data_6N6S # _entry.id 6N6S # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6N6S pdb_00006n6s 10.2210/pdb6n6s/pdb WWPDB D_1000238145 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-07-17 2 'Structure model' 1 1 2019-08-28 3 'Structure model' 1 2 2024-03-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 3 'Structure model' '_database_2.pdbx_DOI' 5 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6N6S _pdbx_database_status.recvd_initial_deposition_date 2018-11-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Rahighi, S.' 1 ? 'Dikic, I.' 2 ? 'Wakatsuki, S.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Mol.Biol. _citation.journal_id_ASTM JMOBAK _citation.journal_id_CSD 0070 _citation.journal_id_ISSN 1089-8638 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 431 _citation.language ? _citation.page_first 3146 _citation.page_last 3156 _citation.title 'Molecular Recognition of M1-Linked Ubiquitin Chains by Native and Phosphorylated UBAN Domains.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jmb.2019.06.012 _citation.pdbx_database_id_PubMed 31247202 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Herhaus, L.' 1 ? primary 'van den Bedem, H.' 2 ? primary 'Tang, S.' 3 ? primary 'Maslennikov, I.' 4 ? primary 'Wakatsuki, S.' 5 ? primary 'Dikic, I.' 6 ? primary 'Rahighi, S.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'TNFAIP3-interacting protein 1' 8689.812 4 ? ? ? ? 2 water nat water 18.015 32 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;A20-binding inhibitor of NF-kappa-B activation 1,ABIN-1,Nef-associated factor 1,Naf1,Virion-associated nuclear shuttling protein,mVAN ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSLRKQELVTQNELLKQQVKIFEEDFQRERSDRERMNEEKEELKKQVEKLQAQVTLTNAQLKTLKEEEKAKE _entity_poly.pdbx_seq_one_letter_code_can GSLRKQELVTQNELLKQQVKIFEEDFQRERSDRERMNEEKEELKKQVEKLQAQVTLTNAQLKTLKEEEKAKE _entity_poly.pdbx_strand_id B,D,A,C _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 LEU n 1 4 ARG n 1 5 LYS n 1 6 GLN n 1 7 GLU n 1 8 LEU n 1 9 VAL n 1 10 THR n 1 11 GLN n 1 12 ASN n 1 13 GLU n 1 14 LEU n 1 15 LEU n 1 16 LYS n 1 17 GLN n 1 18 GLN n 1 19 VAL n 1 20 LYS n 1 21 ILE n 1 22 PHE n 1 23 GLU n 1 24 GLU n 1 25 ASP n 1 26 PHE n 1 27 GLN n 1 28 ARG n 1 29 GLU n 1 30 ARG n 1 31 SER n 1 32 ASP n 1 33 ARG n 1 34 GLU n 1 35 ARG n 1 36 MET n 1 37 ASN n 1 38 GLU n 1 39 GLU n 1 40 LYS n 1 41 GLU n 1 42 GLU n 1 43 LEU n 1 44 LYS n 1 45 LYS n 1 46 GLN n 1 47 VAL n 1 48 GLU n 1 49 LYS n 1 50 LEU n 1 51 GLN n 1 52 ALA n 1 53 GLN n 1 54 VAL n 1 55 THR n 1 56 LEU n 1 57 THR n 1 58 ASN n 1 59 ALA n 1 60 GLN n 1 61 LEU n 1 62 LYS n 1 63 THR n 1 64 LEU n 1 65 LYS n 1 66 GLU n 1 67 GLU n 1 68 GLU n 1 69 LYS n 1 70 ALA n 1 71 LYS n 1 72 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 72 _entity_src_gen.gene_src_common_name Mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Tnip1, Abin, Naf1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli K-12' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 83333 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 461 ? ? ? B . n A 1 2 SER 2 462 ? ? ? B . n A 1 3 LEU 3 463 ? ? ? B . n A 1 4 ARG 4 464 464 ARG ARG B . n A 1 5 LYS 5 465 465 LYS LYS B . n A 1 6 GLN 6 466 466 GLN GLN B . n A 1 7 GLU 7 467 467 GLU GLU B . n A 1 8 LEU 8 468 468 LEU LEU B . n A 1 9 VAL 9 469 469 VAL VAL B . n A 1 10 THR 10 470 470 THR THR B . n A 1 11 GLN 11 471 471 GLN GLN B . n A 1 12 ASN 12 472 472 ASN ASN B . n A 1 13 GLU 13 473 473 GLU