N 374 
VAL CG1 HG13 sing N N 375 
VAL CG2 HG21 sing N N 376 
VAL CG2 HG22 sing N N 377 
VAL CG2 HG23 sing N N 378 
VAL OXT HXT  sing N N 379 
# 
_em_3d_crystal_entity.id                    1 
_em_3d_crystal_entity.image_processing_id   1 
_em_3d_crystal_entity.angle_alpha           90 
_em_3d_crystal_entity.angle_beta            90 
_em_3d_crystal_entity.angle_gamma           90 
_em_3d_crystal_entity.length_a              67.46 
_em_3d_crystal_entity.length_b              67.46 
_em_3d_crystal_entity.length_c              106.67 
_em_3d_crystal_entity.space_group_name      'P43 21 2' 
_em_3d_crystal_entity.space_group_num       96 
# 
_em_admin.entry_id           6N4U 
_em_admin.current_status     REL 
_em_admin.deposition_date    2018-11-20 
_em_admin.deposition_site    RCSB 
_em_admin.last_update        2024-11-06 
_em_admin.map_release_date   2019-02-06 
_em_admin.title              'MicroED structure of Proteinase K at 2.75A resolution from a single milled crystal.' 
# 
_em_crystal_formation.id                    1 
_em_crystal_formation.specimen_id           1 
_em_crystal_formation.atmosphere            ? 
_em_crystal_formation.details               ? 
_em_crystal_formation.instrument            ? 
_em_crystal_formation.lipid_mixture         ? 
_em_crystal_formation.lipid_protein_ratio   ? 
_em_crystal_formation.temperature           ? 
_em_crystal_formation.time                  ? 
_em_crystal_formation.time_unit             ? 
# 
_em_ctf_correction.id                       1 
_em_ctf_correction.em_image_processing_id   1 
_em_ctf_correction.type                     NONE 
_em_ctf_correction.details                  NONE 
# 
_em_diffraction.id                1 
_em_diffraction.camera_length     1700 
_em_diffraction.imaging_id        1 
_em_diffraction.tilt_angle_list   ? 
# 
_em_diffraction_shell.id                        1 
_em_diffraction_shell.em_diffraction_stats_id   1 
_em_diffraction_shell.fourier_space_coverage    88.23 
_em_diffraction_shell.high_resolution           2.75 
_em_diffraction_shell.low_resolution            3.1483 
_em_diffraction_shell.multiplicity              2.9 
_em_diffraction_shell.num_structure_factors     1831 
_em_diffraction_shell.phase_residual            28.11 
# 
_em_diffraction_stats.id                               1 
_em_diffraction_stats.details                          ? 
_em_diffraction_stats.image_processing_id              1 
_em_diffraction_stats.fourier_space_coverage           88.4 
_em_diffraction_stats.high_resolution                  2.75 
_em_diffraction_stats.num_intensities_measured         31013 
_em_diffraction_stats.num_structure_factors            10807 
_em_diffraction_stats.overall_phase_error              22.41 
_em_diffraction_stats.overall_phase_residual           22.41 
_em_diffraction_stats.phase_error_rejection_criteria   0 
_em_diffraction_stats.r_merge                          0.47 
_em_diffraction_stats.r_sym                            0.39 
# 
_em_entity_assembly_molwt.entity_assembly_id   1 
_em_entity_assembly_molwt.id                   1 
_em_entity_assembly_molwt.experimental_flag    NO 
_em_entity_assembly_molwt.units                MEGADALTONS 
_em_entity_assembly_molwt.value                0.02893 
# 
_em_entity_assembly_naturalsource.id                   2 
_em_entity_assembly_naturalsource.entity_assembly_id   1 
_em_entity_assembly_naturalsource.cell                 ? 
_em_entity_assembly_naturalsource.cellular_location    ? 
_em_entity_assembly_naturalsource.ncbi_tax_id          37998 
_em_entity_assembly_naturalsource.organ                ? 
_em_entity_assembly_naturalsource.organelle            ? 
_em_entity_assembly_naturalsource.organism             'Engyodontium album' 
_em_entity_assembly_naturalsource.strain               ? 
_em_entity_assembly_naturalsource.tissue               ? 
# 
_em_image_processing.id                   1 
_em_image_processing.image_recording_id   1 
_em_image_processing.details              'This was the new CetaD.' 
# 
_em_image_recording.id                            1 
_em_image_recording.imaging_id                    1 
_em_image_recording.avg_electron_dose_per_image   0.04 
_em_image_recording.average_exposure_time         2 
_em_image_recording.details                       
'Continuous rotation from -30 to +30 with a rotation rate of 0.2 degrees per second and a readout every 3 seconds.' 
_em_image_recording.detector_mode                 ? 
_em_image_recording.film_or_detector_model        'FEI CETA (4k x 4k)' 
_em_image_recording.num_diffraction_images        100 
_em_image_recording.num_grids_imaged              1 
_em_image_recording.num_real_images               ? 
# 
_em_imaging_optics.id                         1 
_em_imaging_optics.imaging_id                 1 
_em_imaging_optics.chr_aberration_corrector   ? 
_em_imaging_optics.energyfilter_lower         ? 
_em_imaging_optics.energyfilter_name          ? 
_em_imaging_optics.energyfilter_upper         ? 
_em_imaging_optics.energyfilter_slit_width    ? 
_em_imaging_optics.phase_plate                ? 
_em_imaging_optics.sph_aberration_corrector   ? 
# 
loop_
_em_software.id 
_em_software.category 
_em_software.details 
_em_software.name 
_em_software.version 
_em_software.image_processing_id 
_em_software.fitting_id 
_em_software.imaging_id 
1  'IMAGE ACQUISITION'             ? ?      ?     ? ? 1 
2  MASKING                         ? ?      ?     ? ? ? 
3  'CTF CORRECTION'                ? ?      ?     1 ? ? 
4  'LAYERLINE INDEXING'            ? ?      ?     ? ? ? 
5  'DIFFRACTION INDEXING'          ? ?      ?     ? ? ? 
6  'MODEL FITTING'                 ? PHENIX 1.14  ? 1 ? 
7  OTHER                           ? ?      ?     ? ? ? 
8  'MOLECULAR REPLACEMENT'         ? PHENIX 2.8.2 1 ? ? 
9  'LATTICE DISTORTION CORRECTION' ? ?      ?     1 ? ? 
10 'SYMMETRY DETERMINATION'        ? ?      ?     1 ? ? 
11 'CRYSTALLOGRAPHY MERGING'       ? ?      ?     1 ? ? 
12 RECONSTRUCTION                  ? ?      ?     1 ? ? 
13 'MODEL REFINEMENT'              ? PHENIX 1.14  ? 1 ? 
# 
_em_specimen.id                      1 
_em_specimen.experiment_id           1 
_em_specimen.concentration           20 
_em_specimen.details                 'Proteinase K purchased from Sigma.' 
_em_specimen.embedding_applied       NO 
_em_specimen.shadowing_applied       NO 
_em_specimen.staining_applied        NO 
_em_specimen.vitrification_applied   YES 
# 
_pdbx_audit_support.funding_organization   'National Institutes of Health/National Human Genome Research Institute (NIH/NHGRI)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           'R35 GM122588' 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   6CL7 
_pdbx_initial_refinement_model.details          ? 
# 
_atom_sites.entry_id                    6N4U 
_atom_sites.fract_transf_matrix[1][1]   0.014824 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014824 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009375 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_