data_6N63 # _entry.id 6N63 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6N63 pdb_00006n63 10.2210/pdb6n63/pdb WWPDB D_1000238236 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-07-17 2 'Structure model' 2 0 2023-11-15 3 'Structure model' 2 1 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Atomic model' 2 2 'Structure model' 'Data collection' 3 2 'Structure model' 'Database references' 4 2 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' chem_comp_atom 3 2 'Structure model' chem_comp_bond 4 2 'Structure model' database_2 5 2 'Structure model' pdbx_struct_conn_angle 6 2 'Structure model' struct_conn 7 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_site.auth_atom_id' 2 2 'Structure model' '_atom_site.label_atom_id' 3 2 'Structure model' '_database_2.pdbx_DOI' 4 2 'Structure model' '_database_2.pdbx_database_accession' 5 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 8 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 9 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 15 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 16 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 17 2 'Structure model' '_pdbx_struct_conn_angle.value' 18 2 'Structure model' '_struct_conn.pdbx_dist_value' 19 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 20 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 21 2 'Structure model' '_struct_conn.ptnr1_label_asym_id' 22 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 23 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 24 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 25 2 'Structure model' '_struct_conn.ptnr2_symmetry' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6N63 _pdbx_database_status.recvd_initial_deposition_date 2018-11-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Birrane, G.' 1 0000-0002-1759-5499 'Geissen, T.W.' 2 0000-0001-6328-2031 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Elife _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2050-084X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 8 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Large protein organelles form a new iron sequestration system with high storage capacity.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.7554/eLife.46070 _citation.pdbx_database_id_PubMed 31282860 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Giessen, T.W.' 1 0000-0001-6328-2031 primary 'Orlando, B.J.' 2 ? primary 'Verdegaal, A.A.' 3 0000-0002-4517-6961 primary 'Chambers, M.G.' 4 0000-0001-5111-7194 primary 'Gardener, J.' 5 ? primary 'Bell, D.C.' 6 ? primary 'Birrane, G.' 7 0000-0002-1759-5499 primary 'Liao, M.' 8 ? primary 'Silver, P.A.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ENCAPSULIN CARGO PROTEIN' 23471.000 1 ? ? ? ? 2 non-polymer syn 'GLYCOLIC ACID' 76.051 1 ? ? ? ? 3 non-polymer syn 'ACETATE ION' 59.044 1 ? ? ? ? 4 non-polymer syn 'FE (III) ION' 55.845 1 ? ? ? ? 5 water nat water 18.015 68 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'IRON-MINERALIZING ENCAPSULIN-ASSOCIATED FIRMICUTE CARGO PROTEIN (IMEF)' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKEELDAFHQIFTTTKEAIERFMAMLTPVIENAEDDHERLYYHHIYEEEEQRLSRLDVLIPLIEKFQDETDEGLFSPSNN AFNRLLQELNLEKFGLHNFIEHVDLALFSFTDEERQTLLKELRKDAYEGYQYVKEKLAEINARFDHDYADPHAHHDEHRD HLADMPSAGSSHEEVQPVAHKKKGFTVGSLIQHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MKEELDAFHQIFTTTKEAIERFMAMLTPVIENAEDDHERLYYHHIYEEEEQRLSRLDVLIPLIEKFQDETDEGLFSPSNN AFNRLLQELNLEKFGLHNFIEHVDLALFSFTDEERQTLLKELRKDAYEGYQYVKEKLAEINARFDHDYADPHAHHDEHRD HLADMPSAGSSHEEVQPVAHKKKGFTVGSLIQHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'GLYCOLIC ACID' GOA 3 'ACETATE ION' ACT 4 'FE (III) ION' FE 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 GLU n 1 4 GLU n 1 5 LEU n 1 6 ASP n 1 7 ALA n 1 8 PHE n 1 9 HIS n 1 10 GLN n 1 11 ILE n 1 12 PHE n 1 13 THR n 1 14 THR n 1 15 THR n 1 16 LYS n 1 17 GLU n 1 18 ALA n 1 19 ILE n 1 20 GLU n 1 21 ARG n 1 22 PHE n 1 23 MET n 1 24 ALA n 1 25 MET n 1 26 LEU n 1 27 THR n 1 28 PRO n 1 29 VAL n 1 30 ILE n 1 31 GLU n 1 32 ASN n 1 33 ALA n 1 34 GLU n 1 35 ASP n 1 36 ASP n 1 37 HIS n 1 38 GLU n 1 39 ARG n 1 40 LEU n 1 41 TYR n 1 42 TYR n 1 43 HIS n 1 44 HIS n 1 45 ILE n 1 46 TYR n 1 47 GLU n 1 48 GLU n 1 49 GLU n 1 50 GLU n 1 51 GLN n 1 52 ARG n 1 53 LEU n 1 54 SER n 1 55 ARG n 1 56 LEU n 1 57 ASP n 1 58 VAL n 1 59 LEU n 1 60 ILE n 1 61 PRO n 1 62 LEU n 1 63 ILE n 1 64 GLU n 1 65 LYS n 1 66 PHE n 1 67 GLN n 1 68 ASP n 1 69 GLU n 1 70 THR n 1 71 ASP n 1 72 GLU