GLU B . n A 1 14 LEU 14 474 474 LEU LEU B . n A 1 15 LEU 15 475 475 LEU LEU B . n A 1 16 LYS 16 476 476 LYS LYS B . n A 1 17 GLN 17 477 477 GLN GLN B . n A 1 18 GLN 18 478 478 GLN GLN B . n A 1 19 VAL 19 479 479 VAL VAL B . n A 1 20 LYS 20 480 480 LYS LYS B . n A 1 21 ILE 21 481 481 ILE ILE B . n A 1 22 PHE 22 482 482 PHE PHE B . n A 1 23 GLU 23 483 483 GLU GLU B . n A 1 24 GLU 24 484 484 GLU GLU B . n A 1 25 ASP 25 485 485 ASP ASP B . n A 1 26 PHE 26 486 486 PHE PHE B . n A 1 27 GLN 27 487 487 GLN GLN B . n A 1 28 ARG 28 488 488 ARG ARG B . n A 1 29 GLU 29 489 489 GLU GLU B . n A 1 30 ARG 30 490 490 ARG ARG B . n A 1 31 SER 31 491 491 SER SER B . n A 1 32 ASP 32 492 492 ASP ASP B . n A 1 33 ARG 33 493 493 ARG ARG B . n A 1 34 GLU 34 494 494 GLU GLU B . n A 1 35 ARG 35 495 495 ARG ARG B . n A 1 36 MET 36 496 496 MET MET B . n A 1 37 ASN 37 497 497 ASN ASN B . n A 1 38 GLU 38 498 498 GLU GLU B . n A 1 39 GLU 39 499 499 GLU GLU B . n A 1 40 LYS 40 500 500 LYS LYS B . n A 1 41 GLU 41 501 501 GLU GLU B . n A 1 42 GLU 42 502 502 GLU GLU B . n A 1 43 LEU 43 503 503 LEU LEU B . n A 1 44 LYS 44 504 504 LYS LYS B . n A 1 45 LYS 45 505 505 LYS LYS B . n A 1 46 GLN 46 506 506 GLN GLN B . n A 1 47 VAL 47 507 507 VAL VAL B . n A 1 48 GLU 48 508 508 GLU GLU B . n A 1 49 LYS 49 509 509 LYS LYS B . n A 1 50 LEU 50 510 510 LEU LEU B . n A 1 51 GLN 51 511 511 GLN GLN B . n A 1 52 ALA 52 512 512 ALA ALA B . n A 1 53 GLN 53 513 513 GLN GLN B . n A 1 54 VAL 54 514 514 VAL VAL B . n A 1 55 THR 55 515 515 THR THR B . n A 1 56 LEU 56 516 516 LEU LEU B . n A 1 57 THR 57 517 517 THR THR B . n A 1 58 ASN 58 518 518 ASN ASN B . n A 1 59 ALA 59 519 519 ALA ALA B . n A 1 60 GLN 60 520 520 GLN GLN B . n A 1 61 LEU 61 521 521 LEU LEU B . n A 1 62 LYS 62 522 522 LYS LYS B . n A 1 63 THR 63 523 523 THR THR B . n A 1 64 LEU 64 524 524 LEU LEU B . n A 1 65 LYS 65 525 525 LYS LYS B . n A 1 66 GLU 66 526 526 GLU GLU B . n A 1 67 GLU 67 527 527 GLU GLU B . n A 1 68 GLU 68 528 528 GLU GLU B . n A 1 69 LYS 69 529 ? ? ? B . n A 1 70 ALA 70 530 ? ? ? B . n A 1 71 LYS 71 531 ? ? ? B . n A 1 72 GLU 72 532 ? ? ? B . n B 1 1 GLY 1 461 ? ? ? D . n B 1 2 SER 2 462 ? ? ? D . n B 1 3 LEU 3 463 ? ? ? D . n B 1 4 ARG 4 464 464 ARG ARG D . n B 1 5 LYS 5 465 465 LYS LYS D . n B 1 6 GLN 6 466 466 GLN GLN D . n B 1 7 GLU 7 467 467 GLU GLU D . n B 1 8 LEU 8 468 468 LEU LEU D . n B 1 9 VAL 9 469 469 VAL VAL D . n B 1 10 THR 10 470 470 THR THR D . n B 1 11 GLN 11 471 471 GLN GLN D . n B 1 12 ASN 12 472 472 ASN ASN D . n B 1 13 GLU 13 473 473 GLU GLU D . n B 1 14 LEU 14 474 474 LEU LEU D . n B 1 15 LEU 15 475 475 LEU LEU D . n B 1 16 LYS 16 476 476 LYS LYS D . n B 1 17 GLN 17 477 477 GLN GLN D . n B 1 18 GLN 18 478 478 GLN GLN D . n B 1 19 VAL 19 479 479 VAL VAL D . n B 1 20 LYS 20 480 480 LYS LYS D . n B 1 21 ILE 21 481 481 ILE ILE D . n B 1 22 PHE 22 482 482 PHE PHE D . n B 1 23 GLU 23 483 483 GLU GLU D . n B 1 24 GLU 24 484 484 GLU GLU D . n B 1 25 ASP 25 485 485 ASP ASP D . n B 1 26 PHE 26 486 486 PHE PHE D . n B 1 27 GLN 27 487 487 GLN GLN D . n B 1 28 ARG 28 488 488 ARG ARG D . n B 1 29 GLU 29 489 489 GLU GLU D . n B 1 30 ARG 30 490 490 ARG ARG D . n B 1 31 SER 31 491 491 SER SER D . n B 1 32 ASP 32 492 492 ASP ASP D . n B 1 33 ARG 33 493 493 ARG ARG D . n B 1 34 GLU 34 494 494 GLU GLU D . n B 1 35 ARG 35 495 495 ARG ARG D . n B 1 36 MET 36 496 496 MET MET D . n B 1 37 ASN 37 497 497 ASN ASN D . n B 1 38 GLU 38 498 498 GLU GLU D . n B 1 39 GLU 39 499 499 GLU GLU D . n B 