data_6N8B # _entry.id 6N8B # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6N8B pdb_00006n8b 10.2210/pdb6n8b/pdb WWPDB D_1000238341 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-07-15 2 'Structure model' 1 1 2021-01-27 3 'Structure model' 1 2 2024-03-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_database_2.pdbx_DOI' 13 3 'Structure model' '_database_2.pdbx_database_accession' 14 3 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 15 3 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 16 3 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 17 3 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 18 3 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 19 3 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 20 3 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 21 3 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6N8B _pdbx_database_status.recvd_initial_deposition_date 2018-11-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 6N8A _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Luo, Z.' 1 ? 'Hancock, S.J.' 2 ? 'Schembri, M.A.' 3 ? 'Kobe, B.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Microbiol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2058-5276 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 5 _citation.language ? _citation.page_first 1340 _citation.page_last 1348 _citation.title 'Comprehensive analysis of IncC plasmid conjugation identifies a crucial role for the transcriptional regulator AcaB.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41564-020-0775-0 _citation.pdbx_database_id_PubMed 32807890 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hancock, S.J.' 1 0000-0001-7203-2640 primary 'Phan, M.D.' 2 0000-0002-3426-1044 primary 'Luo, Z.' 3 ? primary 'Lo, A.W.' 4 ? primary 'Peters, K.M.' 5 ? primary 'Nhu, N.T.K.' 6 0000-0002-0158-850X primary 'Forde, B.M.' 7 0000-0002-2264-4785 primary 'Whitfield, J.' 8 ? primary 'Yang, J.' 9 ? primary 'Strugnell, R.A.' 10 0000-0003-0614-5641 primary 'Paterson, D.L.' 11 ? primary 'Walsh, T.R.' 12 0000-0003-4315-4096 primary 'Kobe, B.' 13 0000-0001-9413-9166 primary 'Beatson, S.A.' 14 0000-0002-1806-3283 primary 'Schembri, M.A.' 15 0000-0003-4863-9260 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'transcription regulator AcaB' 23954.041 2 ? ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 3 water nat water 18.015 10 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAEAQVALDTNNDRSNHYSRPVFKQVLKVNSLQAQRVMERSFERVSNSLFSIDVILRIIGEQDEIDQVETVILEHISKVS EDLDKATAQLNKLMEDNGIDMMPGYTNPNEYTIEINSPQVAQFAHLIRKLDTLMGIVDTLWLNTVLTSKQRTDATYQWQQ RLIKLAGRIIGIEKRARISAHSKGKEGEVAEAAPESATGDKEIADEAEKTKAA ; _entity_poly.pdbx_seq_one_letter_code_can ;MAEAQVALDTNNDRSNHYSRPVFKQVLKVNSLQAQRVMERSFERVSNSLFSIDVILRIIGEQDEIDQVETVILEHISKVS EDLDKATAQLNKLMEDNGIDMMPGYTNPNEYTIEINSPQVAQFAHLIRKLDTLMGIVDTLWLNTVLTSKQRTDATYQWQQ RLIKLAGRIIGIEKRARISAHSKGKEGEVAEAAPESATGDKEIADEAEKTKAA ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 GLU n 1 4 ALA n 1 5 GLN n 1 6 VAL n 1 7 ALA n 1 8 LEU n 1 9 ASP n 1 10 THR n 1 11 ASN n 1 12 ASN n 1 13 ASP