n 1 73 GLY n 1 74 LEU n 1 75 PHE n 1 76 SER n 1 77 PRO n 1 78 SER n 1 79 ASN n 1 80 ASN n 1 81 ALA n 1 82 PHE n 1 83 ASN n 1 84 ARG n 1 85 LEU n 1 86 LEU n 1 87 GLN n 1 88 GLU n 1 89 LEU n 1 90 ASN n 1 91 LEU n 1 92 GLU n 1 93 LYS n 1 94 PHE n 1 95 GLY n 1 96 LEU n 1 97 HIS n 1 98 ASN n 1 99 PHE n 1 100 ILE n 1 101 GLU n 1 102 HIS n 1 103 VAL n 1 104 ASP n 1 105 LEU n 1 106 ALA n 1 107 LEU n 1 108 PHE n 1 109 SER n 1 110 PHE n 1 111 THR n 1 112 ASP n 1 113 GLU n 1 114 GLU n 1 115 ARG n 1 116 GLN n 1 117 THR n 1 118 LEU n 1 119 LEU n 1 120 LYS n 1 121 GLU n 1 122 LEU n 1 123 ARG n 1 124 LYS n 1 125 ASP n 1 126 ALA n 1 127 TYR n 1 128 GLU n 1 129 GLY n 1 130 TYR n 1 131 GLN n 1 132 TYR n 1 133 VAL n 1 134 LYS n 1 135 GLU n 1 136 LYS n 1 137 LEU n 1 138 ALA n 1 139 GLU n 1 140 ILE n 1 141 ASN n 1 142 ALA n 1 143 ARG n 1 144 PHE n 1 145 ASP n 1 146 HIS n 1 147 ASP n 1 148 TYR n 1 149 ALA n 1 150 ASP n 1 151 PRO n 1 152 HIS n 1 153 ALA n 1 154 HIS n 1 155 HIS n 1 156 ASP n 1 157 GLU n 1 158 HIS n 1 159 ARG n 1 160 ASP n 1 161 HIS n 1 162 LEU n 1 163 ALA n 1 164 ASP n 1 165 MET n 1 166 PRO n 1 167 SER n 1 168 ALA n 1 169 GLY n 1 170 SER n 1 171 SER n 1 172 HIS n 1 173 GLU n 1 174 GLU n 1 175 VAL n 1 176 GLN n 1 177 PRO n 1 178 VAL n 1 179 ALA n 1 180 HIS n 1 181 LYS n 1 182 LYS n 1 183 LYS n 1 184 GLY n 1 185 PHE n 1 186 THR n 1 187 VAL n 1 188 GLY n 1 189 SER n 1 190 LEU n 1 191 ILE n 1 192 GLN n 1 193 HIS n 1 194 HIS n 1 195 HIS n 1 196 HIS n 1 197 HIS n 1 198 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 198 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene QY95_01593 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus thermotolerans' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1221996 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 FE non-polymer . 'FE (III) ION' ? 'Fe 3' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOA non-polymer . 'GLYCOLIC ACID' 'HYDROXYACETIC ACID; HYDROXYETHANOIC ACID' 'C2 H4 O3' 76.051 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 MET 25 25 25 MET MET A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 HIS 37 37 37 HIS HIS A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 HIS 97 97 97 HIS HIS A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 HIS 102 102 102 HIS HIS A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 ARG 115 115 115 ARG ARG A . n A 1 116 GLN 116 116 116 GLN GLN A . n A 1 117 THR 117 117 117 THR THR A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 ARG 123 123 123 ARG ARG A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 TYR 127 127 127 TYR TYR A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 TYR 130 130 130 TYR TYR A . n A 1 131 GLN 131 131 131 GLN GLN A . n A 1 132 TYR 132 132 132 TYR TYR A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 ASN 141 141 141 ASN ASN A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 ARG 143 143 ? ? ? A . n A 1 144 PHE 144 144 ? ? ? A . n A 1 145 ASP 145 145 ? ? ? A . n A 1 146 HIS 146 146 ? ? ? A . n A 1 147 ASP 147 147 ? ? ? A . n A 1 148 TYR 148 148 ? ? ? A . n A 1 149 ALA 149 149 ? ? ? A . n A 1 150 ASP 150 150 ? ? ? A . n A 1 151 PRO 151 151 ? ? ? A . n A 1 152 HIS 152 152 ? ? ? A . n A 1 153 ALA 153 153 ? ? ? A . n A 1 154 HIS 154 154 ? ? ? A . n A 1 155 HIS 155 155 ? ? ? A . n A 1 156 ASP 156 156 ? ? ? A . n A 1 157 GLU 157 157 ? ? ? A . n A 1 158 HIS 158 158 ? ? ? A . n A 1 159 ARG 159 159 ? ? ? A . n A 1 160 ASP 160 160 ? ? ? A . n A 1 161 HIS 161 161 ? ? ? A . n A 1 162 LEU 162 162 ? ? ? A . n A 1 163 ALA 163 163 ? ? ? A . n A 1 164 ASP 164 164 ? ? ? A . n A 1 165 MET 165 165 ? ? ? A . n A 1 166 PRO 166 166 ? ? ? A . n A 1 167 SER 167 167 ? ? ? A . n A 1 168 ALA 168 168 ? ? ? A . n A 1 169 GLY 169 169 ? ? ? A . n A 1 170 SER 170 170 ? ? ? A . n A 1 171 SER 171 171 ? ? ? A . n A 1 172 HIS 172 172 ? ? ? A . n A 1 173 GLU 173 173 ? ? ? A . n A 1 174 GLU 174 174 ? ? ? A . n A 1 175 VAL 175 175 ? ? ? A . n A 1 176 GLN 176 176 ? ? ? A . n A 1 177 PRO 177 177 ? ? ? A . n A 1 178 VAL 178 178 ? ? ? A . n A 1 179 ALA 179 179 ? ? ? A . n A 1 180 HIS 180 180 ? ? ? A . n A 1 181 LYS 181 181 ? ? ? A . n A 1 182 LYS 182 182 ? ? ? A . n A 1 183 LYS 183 183 ? ? ? A . n A 1 184 GLY 184 184 ? ? ? A . n A 1 185 PHE 185 185 ? ? ? A . n A 1 186 THR 186 186 ? ? ? A . n A 1 187 VAL 187 187 ? ? ? A . n A 1 188 GLY 188 188 ? ? ? A . n A 1 189 SER 189 189 ? ? ? A . n A 1 190 LEU 190 190 ? ? ? A . n A 1 191 ILE 191 191 ? ? ? A . n A 1 192 GLN 192 192 ? ? ? A . n A 1 193 HIS 193 