1 40 LYS 40 500 500 LYS LYS D . n B 1 41 GLU 41 501 501 GLU GLU D . n B 1 42 GLU 42 502 502 GLU GLU D . n B 1 43 LEU 43 503 503 LEU LEU D . n B 1 44 LYS 44 504 504 LYS LYS D . n B 1 45 LYS 45 505 505 LYS LYS D . n B 1 46 GLN 46 506 506 GLN GLN D . n B 1 47 VAL 47 507 507 VAL VAL D . n B 1 48 GLU 48 508 508 GLU GLU D . n B 1 49 LYS 49 509 509 LYS LYS D . n B 1 50 LEU 50 510 510 LEU LEU D . n B 1 51 GLN 51 511 511 GLN GLN D . n B 1 52 ALA 52 512 512 ALA ALA D . n B 1 53 GLN 53 513 513 GLN GLN D . n B 1 54 VAL 54 514 514 VAL VAL D . n B 1 55 THR 55 515 515 THR THR D . n B 1 56 LEU 56 516 516 LEU LEU D . n B 1 57 THR 57 517 517 THR THR D . n B 1 58 ASN 58 518 518 ASN ASN D . n B 1 59 ALA 59 519 519 ALA ALA D . n B 1 60 GLN 60 520 520 GLN GLN D . n B 1 61 LEU 61 521 521 LEU LEU D . n B 1 62 LYS 62 522 522 LYS LYS D . n B 1 63 THR 63 523 523 THR THR D . n B 1 64 LEU 64 524 524 LEU LEU D . n B 1 65 LYS 65 525 525 LYS LYS D . n B 1 66 GLU 66 526 526 GLU GLU D . n B 1 67 GLU 67 527 527 GLU GLU D . n B 1 68 GLU 68 528 528 GLU GLU D . n B 1 69 LYS 69 529 529 LYS LYS D . n B 1 70 ALA 70 530 530 ALA ALA D . n B 1 71 LYS 71 531 531 LYS LYS D . n B 1 72 GLU 72 532 532 GLU GLU D . n C 1 1 GLY 1 461 ? ? ? A . n C 1 2 SER 2 462 ? ? ? A . n C 1 3 LEU 3 463 ? ? ? A . n C 1 4 ARG 4 464 ? ? ? A . n C 1 5 LYS 5 465 465 LYS LYS A . n C 1 6 GLN 6 466 466 GLN GLN A . n C 1 7 GLU 7 467 467 GLU GLU A . n C 1 8 LEU 8 468 468 LEU LEU A . n C 1 9 VAL 9 469 469 VAL VAL A . n C 1 10 THR 10 470 470 THR THR A . n C 1 11 GLN 11 471 471 GLN GLN A . n C 1 12 ASN 12 472 472 ASN ASN A . n C 1 13 GLU 13 473 473 GLU GLU A . n C 1 14 LEU 14 474 474 LEU LEU A . n C 1 15 LEU 15 475 475 LEU LEU A . n C 1 16 LYS 16 476 476 LYS LYS A . n C 1 17 GLN 17 477 477 GLN GLN A . n C 1 18 GLN 18 478 478 GLN GLN A . n C 1 19 VAL 19 479 479 VAL VAL A . n C 1 20 LYS 20 480 480 LYS LYS A . n C 1 21 ILE 21 481 481 ILE ILE A . n C 1 22 PHE 22 482 482 PHE PHE A . n C 1 23 GLU 23 483 483 GLU GLU A . n C 1 24 GLU 24 484 484 GLU GLU A . n C 1 25 ASP 25 485 485 ASP ASP A . n C 1 26 PHE 26 486 486 PHE PHE A . n C 1 27 GLN 27 487 487 GLN GLN A . n C 1 28 ARG 28 488 488 ARG ARG A . n C 1 29 GLU 29 489 489 GLU GLU A . n C 1 30 ARG 30 490 490 ARG ARG A . n C 1 31 SER 31 491 491 SER SER A . n C 1 32 ASP 32 492 492 ASP ASP A . n C 1 33 ARG 33 493 493 ARG ARG A . n C 1 34 GLU 34 494 494 GLU GLU A . n C 1 35 ARG 35 495 495 ARG ARG A . n C 1 36 MET 36 496 496 MET MET A . n C 1 37 ASN 37 497 497 ASN ASN A . n C 1 38 GLU 38 498 498 GLU GLU A . n C 1 39 GLU 39 499 499 GLU GLU A . n C 1 40 LYS 40 500 500 LYS LYS A . n C 1 41 GLU 41 501 501 GLU GLU A . n C 1 42 GLU 42 502 502 GLU GLU A . n C 1 43 LEU 43 503 503 LEU LEU A . n C 1 44 LYS 44 504 504 LYS LYS A . n C 1 45 LYS 45 505 505 LYS LYS A . n C 1 46 GLN 46 506 506 GLN GLN A . n C 1 47 VAL 47 507 507 VAL VAL A . n C 1 48 GLU 48 508 508 GLU GLU A . n C 1 49 LYS 49 509 509 LYS LYS A . n C 1 50 LEU 50 510 510 LEU LEU A . n C 1 51 GLN 51 511 511 GLN GLN A . n C 1 52 ALA 52 512 512 ALA ALA A . n C 1 53 GLN 53 513 513 GLN GLN A . n C 1 54 VAL 54 514 514 VAL VAL A . n C 1 55 THR 55 515 515 THR THR A . n C 1 56 LEU 56 516 516 LEU LEU A . n C 1 57 THR 57 517 517 THR THR A . n C 1 58 ASN 58 518 518 ASN ASN A . n C 1 59 ALA 59 519 519 ALA ALA A . n C 1 60 GLN 60 520 520 GLN GLN A . n C 1 61 LEU 61 521 521 LEU LEU A . n C 1 62 LYS 62 522 522 LYS LYS A . n C 1 63 THR 63 523 523 THR THR A . n C 1 64 LEU 64 524 524 LEU LEU A . n C 1 65 LYS 65 525 525 LYS LYS