n 1 14 ARG n 1 15 SER n 1 16 ASN n 1 17 HIS n 1 18 TYR n 1 19 SER n 1 20 ARG n 1 21 PRO n 1 22 VAL n 1 23 PHE n 1 24 LYS n 1 25 GLN n 1 26 VAL n 1 27 LEU n 1 28 LYS n 1 29 VAL n 1 30 ASN n 1 31 SER n 1 32 LEU n 1 33 GLN n 1 34 ALA n 1 35 GLN n 1 36 ARG n 1 37 VAL n 1 38 MET n 1 39 GLU n 1 40 ARG n 1 41 SER n 1 42 PHE n 1 43 GLU n 1 44 ARG n 1 45 VAL n 1 46 SER n 1 47 ASN n 1 48 SER n 1 49 LEU n 1 50 PHE n 1 51 SER n 1 52 ILE n 1 53 ASP n 1 54 VAL n 1 55 ILE n 1 56 LEU n 1 57 ARG n 1 58 ILE n 1 59 ILE n 1 60 GLY n 1 61 GLU n 1 62 GLN n 1 63 ASP n 1 64 GLU n 1 65 ILE n 1 66 ASP n 1 67 GLN n 1 68 VAL n 1 69 GLU n 1 70 THR n 1 71 VAL n 1 72 ILE n 1 73 LEU n 1 74 GLU n 1 75 HIS n 1 76 ILE n 1 77 SER n 1 78 LYS n 1 79 VAL n 1 80 SER n 1 81 GLU n 1 82 ASP n 1 83 LEU n 1 84 ASP n 1 85 LYS n 1 86 ALA n 1 87 THR n 1 88 ALA n 1 89 GLN n 1 90 LEU n 1 91 ASN n 1 92 LYS n 1 93 LEU n 1 94 MET n 1 95 GLU n 1 96 ASP n 1 97 ASN n 1 98 GLY n 1 99 ILE n 1 100 ASP n 1 101 MET n 1 102 MET n 1 103 PRO n 1 104 GLY n 1 105 TYR n 1 106 THR n 1 107 ASN n 1 108 PRO n 1 109 ASN n 1 110 GLU n 1 111 TYR n 1 112 THR n 1 113 ILE n 1 114 GLU n 1 115 ILE n 1 116 ASN n 1 117 SER n 1 118 PRO n 1 119 GLN n 1 120 VAL n 1 121 ALA n 1 122 GLN n 1 123 PHE n 1 124 ALA n 1 125 HIS n 1 126 LEU n 1 127 ILE n 1 128 ARG n 1 129 LYS n 1 130 LEU n 1 131 ASP n 1 132 THR n 1 133 LEU n 1 134 MET n 1 135 GLY n 1 136 ILE n 1 137 VAL n 1 138 ASP n 1 139 THR n 1 140 LEU n 1 141 TRP n 1 142 LEU n 1 143 ASN n 1 144 THR n 1 145 VAL n 1 146 LEU n 1 147 THR n 1 148 SER n 1 149 LYS n 1 150 GLN n 1 151 ARG n 1 152 THR n 1 153 ASP n 1 154 ALA n 1 155 THR n 1 156 TYR n 1 157 GLN n 1 158 TRP n 1 159 GLN n 1 160 GLN n 1 161 ARG n 1 162 LEU n 1 163 ILE n 1 164 LYS n 1 165 LEU n 1 166 ALA n 1 167 GLY n 1 168 ARG n 1 169 ILE n 1 170 ILE n 1 171 GLY n 1 172 ILE n 1 173 GLU n 1 174 LYS n 1 175 ARG n 1 176 ALA n 1 177 ARG n 1 178 ILE n 1 179 SER n 1 180 ALA n 1 181 HIS n 1 182 SER n 1 183 LYS n 1 184 GLY n 1 185 LYS n 1 186 GLU n 1 187 GLY n 1 188 GLU n 1 189 VAL n 1 190 ALA n 1 191 GLU n 1 192 ALA n 1 193 ALA n 1 194 PRO n 1 195 GLU n 1 196 SER n 1 197 ALA n 1 198 THR n 1 199 GLY n 1 200 ASP n 1 201 LYS n 1 202 GLU n 1 203 ILE n 1 204 ALA n 1 205 ASP n 1 206 GLU n 1 207 ALA n 1 208 GLU n 1 209 LYS n 1 210 THR n 1 211 LYS n 1 212 ALA n 1 213 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 213 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 GLU 3 3 ? ? ? A . n A 1 4 ALA 4 4 ? ? ? A . n A 1 5 GLN 5 5 ? ? ? A . n A 1 6 VAL 6 6 ? ? ? A . n A 1 7 ALA 7 7 ? ? ? A . n A 1 8 LEU 8 8 ? ? ? A . n A 1 9 ASP 9 9 ? ? ? A . n A 1 10 THR 10 10 ? ? ? A . n A 1 11 ASN 11 11 ? ? ? A . n A 1 12 ASN 12 12 ? ? ? A . n A 1 13 ASP 13 13 ? ? ? A . n A 1 14 ARG 14 14 ? ? ? A . n A 1 15 SER 15 15 ? ? ? A . n A 1 16 ASN 16 16 ? ? ? A . n A 1 17 HIS 17 17 ? ? ? A . n A 1 18 TYR 18 18 ? ? ? A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 MET 38 38 38 MET MET A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 HIS 75 75 75 HIS HIS A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 MET 94 94 94 MET MET