193 ? ? ? A . n A 1 194 HIS 194 194 ? ? ? A . n A 1 195 HIS 195 195 ? ? ? A . n A 1 196 HIS 196 196 ? ? ? A . n A 1 197 HIS 197 197 ? ? ? A . n A 1 198 HIS 198 198 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOA 1 401 401 GOA GOA A . C 3 ACT 1 402 402 ACT ACT A . D 4 FE 1 403 403 FE FE A . E 5 HOH 1 501 501 HOH HOH A . E 5 HOH 2 502 502 HOH HOH A . E 5 HOH 3 503 503 HOH HOH A . E 5 HOH 4 504 504 HOH HOH A . E 5 HOH 5 505 505 HOH HOH A . E 5 HOH 6 506 506 HOH HOH A . E 5 HOH 7 507 507 HOH HOH A . E 5 HOH 8 508 508 HOH HOH A . E 5 HOH 9 509 509 HOH HOH A . E 5 HOH 10 510 510 HOH HOH A . E 5 HOH 11 511 511 HOH HOH A . E 5 HOH 12 512 512 HOH HOH A . E 5 HOH 13 513 513 HOH HOH A . E 5 HOH 14 514 514 HOH HOH A . E 5 HOH 15 515 515 HOH HOH A . E 5 HOH 16 516 516 HOH HOH A . E 5 HOH 17 517 517 HOH HOH A . E 5 HOH 18 518 518 HOH HOH A . E 5 HOH 19 519 519 HOH HOH A . E 5 HOH 20 520 520 HOH HOH A . E 5 HOH 21 521 521 HOH HOH A . E 5 HOH 22 522 522 HOH HOH A . E 5 HOH 23 523 523 HOH HOH A . E 5 HOH 24 524 524 HOH HOH A . E 5 HOH 25 525 525 HOH HOH A . E 5 HOH 26 526 526 HOH HOH A . E 5 HOH 27 527 527 HOH HOH A . E 5 HOH 28 528 528 HOH HOH A . E 5 HOH 29 529 529 HOH HOH A . E 5 HOH 30 530 530 HOH HOH A . E 5 HOH 31 531 531 HOH HOH A . E 5 HOH 32 532 532 HOH HOH A . E 5 HOH 33 533 533 HOH HOH A . E 5 HOH 34 534 534 HOH HOH A . E 5 HOH 35 535 535 HOH HOH A . E 5 HOH 36 536 536 HOH HOH A . E 5 HOH 37 537 537 HOH HOH A . E 5 HOH 38 538 538 HOH HOH A . E 5 HOH 39 539 539 HOH HOH A . E 5 HOH 40 540 540 HOH HOH A . E 5 HOH 41 541 541 HOH HOH A . E 5 HOH 42 542 542 HOH HOH A . E 5 HOH 43 543 543 HOH HOH A . E 5 HOH 44 544 544 HOH HOH A . E 5 HOH 45 545 545 HOH HOH A . E 5 HOH 46 546 546 HOH HOH A . E 5 HOH 47 547 547 HOH HOH A . E 5 HOH 48 548 548 HOH HOH A . E 5 HOH 49 549 549 HOH HOH A . E 5 HOH 50 550 550 HOH HOH A . E 5 HOH 51 551 551 HOH HOH A . E 5 HOH 52 552 552 HOH HOH A . E 5 HOH 53 553 553 HOH HOH A . E 5 HOH 54 554 554 HOH HOH A . E 5 HOH 55 555 555 HOH HOH A . E 5 HOH 56 556 556 HOH HOH A . E 5 HOH 57 557 557 HOH HOH A . E 5 HOH 58 558 558 HOH HOH A . E 5 HOH 59 559 559 HOH HOH A . E 5 HOH 60 560 560 HOH HOH A . E 5 HOH 61 561 561 HOH HOH A . E 5 HOH 62 562 562 HOH HOH A . E 5 HOH 63 563 563 HOH HOH A . E 5 HOH 64 564 564 HOH HOH A . E 5 HOH 65 565 565 HOH HOH A . E 5 HOH 66 566 566 HOH HOH A . E 5 HOH 67 567 567 HOH HOH A . E 5 HOH 68 568 568 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14_3260 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? Arcimboldo ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6N63 _cell.details ? _cell.formula_units_Z ? _cell.length_a 81.390 _cell.length_a_esd ? _cell.length_b 81.390 _cell.length_b_esd ? _cell.length_c 65.861 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6N63 _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6N63 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.32 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.06 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '10% v/v Pentaerythritol ethoxylate (3/4 EO/OH) and 10% butanol' _exptl_crystal_grow.pdbx_pH_range 7.5 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-09-05 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9762 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID30B' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9762 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID30B _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6N63 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.719 _reflns.d_resolution_low 58.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 24131 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.1 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 29.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.026 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.982 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.72 _reflns_shell.d_res_low 1.78 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.0 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2353 _reflns_shell.percent_possible_all 99.7 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 8.1 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.504 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.681 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6N63 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.72 _refine.ls_d_res_low 40.70 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 24065 _refine.ls_number_reflns_R_free 1164 