A . n C 1 66 GLU 66 526 526 GLU GLU A . n C 1 67 GLU 67 527 527 GLU GLU A . n C 1 68 GLU 68 528 528 GLU GLU A . n C 1 69 LYS 69 529 529 LYS LYS A . n C 1 70 ALA 70 530 ? ? ? A . n C 1 71 LYS 71 531 ? ? ? A . n C 1 72 GLU 72 532 ? ? ? A . n D 1 1 GLY 1 461 461 GLY GLY C . n D 1 2 SER 2 462 462 SER SER C . n D 1 3 LEU 3 463 463 LEU LEU C . n D 1 4 ARG 4 464 464 ARG ARG C . n D 1 5 LYS 5 465 465 LYS LYS C . n D 1 6 GLN 6 466 466 GLN GLN C . n D 1 7 GLU 7 467 467 GLU GLU C . n D 1 8 LEU 8 468 468 LEU LEU C . n D 1 9 VAL 9 469 469 VAL VAL C . n D 1 10 THR 10 470 470 THR THR C . n D 1 11 GLN 11 471 471 GLN GLN C . n D 1 12 ASN 12 472 472 ASN ASN C . n D 1 13 GLU 13 473 473 GLU GLU C . n D 1 14 LEU 14 474 474 LEU LEU C . n D 1 15 LEU 15 475 475 LEU LEU C . n D 1 16 LYS 16 476 476 LYS LYS C . n D 1 17 GLN 17 477 477 GLN GLN C . n D 1 18 GLN 18 478 478 GLN GLN C . n D 1 19 VAL 19 479 479 VAL VAL C . n D 1 20 LYS 20 480 480 LYS LYS C . n D 1 21 ILE 21 481 481 ILE ILE C . n D 1 22 PHE 22 482 482 PHE PHE C . n D 1 23 GLU 23 483 483 GLU GLU C . n D 1 24 GLU 24 484 484 GLU GLU C . n D 1 25 ASP 25 485 485 ASP ASP C . n D 1 26 PHE 26 486 486 PHE PHE C . n D 1 27 GLN 27 487 487 GLN GLN C . n D 1 28 ARG 28 488 488 ARG ARG C . n D 1 29 GLU 29 489 489 GLU GLU C . n D 1 30 ARG 30 490 490 ARG ARG C . n D 1 31 SER 31 491 491 SER SER C . n D 1 32 ASP 32 492 492 ASP ASP C . n D 1 33 ARG 33 493 493 ARG ARG C . n D 1 34 GLU 34 494 494 GLU GLU C . n D 1 35 ARG 35 495 495 ARG ARG C . n D 1 36 MET 36 496 496 MET MET C . n D 1 37 ASN 37 497 497 ASN ASN C . n D 1 38 GLU 38 498 498 GLU GLU C . n D 1 39 GLU 39 499 499 GLU GLU C . n D 1 40 LYS 40 500 500 LYS LYS C . n D 1 41 GLU 41 501 501 GLU GLU C . n D 1 42 GLU 42 502 502 GLU GLU C . n D 1 43 LEU 43 503 503 LEU LEU C . n D 1 44 LYS 44 504 504 LYS LYS C . n D 1 45 LYS 45 505 505 LYS LYS C . n D 1 46 GLN 46 506 506 GLN GLN C . n D 1 47 VAL 47 507 507 VAL VAL C . n D 1 48 GLU 48 508 508 GLU GLU C . n D 1 49 LYS 49 509 509 LYS LYS C . n D 1 50 LEU 50 510 510 LEU LEU C . n D 1 51 GLN 51 511 511 GLN GLN C . n D 1 52 ALA 52 512 512 ALA ALA C . n D 1 53 GLN 53 513 513 GLN GLN C . n D 1 54 VAL 54 514 514 VAL VAL C . n D 1 55 THR 55 515 515 THR THR C . n D 1 56 LEU 56 516 516 LEU LEU C . n D 1 57 THR 57 517 517 THR THR C . n D 1 58 ASN 58 518 518 ASN ASN C . n D 1 59 ALA 59 519 519 ALA ALA C . n D 1 60 GLN 60 520 520 GLN GLN C . n D 1 61 LEU 61 521 521 LEU LEU C . n D 1 62 LYS 62 522 522 LYS LYS C . n D 1 63 THR 63 523 523 THR THR C . n D 1 64 LEU 64 524 524 LEU LEU C . n D 1 65 LYS 65 525 525 LYS LYS C . n D 1 66 GLU 66 526 526 GLU GLU C . n D 1 67 GLU 67 527 527 GLU GLU C . n D 1 68 GLU 68 528 528 GLU GLU C . n D 1 69 LYS 69 529 ? ? ? C . n D 1 70 ALA 70 530 ? ? ? C . n D 1 71 LYS 71 531 ? ? ? C . n D 1 72 GLU 72 532 ? ? ? C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 2 HOH 1 601 26 HOH HOH B . E 2 HOH 2 602 12 HOH HOH B . E 2 HOH 3 603 11 HOH HOH B . E 2 HOH 4 604 9 HOH HOH B . E 2 HOH 5 605 25 HOH HOH B . E 2 HOH 6 606 30 HOH HOH B . E 2 HOH 7 607 31 HOH HOH B . E 2 HOH 8 608 15 HOH HOH B . E 2 HOH 9 609 13 HOH HOH B . E 2 HOH 10 610 23 HOH HOH B . E 2 HOH 11 611 14 HOH HOH B . F 2 HOH 1 601 10 HOH HOH D . F 2 HOH 2 602 28 HOH HOH D . F 2 HOH 3 603 16 HOH HOH D . F 2 HOH 4 604 29 HOH HOH D . F 2 HOH 5 605 7 HOH HOH D . F 2 HOH 6 606 8 HOH HOH D . F 2 HOH 7 607 19 HOH HOH D . F 2 HOH 8 608 6 HOH HOH D . F 2 HOH 9 609 32 HOH HOH D . F 2 HOH 10 610 17 HOH HOH D . G 2 HOH 1 601 2 HOH HOH A . G 2 HOH 2 602 4 HOH HOH A . G 2 HOH 3 603 34 HOH HOH A . G 2 HOH 4 604 33 HOH HOH A . G 2 HOH 5 605 22 HOH HOH A . G 2 HOH 6 606 21 HOH HOH A . G 2 HOH 7 607 1 HOH HOH A . G 2 HOH 8 608 24 HOH HOH A . H 2 HOH 1 601 20 HOH HOH C . H 2 HOH 2 602 18 HOH HOH C . H 2 HOH 3 603 27 HOH HOH C . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0158 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 91.49 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6N6S _cell.details ? _cell.formula_units_Z ? _cell.length_a 51.290 _cell.length_a_esd ? _cell.length_b 64.780 _cell.length_b_esd ? _cell.length_c 104.403 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6N6S _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6N6S _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.49 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.68 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;20% PEG 3350, 0.2 M sodium malonate pH 5.0 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2009-12-09 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE AR-NW12A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline AR-NW12A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6N6S _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.47 _reflns.d_resolution_low 32 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6860 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.2 _reflns.pdbx_Rmerge_I_obs 0.077 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.989 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.47 _reflns_shell.d_res_low 2.57 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1377 _reflns_shell.percent_possible_all 98.5 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.104 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.2 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.981 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 2.43 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] -3.25 _refine.aniso_B[2][2] -1.06 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -1.20 _refine.B_iso_max ? _refine.B_iso_mean 3.369 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.759 _refine.correlation_coeff_Fo_to_Fc_free 0.704 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6N6S _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.00 _refine.ls_d_res_low 32.00 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6433 _refine.ls_number_reflns_R_free 333 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.65 _refine.ls_percent_reflns_R_free 5.4 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.29980 _refine.ls_R_factor_R_free 0.32785 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.29821 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.605 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 27.672 _refine.overall_SU_ML 0.500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 2276 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 32 _refine_hist.number_atoms_total 2308 _refine_hist.d_res_high 3.00 _refine_hist.d_res_low 32.00 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.012 0.019 2280 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 2223 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.269 1.989 3022 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.844 3.000 5221 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.075 5.000 263 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 32.668 26.714 140 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.459 