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8 _refine.ls_percent_reflns_R_free 4.840 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.194 _refine.ls_R_factor_R_free 0.216 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.193 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'in-house model' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.870 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.230 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.72 _refine_hist.d_res_low 40.70 _refine_hist.number_atoms_solvent 68 _refine_hist.number_atoms_total 1269 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1191 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.020 ? 1229 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.360 ? 1656 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 6.109 ? 1048 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.086 ? 177 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 ? 221 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.7194 1.7976 . . 152 2772 99.00 . . . 0.3080 . 0.3127 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7976 1.8924 . . 131 2839 100.00 . . . 0.3209 . 0.2780 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8924 2.0110 . . 160 2802 100.00 . . . 0.2480 . 0.2488 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0110 2.1662 . . 127 2824 100.00 . . . 0.2533 . 0.2135 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1662 2.3842 . . 133 2864 100.00 . . . 0.2030 . 0.1950 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3842 2.7291 . . 147 2867 100.00 . . . 0.2212 . 0.1850 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7291 3.4382 . . 161 2879 100.00 . . . 0.2155 . 0.1975 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4382 40.7064 . . 153 3054 100.00 . . . 0.2013 . 0.1752 . . . . . . . . . . # _struct.entry_id 6N63 _struct.title 'Crystal structure of an Iron binding protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6N63 _struct_keywords.text 'IRON STORAGE, MINERALIZATION, ENCAPSULIN, FERROXIDASE, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0F5HNH9_9BACI _struct_ref.pdbx_db_accession A0A0F5HNH9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKEELDAFHQIFTTTKEAIERFMAMLTPVIENAEDDHERLYYHHIYEEEEQRLSRLDVLIPLIEKFQDETDEGLFSPSNN AFNRLLQELNLEKFGLHNFIEHVDLALFSFTDEERQTLLKELRKDAYEGYQYVKEKLAEINARFDHDYADPHAHHDEHRD HLADMPSAGSSHEEVQPVAHKKKGFTVGSLIQ ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6N63 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 192 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0F5HNH9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 192 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 192 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6N63 HIS A 193 ? UNP A0A0F5HNH9 ? ? 'expression tag' 193 1 1 6N63 HIS A 194 ? UNP A0A0F5HNH9 ? ? 'expression tag' 194 2 1 6N63 HIS A 195 ? UNP A0A0F5HNH9 ? ? 'expression tag' 195 3 1 6N63 HIS A 196 ? UNP A0A0F5HNH9 ? ? 'expression tag' 196 4 1 6N63 HIS A 197 ? UNP A0A0F5HNH9 ? ? 'expression tag' 197 5 1 6N63 HIS A 198 ? UNP A0A0F5HNH9 ? ? 'expression tag' 198 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3310 ? 1 MORE -33 ? 1 'SSA (A^2)' 14990 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 2 ? ASN A 32 ? LYS A 2 ASN A 32 1 ? 31 HELX_P HELX_P2 AA2 ASP A 35 ? THR A 70 ? ASP A 35 THR A 70 1 ? 36 HELX_P HELX_P3 AA3 SER A 78 ? PHE A 110 ? SER A 78 PHE A 110 1 ? 33 HELX_P HELX_P4 AA4 ASP A 112 ? ILE A 140 ? ASP A 112 ILE A 140 1 ? 29 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 44 NE2 ? ? ? 1_555 D FE . FE ? ? A HIS 44 A FE 403 1_555 ? ? ? ? ? ? ? 2.001 ? ? metalc2 metalc ? ? A GLU 48 OE2 ? ? ? 1_555 D FE . FE ? ? A GLU 48 A FE 403 1_555 ? ? ? ? ? ? ? 1.969 ? ? metalc3 metalc ? ? A GLU 48 OE1 ? ? ? 1_555 D FE . FE ? ? A GLU 48 A FE 403 7_555 ? ? ? ? ? ? ? 2.009 ? ? metalc4 metalc ? ? A HIS 102 NE2 ? ? ? 1_555 D FE . FE ? ? A HIS 102 A FE 403 7_555 ? ? ? ? ? ? ? 2.009 ? ? metalc5 metalc ? ? C ACT . O ? ? ? 1_555 D FE . FE ? ? A ACT 402 A FE 403 1_555 ? ? ? ? ? ? ? 1.789 ? ? metalc6 metalc ? ? C ACT . OXT ? ? ? 1_555 D FE . FE ? ? A ACT 402 A FE 403 7_555 ? ? ? ? ? ? ? 1.835 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 44 ? A HIS 44 ? 1_555 FE ? D FE . ? A FE 403 ? 1_555 OE2 ? A GLU 48 ? A GLU 48 ? 1_555 86.2 ? 2 NE2 ? A HIS 44 ? A HIS 44 ? 1_555 FE ? D FE . ? A FE 403 ? 1_555 OE1 ? A GLU 48 ? A GLU 48 ? 1_555 86.8 ? 3 OE2 ? A GLU 48 ? A GLU 48 ? 1_555 FE ? D FE . ? A FE 403 ? 