15.000 550 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 11.714 15.000 19 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.053 0.200 335 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 0.020 2444 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 379 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 0.461 0.304 1064 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 0.461 0.303 1063 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 0.852 0.448 1323 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 0.852 0.448 1324 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 0.374 0.380 1215 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 0.366 0.378 1213 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 0.744 0.549 1699 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 1.808 3.621 2547 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 1.810 3.625 2548 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 3.000 _refine_ls_shell.d_res_low 3.077 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 24 _refine_ls_shell.number_reflns_R_work 469 _refine_ls_shell.percent_reflns_obs 98.01 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.443 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.359 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6N6S _struct.title 'Crystal structure of ABIN-1 UBAN' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6N6S _struct_keywords.text 'Ubiquitin-binding domain, A20-binding protein, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TNIP1_MOUSE _struct_ref.pdbx_db_accession Q9WUU8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code LRKQELVTQNELLKQQVKIFEEDFQRERSDRERMNEEKEELKKQVEKLQAQVTLTNAQLKTLKEEEKAKE _struct_ref.pdbx_align_begin 463 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6N6S B 3 ? 72 ? Q9WUU8 463 ? 532 ? 463 532 2 1 6N6S D 3 ? 72 ? Q9WUU8 463 ? 532 ? 463 532 3 1 6N6S A 3 ? 72 ? Q9WUU8 463 ? 532 ? 463 532 4 1 6N6S C 3 ? 72 ? Q9WUU8 463 ? 532 ? 463 532 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6N6S GLY B 1 ? UNP Q9WUU8 ? ? 'expression tag' 461 1 1 6N6S SER B 2 ? UNP Q9WUU8 ? ? 'expression tag' 462 2 2 6N6S GLY D 1 ? UNP Q9WUU8 ? ? 'expression tag' 461 3 2 6N6S SER D 2 ? UNP Q9WUU8 ? ? 'expression tag' 462 4 3 6N6S GLY A 1 ? UNP Q9WUU8 ? ? 'expression tag' 461 5 3 6N6S SER A 2 ? UNP Q9WUU8 ? ? 'expression tag' 462 6 4 6N6S GLY C 1 ? UNP Q9WUU8 ? ? 'expression tag' 461 7 4 6N6S SER C 2 ? UNP Q9WUU8 ? ? 'expression tag' 462 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 4 ? GLU A 67 ? ARG B 464 GLU B 527 1 ? 64 HELX_P HELX_P2 AA2 LYS B 5 ? GLU B 72 ? LYS D 465 GLU D 532 1 ? 68 HELX_P HELX_P3 AA3 GLN C 6 ? LYS C 69 ? GLN A 466 LYS A 529 1 ? 64 HELX_P HELX_P4 AA4 SER D 2 ? GLU D 68 ? SER C 462 GLU C 528 1 ? 67 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 B GLY 461 ? A GLY 1 2 1 Y 1 B SER 462 ? A SER 2 3 1 Y 1 B LEU 463 ? A LEU 3 4 1 Y 1 B LYS 529 ? A LYS 69 5 1 Y 1 B ALA 530 ? A ALA 70 6 1 Y 1 B LYS 531 ? A LYS 71 7 1 Y 1 B GLU 532 ? A GLU 72 8 1 Y 1 D GLY 461 ? B GLY 1 9 1 Y 1 D SER 462 ? B SER 2 10 1 Y 1 D LEU 463 ? B LEU 3 11 1 Y 1 A GLY 461 ? C GLY 1 12 1 Y 1 A SER 462 ? C SER 2 13 1 Y 1 A LEU 463 ? C LEU 3 14 1 Y 1 A ARG 464 ? C ARG 4 15 1 Y 1 A ALA 530 ? C ALA 70 16 1 Y 1 A LYS 531 ? C LYS 71 17 1 Y 1 A GLU 532 ? C GLU 72 18 1 Y 1 C LYS 529 ? D LYS 69 19 1 Y 1 C ALA 530 ? D ALA 70 20 1 Y 1 C LYS 531 ? D LYS 71 21 1 Y 1 C GLU 532 ? D GLU 72 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HOH O O N N 123 HOH H1 H N N 124 HOH H2 H N N 125 ILE N N N N 126 ILE CA C N S 127 ILE C C N N 128 ILE O O N N 129 ILE CB C N S 130 ILE CG1 C N N 131 ILE CG2 C N N 132 ILE CD1 C N N 133 ILE OXT O N N 134 ILE H H N N 135 ILE H2 H N N 136 ILE HA H N N 137 ILE HB H N N 138 ILE HG12 H N N 139 ILE HG13 H N N 140 ILE HG21 H N N 141 ILE HG22 H N N 142 ILE HG23 H N N 143 ILE HD11 H N N 144 ILE HD12 H N N 145 ILE HD13 H N N 146 ILE HXT H N N 147 LEU N N N N 148 LEU CA C N S 149 LEU C C N N 150 LEU O O N N 151 LEU CB C N N 152 LEU CG C N N 153 LEU CD1 C N N 154 LEU CD2 C N N 155 LEU OXT O N N 156 LEU H H N N 157 LEU H2 H N N 158 LEU HA H N N 159 LEU HB2 H N N 160 LEU HB3 H N N 161 LEU HG H N N 162 LEU HD11 H N N 163 LEU HD12 H N N 164 LEU HD13 H N N 165 LEU HD21 H N N 166 LEU HD22 H N N 167 LEU HD23 H N N 168 LEU HXT H N N 169 LYS N N N N 170 LYS CA C N S 171 LYS C C N N 172 LYS O O N N 173 LYS CB C N N 174 LYS CG C N N 175 LYS CD C N N 176 LYS CE C N N 177 LYS NZ N N N 178 LYS OXT O N N 179 LYS H H N N 180 LYS H2 H N N 181 LYS HA H N N 182 LYS HB2 H N N 183 LYS HB3 H N N 184 LYS HG2 H N N 185 LYS HG3 H N N 186 LYS HD2 H N N 187 LYS HD3 H N N 188 LYS HE2 H N N 189 LYS HE3 H N N 190 LYS HZ1 H N N 191 LYS HZ2 H N N 192 LYS HZ3 H N N 193 LYS HXT H N N 194 MET N N N N 195 MET CA C N S 196 MET C C N N 197 MET O O N N 198 MET CB C N N 199 MET CG C N N 200 MET SD S N N 201 MET CE C N N 202 MET OXT O N N 203 MET H H N N 204 MET H2 H N N 205 MET HA H N N 206 MET HB2 H N N 207 MET HB3 H N N 208 MET HG2 H N N 209 MET HG3 H N N 210 MET HE1 H N N 211 MET HE2 H N N 212 MET HE3 H N N 213 MET HXT H N N 214 PHE N N N N 215 PHE CA C N S 216 PHE C C N N 217 PHE O O N N 218 PHE CB C N N 219 PHE CG C Y N 220 PHE CD1 C Y N 221 PHE CD2 C Y N 222 PHE CE1 C Y N 223 PHE CE2 C Y N 224 PHE CZ C Y N 225 PHE OXT O N N 226 PHE H H N N 227 PHE H2 H N N 228 PHE HA H N N 229 PHE HB2 H N N 230 PHE HB3 H N N 231 PHE HD1 H N N 232 PHE HD2 H N N 233 PHE HE1 H N N 234 PHE HE2 H N N 235 PHE HZ H N N 236 PHE HXT H N N 237 SER N N N N 238 SER CA C N S 239 SER C C N N 240 SER O O N N 241 SER CB C N N 242 SER OG O N N 243 SER OXT O N N 244 SER H H N N 245 SER H2 H N N 246 SER HA H N N 247 SER HB2 H N N 248 SER HB3 H N N 249 SER HG H N N 250 SER HXT H N N 251 THR N N N N 252 THR CA C N S 253 THR C C N N 254 THR O O N N 255 THR CB C N R 256 THR OG1 O N N 257 THR CG2 C N N 258 THR OXT O N N 259 THR H H N N 260 THR H2 H N N 261 THR HA H N N 262 THR HB H N N 263 THR HG1 H N N 264 THR HG21 H N N 265 THR HG22 H N N 266 THR HG23 H N N 267 THR HXT H N N 268 VAL N N N N 269 VAL CA C N S 270 VAL C C N N 271 VAL O O N N 272 VAL CB C N N 273 VAL CG1 C N N 274 VAL CG2 C N N 275 VAL OXT O N N 276 VAL H H N N 277 VAL H2 H N N 278 VAL HA H N N 279 VAL HB H N N 280 VAL HG11 H N N 281 VAL HG12 H N N 282 VAL HG13 H N N 283 VAL HG21 H N N 284 VAL HG22 H N N 285 VAL HG23 H N N 286 VAL HXT H N N 287 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HOH O H1 sing N N 116 HOH O H2 sing N N 117 ILE N CA sing N N 118 ILE N H sing N N 119 ILE N H2 sing N N 120 ILE CA C sing N N 121 ILE CA CB sing N N 122 ILE CA HA sing N N 123 ILE C O doub N N 124 ILE C OXT sing N N 125 ILE CB CG1 sing N N 126 ILE CB CG2 sing N N 127 ILE CB HB sing N N 128 ILE CG1 CD1 sing N N 129 ILE CG1 HG12 sing N N 130 ILE CG1 HG13 sing N N 131 ILE CG2 HG21 sing N N 132 ILE CG2 HG22 sing N N 133 ILE CG2 HG23 sing N N 134 ILE CD1 HD11 sing N N 135 ILE CD1 HD12 sing N N 136 ILE CD1 HD13 sing N N 