1_555 OE1 ? A GLU 48 ? A GLU 48 ? 1_555 51.1 ? 4 NE2 ? A HIS 44 ? A HIS 44 ? 1_555 FE ? D FE . ? A FE 403 ? 1_555 NE2 ? A HIS 102 ? A HIS 102 ? 1_555 102.4 ? 5 OE2 ? A GLU 48 ? A GLU 48 ? 1_555 FE ? D FE . ? A FE 403 ? 1_555 NE2 ? A HIS 102 ? A HIS 102 ? 1_555 74.7 ? 6 OE1 ? A GLU 48 ? A GLU 48 ? 1_555 FE ? D FE . ? A FE 403 ? 1_555 NE2 ? A HIS 102 ? A HIS 102 ? 1_555 27.1 ? 7 NE2 ? A HIS 44 ? A HIS 44 ? 1_555 FE ? D FE . ? A FE 403 ? 1_555 O ? C ACT . ? A ACT 402 ? 1_555 98.0 ? 8 OE2 ? A GLU 48 ? A GLU 48 ? 1_555 FE ? D FE . ? A FE 403 ? 1_555 O ? C ACT . ? A ACT 402 ? 1_555 142.9 ? 9 OE1 ? A GLU 48 ? A GLU 48 ? 1_555 FE ? D FE . ? A FE 403 ? 1_555 O ? C ACT . ? A ACT 402 ? 1_555 92.1 ? 10 NE2 ? A HIS 102 ? A HIS 102 ? 1_555 FE ? D FE . ? A FE 403 ? 1_555 O ? C ACT . ? A ACT 402 ? 1_555 68.3 ? 11 NE2 ? A HIS 44 ? A HIS 44 ? 1_555 FE ? D FE . ? A FE 403 ? 1_555 OXT ? C ACT . ? A ACT 402 ? 1_555 92.1 ? 12 OE2 ? A GLU 48 ? A GLU 48 ? 1_555 FE ? D FE . ? A FE 403 ? 1_555 OXT ? C ACT . ? A ACT 402 ? 1_555 105.6 ? 13 OE1 ? A GLU 48 ? A GLU 48 ? 1_555 FE ? D FE . ? A FE 403 ? 1_555 OXT ? C ACT . ? A ACT 402 ? 1_555 54.6 ? 14 NE2 ? A HIS 102 ? A HIS 102 ? 1_555 FE ? D FE . ? A FE 403 ? 1_555 OXT ? C ACT . ? A ACT 402 ? 1_555 33.4 ? 15 O ? C ACT . ? A ACT 402 ? 1_555 FE ? D FE . ? A FE 403 ? 1_555 OXT ? C ACT . ? A ACT 402 ? 1_555 37.6 ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A GOA 401 ? 7 'binding site for residue GOA A 401' AC2 Software A ACT 402 ? 10 'binding site for residue ACT A 402' AC3 Software A FE 403 ? 6 'binding site for residue FE A 403' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 GLN A 51 ? GLN A 51 . ? 7_555 ? 2 AC1 7 ARG A 55 ? ARG A 55 . ? 7_555 ? 3 AC1 7 LEU A 91 ? LEU A 91 . ? 1_555 ? 4 AC1 7 PHE A 94 ? PHE A 94 . ? 1_555 ? 5 AC1 7 GLY A 95 ? GLY A 95 . ? 1_555 ? 6 AC1 7 ASN A 98 ? ASN A 98 . ? 1_555 ? 7 AC1 7 HOH E . ? HOH A 524 . ? 1_555 ? 8 AC2 10 HIS A 44 ? HIS A 44 . ? 7_555 ? 9 AC2 10 HIS A 44 ? HIS A 44 . ? 1_555 ? 10 AC2 10 ILE A 45 ? ILE A 45 . ? 1_555 ? 11 AC2 10 ILE A 45 ? ILE A 45 . ? 7_555 ? 12 AC2 10 GLU A 48 ? GLU A 48 . ? 1_555 ? 13 AC2 10 GLU A 48 ? GLU A 48 . ? 7_555 ? 14 AC2 10 HIS A 102 ? HIS A 102 . ? 7_555 ? 15 AC2 10 HIS A 102 ? HIS A 102 . ? 1_555 ? 16 AC2 10 FE D . ? FE A 403 . ? 1_555 ? 17 AC2 10 FE D . ? FE A 403 . ? 7_555 ? 18 AC3 6 HIS A 44 ? HIS A 44 . ? 1_555 ? 19 AC3 6 GLU A 48 ? GLU A 48 . ? 7_555 ? 20 AC3 6 GLU A 48 ? GLU A 48 . ? 1_555 ? 21 AC3 6 HIS A 102 ? HIS A 102 . ? 7_555 ? 22 AC3 6 ACT C . ? ACT A 402 . ? 7_555 ? 23 AC3 6 ACT C . ? ACT A 402 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 121 ? ? O A HOH 501 ? ? 1.89 2 1 O A HOH 552 ? ? O A HOH 565 ? ? 2.09 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 551 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 558 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 5_555 _pdbx_validate_symm_contact.dist 2.14 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 123 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 123 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 123 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 116.89 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation -3.41 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 35 ? ? 88.10 164.66 2 1 ASP A 71 ? ? -154.07 -40.18 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id ACT _pdbx_struct_special_symmetry.auth_seq_id 402 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id ACT _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ARG 143 ? A ARG 143 3 1 Y 1 A PHE 144 ? A PHE 144 4 1 Y 1 A ASP 145 ? A ASP 145 5 1 Y 1 A HIS 146 ? A HIS 146 6 1 Y 1 A ASP 147 ? A ASP 147 7 1 Y 1 A TYR 148 ? A TYR 148 8 1 Y 1 A ALA 149 ? A ALA 149 9 1 Y 1 A ASP 150 ? A ASP 150 10 1 Y 1 A PRO 151 ? A PRO 151 11 1 Y 1 A HIS 152 ? A HIS 152 12 1 Y 1 A ALA 153 ? A ALA 153 13 1 Y 1 A HIS 154 ? A HIS 154 14 1 Y 1 A HIS 155 ? A HIS 155 15 1 Y 1 A ASP 156 ? A ASP 156 16 1 Y 1 A GLU 157 ? A GLU 157 17 1 Y 1 A HIS 158 ? A HIS 158 18 1 Y 1 A ARG 159 ? A ARG 159 19 1 Y 1 A ASP 160 ? A ASP 160 20 1 Y 1 A HIS 161 ? A HIS 161 21 1 Y 1 A LEU 162 ? A LEU 162 22 1 Y 1 A ALA 163 ? A ALA 163 23 1 Y 1 A ASP 164 ? A ASP 164 24 1 Y 1 A MET 165 ? A MET 165 25 1 Y 1 A PRO 166 ? A PRO 166 26 1 Y 1 A SER 167 ? A SER 167 27 1 Y 1 A ALA 168 ? A ALA 168 28 1 Y 1 A GLY 169 ? A GLY 169 29 1 Y 1 A SER 170 ? A SER 170 30 1 Y 1 A SER 171 ? A SER 171 31 1 Y 1 A HIS 172 ? A HIS 172 32 1 Y 1 A GLU 173 ? A GLU 173 33 1 Y 1 A GLU 174 ? A GLU 174 34 1 Y 1 A VAL 