137 ILE OXT HXT sing N N 138 LEU N CA sing N N 139 LEU N H sing N N 140 LEU N H2 sing N N 141 LEU CA C sing N N 142 LEU CA CB sing N N 143 LEU CA HA sing N N 144 LEU C O doub N N 145 LEU C OXT sing N N 146 LEU CB CG sing N N 147 LEU CB HB2 sing N N 148 LEU CB HB3 sing N N 149 LEU CG CD1 sing N N 150 LEU CG CD2 sing N N 151 LEU CG HG sing N N 152 LEU CD1 HD11 sing N N 153 LEU CD1 HD12 sing N N 154 LEU CD1 HD13 sing N N 155 LEU CD2 HD21 sing N N 156 LEU CD2 HD22 sing N N 157 LEU CD2 HD23 sing N N 158 LEU OXT HXT sing N N 159 LYS N CA sing N N 160 LYS N H sing N N 161 LYS N H2 sing N N 162 LYS CA C sing N N 163 LYS CA CB sing N N 164 LYS CA HA sing N N 165 LYS C O doub N N 166 LYS C OXT sing N N 167 LYS CB CG sing N N 168 LYS CB HB2 sing N N 169 LYS CB HB3 sing N N 170 LYS CG CD sing N N 171 LYS CG HG2 sing N N 172 LYS CG HG3 sing N N 173 LYS CD CE sing N N 174 LYS CD HD2 sing N N 175 LYS CD HD3 sing N N 176 LYS CE NZ sing N N 177 LYS CE HE2 sing N N 178 LYS CE HE3 sing N N 179 LYS NZ HZ1 sing N N 180 LYS NZ HZ2 sing N N 181 LYS NZ HZ3 sing N N 182 LYS OXT HXT sing N N 183 MET N CA sing N N 184 MET N H sing N N 185 MET N H2 sing N N 186 MET CA C sing N N 187 MET CA CB sing N N 188 MET CA HA sing N N 189 MET C O doub N N 190 MET C OXT sing N N 191 MET CB CG sing N N 192 MET CB HB2 sing N N 193 MET CB HB3 sing N N 194 MET CG SD sing N N 195 MET CG HG2 sing N N 196 MET CG HG3 sing N N 197 MET SD CE sing N N 198 MET CE HE1 sing N N 199 MET CE HE2 sing N N 200 MET CE HE3 sing N N 201 MET OXT HXT sing N N 202 PHE N CA sing N N 203 PHE N H sing N N 204 PHE N H2 sing N N 205 PHE CA C sing N N 206 PHE CA CB sing N N 207 PHE CA HA sing N N 208 PHE C O doub N N 209 PHE C OXT sing N N 210 PHE CB CG sing N N 211 PHE CB HB2 sing N N 212 PHE CB HB3 sing N N 213 PHE CG CD1 doub Y N 214 PHE CG CD2 sing Y N 215 PHE CD1 CE1 sing Y N 216 PHE CD1 HD1 sing N N 217 PHE CD2 CE2 doub Y N 218 PHE CD2 HD2 sing N N 219 PHE CE1 CZ doub Y N 220 PHE CE1 HE1 sing N N 221 PHE CE2 CZ sing Y N 222 PHE CE2 HE2 sing N N 223 PHE CZ HZ sing N N 224 PHE OXT HXT sing N N 225 SER N CA sing N N 226 SER N H sing N N 227 SER N H2 sing N N 228 SER CA C sing N N 229 SER CA CB sing N N 230 SER CA HA sing N N 231 SER C O doub N N 232 SER C OXT sing N N 233 SER CB OG sing N N 234 SER CB HB2 sing N N 235 SER CB HB3 sing N N 236 SER OG HG sing N N 237 SER OXT HXT sing N N 238 THR N CA sing N N 239 THR N H sing N N 240 THR N H2 sing N N 241 THR CA C sing N N 242 THR CA CB sing N N 243 THR CA HA sing N N 244 THR C O doub N N 245 THR C OXT sing N N 246 THR CB OG1 sing N N 247 THR CB CG2 sing N N 248 THR CB HB sing N N 249 THR OG1 HG1 sing N N 250 THR CG2 HG21 sing N N 251 THR CG2 HG22 sing N N 252 THR CG2 HG23 sing N N 253 THR OXT HXT sing N N 254 VAL N CA sing N N 255 VAL N H sing N N 256 VAL N H2 sing N N 257 VAL CA C sing N N 258 VAL CA CB sing N N 259 VAL CA HA sing N N 260 VAL C O doub N N 261 VAL C OXT sing N N 262 VAL CB CG1 sing N N 263 VAL CB CG2 sing N N 264 VAL CB HB sing N N 265 VAL CG1 HG11 sing N N 266 VAL CG1 HG12 sing N N 267 VAL CG1 HG13 sing N N 268 VAL CG2 HG21 sing N N 269 VAL CG2 HG22 sing N N 270 VAL CG2 HG23 sing N N 271 VAL OXT HXT sing N N 272 # _atom_sites.entry_id 6N6S _atom_sites.fract_transf_matrix[1][1] 0.019497 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000506 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015437 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009581 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_