175 ? A VAL 175 35 1 Y 1 A GLN 176 ? A GLN 176 36 1 Y 1 A PRO 177 ? A PRO 177 37 1 Y 1 A VAL 178 ? A VAL 178 38 1 Y 1 A ALA 179 ? A ALA 179 39 1 Y 1 A HIS 180 ? A HIS 180 40 1 Y 1 A LYS 181 ? A LYS 181 41 1 Y 1 A LYS 182 ? A LYS 182 42 1 Y 1 A LYS 183 ? A LYS 183 43 1 Y 1 A GLY 184 ? A GLY 184 44 1 Y 1 A PHE 185 ? A PHE 185 45 1 Y 1 A THR 186 ? A THR 186 46 1 Y 1 A VAL 187 ? A VAL 187 47 1 Y 1 A GLY 188 ? A GLY 188 48 1 Y 1 A SER 189 ? A SER 189 49 1 Y 1 A LEU 190 ? A LEU 190 50 1 Y 1 A ILE 191 ? A ILE 191 51 1 Y 1 A GLN 192 ? A GLN 192 52 1 Y 1 A HIS 193 ? A HIS 193 53 1 Y 1 A HIS 194 ? A HIS 194 54 1 Y 1 A HIS 195 ? A HIS 195 55 1 Y 1 A HIS 196 ? A HIS 196 56 1 Y 1 A HIS 197 ? A HIS 197 57 1 Y 1 A HIS 198 ? A HIS 198 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACT C C N N 1 ACT O O N N 2 ACT OXT O N N 3 ACT CH3 C N N 4 ACT H1 H N N 5 ACT H2 H N N 6 ACT H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 ASP N N N N 65 ASP CA C N S 66 ASP C C N N 67 ASP O O N N 68 ASP CB C N N 69 ASP CG C N N 70 ASP OD1 O N N 71 ASP OD2 O N N 72 ASP OXT O N N 73 ASP H H N N 74 ASP H2 H N N 75 ASP HA H N N 76 ASP HB2 H N N 77 ASP HB3 H N N 78 ASP HD2 H N N 79 ASP HXT H N N 80 FE FE FE N N 81 GLN N N N N 82 GLN CA C N S 83 GLN C C N N 84 GLN O O N N 85 GLN CB C N N 86 GLN CG C N N 87 GLN CD C N N 88 GLN OE1 O N N 89 GLN NE2 N N N 90 GLN OXT O N N 91 GLN H H N N 92 GLN H2 H N N 93 GLN HA H N N 94 GLN HB2 H N N 95 GLN HB3 H N N 96 GLN HG2 H N N 97 GLN HG3 H N N 98 GLN HE21 H N N 99 GLN HE22 H N N 100 GLN HXT H N N 101 GLU N N N N 102 GLU CA C N S 103 GLU C C N N 104 GLU O O N N 105 GLU CB C N N 106 GLU CG C N N 107 GLU CD C N N 108 GLU OE1 O N N 109 GLU OE2 O N N 110 GLU OXT O N N 111 GLU H H N N 112 GLU H2 H N N 113 GLU HA H N N 114 GLU HB2 H N N 115 GLU HB3 H N N 116 GLU HG2 H N N 117 GLU HG3 H N N 118 GLU HE2 H N N 119 GLU HXT H N N 120 GLY N N N N 121 GLY CA C N N 122 GLY C C N N 123 GLY O O N N 124 GLY OXT O N N 125 GLY H H N N 126 GLY H2 H N N 127 GLY HA2 H N N 128 GLY HA3 H N N 129 GLY HXT H N N 130 GOA C C N N 131 GOA CA C N N 132 GOA O O N N 133 GOA OXT O N N 134 GOA O2 O N N 135 GOA H22 H N N 136 GOA H21 H N N 137 GOA HXT H N N 138 GOA H20 H N N 139 HIS N N N N 140 HIS CA C N S 141 HIS C C N N 142 HIS O O N N 143 HIS CB C N N 144 HIS CG C Y N 145 HIS ND1 N Y N 146 HIS CD2 C Y N 147 HIS CE1 C Y N 148 HIS NE2 N Y N 149 HIS OXT O N N 150 HIS H H N N 151 HIS H2 H N N 152 HIS HA H N N 153 HIS HB2 H N N 154 HIS HB3 H N N 155 HIS HD1 H N N 156 HIS HD2 H N N 157 HIS HE1 H N N 158 HIS HE2 H N N 159 HIS HXT H N N 160 HOH O O N N 161 HOH H1 H N N 162 HOH H2 H N N 163 ILE N N N N 164 ILE CA C N S 165 ILE C C N N 166 ILE O O N N 167 ILE CB C N S 168 ILE CG1 C N N 169 ILE CG2 C N N 170 ILE CD1 C N N 171 ILE OXT O N N 172 ILE H H N N 173 ILE H2 H N N 174 ILE HA H N N 175 ILE HB H N N 176 ILE HG12 H N N 177 ILE HG13 H N N 178 ILE HG21 H N N 179 ILE HG22 H N N 180 ILE HG23 H N N 181 ILE HD11 H N N 182 ILE HD12 H N N 183 ILE HD13 H N N 184 ILE HXT H N N 185 LEU N N N N 186 LEU CA C N S 187 LEU C C N N 188 LEU O O N N 189 LEU CB C N N 190 LEU CG C N N 191 LEU CD1 C N N 192 LEU CD2 C N N 193 LEU OXT O N N 194 LEU H H N N 195 LEU H2 H N N 196 LEU HA H N N 197 LEU HB2 H N N 198 LEU HB3 H N N 199 LEU HG H N N 200 LEU HD11 H N N 201 LEU HD12 H N N 202 LEU HD13 H N N 203 LEU HD21 H N N 204 LEU HD22 H N N 205 LEU HD23 H N N 206 LEU HXT H N N 207 LYS N N N N 208 LYS CA C N S 209 LYS C C N N 210 LYS O O N N 211 LYS CB C N N 212 LYS CG C N N 213 LYS CD C N N 214 LYS CE C N N 215 LYS NZ N N N 216 LYS OXT O N N 217 LYS H H N N 218 LYS H2 H N N 219 LYS HA H N N 220 LYS HB2 H N N 221 LYS HB3 H N N 222 LYS HG2 H N N 223 LYS HG3 H N N 224 LYS HD2 H N N 225 LYS HD3 H N N 226 LYS HE2 H N N 227 LYS HE3 H N N 228 LYS HZ1 H N N 229 LYS HZ2 H N N 230 LYS HZ3 H N N 231 LYS HXT H N N 232 MET N N N N 233 MET CA C N S 234 MET C C N N 235 MET O O N N 236 MET CB C N N 237 MET CG C N N 238 MET SD S N N 239 MET CE C N N 240 MET OXT O N N 241 MET H H N N 242 MET H2 H N N 243 MET HA H N N 244 MET HB2 H N N 245 MET HB3 H N N 246 MET HG2 H N N 247 MET HG3 H N N 248 MET HE1 H N N 249 MET HE2 H N N 250 MET HE3 H N N 251 MET HXT H N N 252 PHE N N N N 253 PHE CA C N S 254 PHE C C N N 255 PHE O O N N 256 PHE CB C N N 257 PHE CG C Y N 258 PHE CD1 C Y N 259 PHE CD2 C Y N 260 PHE CE1 C Y N 261 PHE CE2 C Y N 262 PHE CZ C Y N 263 PHE OXT O N N 264 PHE H H N N 265 PHE H2 H N N 266 PHE HA H N N 267 PHE HB2 H N N 268 PHE HB3 H N N 269 PHE HD1 H N N 270 PHE HD2 H N N 271 PHE HE1 H N N 272 PHE HE2 H N N 273 PHE HZ H N N 274 PHE HXT H N N 275 PRO N N N N 276 PRO CA C N S 277 PRO C C N N 278 PRO O O N N 279 PRO CB C N N 280 PRO CG C N N 281 PRO CD C N N 282 PRO OXT O N N 283 PRO H H N N 284 PRO HA H N N 285 PRO HB2 H N N 286 PRO HB3 H N N 287 PRO HG2 H N N 288 PRO HG3 H N N 289 PRO HD2 H N N 290 PRO HD3 H N N 291 PRO HXT H N N 292 SER N N N N 293 SER CA C N S 294 SER C C N N 295 SER O O N N 296 SER CB C N N 297 SER OG O N N 298 SER OXT O N N 299 SER H H N N 300 SER H2 H N N 301 SER HA H N N 302 SER HB2 H N N 303 SER HB3 H N N 304 SER HG H N N 305 SER HXT H N N 306 THR N N N N 307 THR CA C N S 308 THR C C N N 309 THR O O N N 310 THR CB C N R 311 THR OG1 O N N 312 THR CG2 C N N 313 THR OXT O N N 314 THR H H N N 315 THR H2 H N N 316 THR HA H N N 317 THR HB H N N 318 THR HG1 H N N 319 THR HG21 H N N 320 THR HG22 H N N 321 THR HG23 H N N 322 THR HXT H N N 323 TYR N N N N 324 TYR CA C N S 325 TYR C C N N 326 TYR O O N N 327 TYR CB C N N 328 TYR CG C Y N 329 TYR CD1 C Y N 330 TYR CD2 C Y N 331 TYR CE1 C Y N 332 TYR CE2 C Y N 333 TYR CZ C Y N 334 TYR OH O N N 335 TYR OXT O N N 336 TYR H H N N 337 TYR H2 H N N 338 TYR HA H N N 339 TYR HB2 H N N 340 TYR HB3 H N N 341 TYR HD1 H N N 342 TYR HD2 H N N 343 TYR HE1 H N N 344 TYR HE2 H N N 345 TYR HH H N N 346 TYR HXT H N N 347 VAL N N N N 348 VAL CA C N S 349 VAL C C N N 350 VAL O O N N 351 VAL CB C N N 352 VAL CG1 C N N 353 VAL CG2 C N N 354 VAL OXT O N N 355 VAL H H N N 356 VAL H2 H N N 357 VAL HA H N N 358 VAL HB H N N 359 VAL HG11 H N N 360 VAL HG12 H N N 361 VAL HG13 H N N 362 VAL HG21 H N N 363 VAL HG22 H N N 364 VAL HG23 H N N 365 VAL HXT H N N 366 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACT C O doub N N 1 ACT C OXT sing N N 2 ACT C CH3 sing N N 3 ACT CH3 H1 sing N N 4 ACT CH3 H2 sing N N 5 ACT CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 ASP N CA sing N N 61 ASP N H sing N N 62 ASP N H2 sing N N 63 ASP CA C sing N N 64 ASP CA CB sing N N 65 ASP CA HA sing N N 66 ASP C O doub N N 67 ASP C OXT sing N N 68 ASP CB CG sing N N 69 ASP CB HB2 sing N N 70 ASP CB HB3 sing N N 71 ASP CG OD1 doub N N 72 ASP CG OD2 sing N N 73 ASP OD2 HD2 sing N N 74 ASP OXT HXT sing N N 75 GLN N CA sing N N 76 GLN N H sing N N 77 GLN N H2 sing N N 78 GLN CA C sing N N 79 GLN CA CB sing N N 80 GLN CA HA sing N N 81 GLN C O doub N N 82 GLN C OXT sing N N 83 GLN CB CG sing N N 84 GLN CB HB2 sing N N 85 GLN CB HB3 sing N N 86 GLN CG CD sing N N 87 GLN CG HG2 sing N N 88 GLN CG HG3 sing N N 89 GLN CD OE1 doub N N 90 GLN CD NE2 sing N N 91 GLN NE2 HE21 sing N N 92 GLN NE2 HE22 sing N N 93 GLN OXT HXT sing N N 94 GLU N CA sing N N 95 GLU N H sing N N 96 GLU N H2 sing N N 97 GLU CA C sing N N 98 GLU CA CB sing N N 99 GLU CA HA sing N N 100 GLU C O doub N N 101 GLU C OXT sing N N 102 GLU CB CG sing N N 103 GLU CB HB2 sing N N 104 GLU CB HB3 sing N N 105 GLU CG CD sing N N 106 GLU CG HG2 sing N N 107 GLU CG HG3 sing N N 108 GLU CD OE1 doub N N 109 GLU CD OE2 sing N N 110 GLU OE2 HE2 sing N N 111 GLU OXT HXT sing N N 112 GLY N CA sing N N 113 GLY N H sing N N 114 GLY N H2 sing N N 115 GLY CA C sing N N 116 GLY CA HA2 sing N N 117 GLY CA HA3 sing N N 118 GLY C O doub N N 119 GLY C OXT sing N N 120 GLY OXT HXT sing N N 121 GOA C CA sing N N 122 GOA C O doub N N 123 GOA C OXT sing N N 124 GOA CA O2 sing N N 125 GOA CA H22 sing N N 126 GOA CA H21 sing N N 127 GOA OXT HXT sing N N 128 GOA O2 H20 sing N N 129 HIS N CA sing N N 130 HIS N H sing N N 131 HIS N H2 sing N N 132 HIS CA C sing N N 133 HIS CA CB sing N N 134 HIS CA HA sing N N 135 HIS C O doub N N 136 HIS C OXT sing N N 137 HIS CB CG sing N N 138 HIS CB HB2 sing N N 139 HIS CB HB3 sing N N 140 HIS CG ND1 sing Y N 141 HIS CG CD2 doub Y N 142 HIS ND1 CE1 doub Y N 143 HIS ND1 HD1 sing N N 144 HIS CD2 NE2 sing Y N 145 HIS CD2 HD2 sing N N 146 HIS CE1 NE2 sing Y N 147 HIS CE1 HE1 sing N N 148 HIS NE2 HE2 sing N N 149 HIS OXT HXT sing N N 150 HOH O H1 sing N N 151 HOH O H2 sing N N 152 ILE N CA sing N N 153 ILE N H sing N N 154 ILE N H2 sing N N 155 ILE CA C sing N N 156 ILE CA CB sing N N 157 ILE CA HA sing N N 158 ILE C O doub N N 159 ILE C OXT sing N N 160 ILE CB CG1 sing N N 161 ILE CB CG2 sing N N 162 ILE CB HB sing N N 163 ILE CG1 CD1 sing N N 164 ILE CG1 HG12 sing N N 165 ILE CG1 HG13 sing N N 166 ILE CG2 HG21 sing N N 167 ILE CG2 HG22 sing N N 168 ILE CG2 HG23 sing N N 169 ILE CD1 HD11 sing N N 170 ILE CD1 HD12 sing N N 171 ILE CD1 HD13 sing N N 172 ILE OXT HXT sing N N 173 LEU N CA sing N N 174 LEU N H sing N N 175 LEU N H2 sing N N 176 LEU CA C sing N N 177 LEU CA CB sing N N 178 LEU CA HA sing N N 179 LEU C O doub N N 180 LEU C OXT sing N N 181 LEU CB CG sing N N 182 LEU CB HB2 sing N N 183 LEU CB HB3 sing N N 184 LEU CG CD1 sing N N 185 LEU CG CD2 sing N N 186 LEU CG HG sing N N 187 LEU CD1 HD11 sing N N 188 LEU CD1 HD12 sing N N 189 LEU CD1 HD13 sing N N 190 LEU CD2 HD21 sing N N 191 LEU CD2 HD22 sing N N 192 LEU CD2 HD23 sing N N 193 LEU OXT HXT sing N N 194 LYS N CA sing N N 195 LYS N H sing N N 196 LYS N H2 sing N N 197 LYS CA C sing N N 198 LYS CA CB sing N N 199 LYS CA HA sing N N 200 LYS C O doub N N 201 LYS C OXT sing N N 202 LYS CB CG sing N N 203 LYS CB HB2 sing N N 204 LYS CB HB3 sing N N 205 LYS CG CD sing N N 206 LYS CG HG2 sing N N 207 LYS CG HG3 sing N N 208 LYS CD CE sing N N 209 LYS CD HD2 sing N N 210 LYS CD HD3 sing N N 211 LYS CE NZ sing N N 212 LYS CE HE2 sing N N 213 LYS CE HE3 sing N N 214 LYS NZ HZ1 sing N N 215 LYS NZ HZ2 sing N N 216 LYS NZ HZ3 sing N N 217 LYS OXT HXT sing N N 218 MET N CA sing N N 219 MET N H sing N N 220 MET N H2 sing N N 221 MET CA C sing N N 222 MET CA CB sing N N 223 MET CA HA sing N N 224 MET C O doub N N 225 MET C OXT sing N N 226 MET CB CG sing N N 227 MET CB HB2 sing N N 228 MET CB HB3 sing N N 229 MET CG SD sing N N 230 MET CG HG2 sing N N 231 MET CG HG3 sing N N 232 MET SD CE sing N N 233 MET CE HE1 sing N N 234 MET CE HE2 sing N N 235 MET CE HE3 sing N N 236 MET OXT HXT sing N N 237 PHE N CA sing N N 238 PHE N H sing N N 239 PHE N H2 sing N N 240 PHE CA C sing N N 241 PHE CA CB sing N N 242 PHE CA HA sing N N 243 PHE C O doub N N 244 PHE C OXT sing N N 245 PHE CB CG sing N N 246 PHE CB HB2 sing N N 247 PHE CB HB3 sing N N 248 PHE CG CD1 doub Y N 249 PHE CG CD2 sing Y N 250 PHE CD1 CE1 sing Y N 251 PHE CD1 HD1 sing N N 252 PHE CD2 CE2 doub Y N 253 PHE CD2 HD2 sing N N 254 PHE CE1 CZ doub Y N 255 PHE CE1 HE1 sing N N 256 PHE CE2 CZ sing Y N 257 PHE CE2 HE2 sing N N 258 PHE CZ HZ sing N N 259 PHE OXT HXT sing N N 260 PRO N CA sing N N 261 PRO N CD sing N N 262 PRO N H sing N N 263 PRO CA C sing N N 264 PRO CA CB sing N N 265 PRO CA HA sing N N 266 PRO C O doub N N 267 PRO C OXT sing N N 268 PRO CB CG sing N N 269 PRO CB HB2 sing N N 270 PRO CB HB3 sing N N 271 PRO CG CD sing N N 272 PRO CG HG2 sing N N 273 PRO CG HG3 sing N N 274 PRO CD HD2 sing N N 275 PRO CD HD3 sing N N 276 PRO OXT HXT sing N N 277 SER N CA sing N N 278 SER N H sing N N 279 SER N H2 sing N N 280 SER CA C sing N N 281 SER CA CB sing N N 282 SER CA HA sing N N 283 SER C O doub N N 284 SER C OXT sing N N 285 SER CB OG sing N N 286 SER CB HB2 sing N N 287 SER CB HB3 sing N N 288 SER OG HG sing N N 289 SER OXT HXT sing N N 290 THR N CA sing N N 291 THR N H sing N N 292 THR N H2 sing N N 293 THR CA C sing N N 294 THR CA CB sing N N 295 THR CA HA sing N N 296 THR C O doub N N 297 THR C OXT sing N N 298 THR CB OG1 sing N N 299 THR CB CG2 sing N N 300 THR CB HB sing N N 301 THR OG1 HG1 sing N N 302 THR CG2 HG21 sing N N 303 THR CG2 HG22 sing N N 304 THR CG2 HG23 sing N N 305 THR OXT HXT sing N N 306 TYR N CA sing N N 307 TYR N H sing N N 308 TYR N H2 sing N N 309 TYR CA C sing N N 310 TYR CA CB sing N N 311 TYR CA HA sing N N 312 TYR C O doub N N 313 TYR C OXT sing N N 314 TYR CB CG sing N N 315 TYR CB HB2 sing N N 316 TYR CB HB3 sing N N 317 TYR CG CD1 doub Y N 318 TYR CG CD2 sing Y N 319 TYR CD1 CE1 sing Y N 320 TYR CD1 HD1 sing N N 321 TYR CD2 CE2 doub Y N 322 TYR CD2 HD2 sing N N 323 TYR CE1 CZ doub Y N 324 TYR CE1 HE1 sing N N 325 TYR CE2 CZ sing Y N 326 TYR CE2 HE2 sing N N 327 TYR CZ OH sing N N 328 TYR OH HH sing N N 329 TYR OXT HXT sing N N 330 VAL N CA sing N N 331 VAL N H sing N N 332 VAL N H2 sing N N 333 VAL CA C sing N N 334 VAL CA CB sing N N 335 VAL CA HA sing N N 336 VAL C O doub N N 337 VAL C OXT sing N N 338 VAL CB CG1 sing N N 339 VAL CB CG2 sing N N 340 VAL CB HB sing N N 341 VAL CG1 HG11 sing N N 342 VAL CG1 HG12 sing N N 343 VAL CG1 HG13 sing N N 344 VAL CG2 HG21 sing N N 345 VAL CG2 HG22 sing N N 346 VAL CG2 HG23 sing N N 347 VAL OXT HXT sing N N 348 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type other _pdbx_initial_refinement_model.source_name ? _pdbx_initial_refinement_model.details 'in-house model' # _atom_sites.entry_id 6N63 _atom_sites.fract_transf_matrix[1][1] 0.012287 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012287 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015183 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE H N O S # loop_