A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 MET 101 101 101 MET MET A . n A 1 102 MET 102 102 102 MET MET A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 TYR 105 105 105 TYR TYR A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 TYR 111 111 111 TYR TYR A . n A 1 112 THR 112 112 112 THR THR A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 ILE 115 115 115 ILE ILE A . n A 1 116 ASN 116 116 116 ASN ASN A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 GLN 119 119 119 GLN GLN A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 PHE 123 123 123 PHE PHE A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 HIS 125 125 125 HIS HIS A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 ARG 128 128 128 ARG ARG A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 MET 134 134 134 MET MET A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 ASP 138 138 138 ASP ASP A . n A 1 139 THR 139 139 139 THR THR A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 TRP 141 141 141 TRP TRP A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 ASN 143 143 143 ASN ASN A . n A 1 144 THR 144 144 144 THR THR A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 SER 148 148 148 SER SER A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 GLN 150 150 150 GLN GLN A . n A 1 151 ARG 151 151 151 ARG ARG A . n A 1 152 THR 152 152 152 THR THR A . n A 1 153 ASP 153 153 153 ASP ASP A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 TYR 156 156 156 TYR TYR A . n A 1 157 GLN 157 157 157 GLN GLN A . n A 1 158 TRP 158 158 158 TRP TRP A . n A 1 159 GLN 159 159 159 GLN GLN A . n A 1 160 GLN 160 160 160 GLN GLN A . n A 1 161 ARG 161 161 161 ARG ARG A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 ILE 163 163 163 ILE ILE A . n A 1 164 LYS 164 164 164 LYS LYS A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 GLY 167 167 167 GLY GLY A . n A 1 168 ARG 168 168 168 ARG ARG A . n A 1 169 ILE 169 169 169 ILE ILE A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 ILE 172 172 172 ILE ILE A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 LYS 174 174 174 LYS LYS A . n A 1 175 ARG 175 175 175 ARG ARG A . n A 1 176 ALA 176 176 176 ALA ALA A . n A 1 177 ARG 177 177 177 ARG ARG A . n A 1 178 ILE 178 178 178 ILE ILE A . n A 1 179 SER 179 179 179 SER SER A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 HIS 181 181 181 HIS HIS A . n A 1 182 SER 182 182 182 SER SER A . n A 1 183 LYS 183 183 183 LYS LYS A . n A 1 184 GLY 184 184 184 GLY GLY A . n A 1 185 LYS 185 185 185 LYS LYS A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 GLY 187 187 187 GLY GLY A . n A 1 188 GLU 188 188 188 GLU GLU A . n A 1 189 VAL 189 189 189 VAL VAL A . n A 1 190 ALA 190 190 190 ALA ALA A . n A 1 191 GLU 191 191 191 GLU GLU A . n A 1 192 ALA 192 192 192 ALA ALA A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 PRO 194 194 194 PRO PRO A . n A 1 195 GLU 195 195 195 GLU GLU A . n A 1 196 SER 196 196 196 SER SER A . n A 1 197 ALA 197 197 197 ALA ALA A . n A 1 198 THR 198 198 198 THR THR A . n A 1 199 GLY 199 199 199 GLY GLY A . n A 1 200 ASP 200 200 200 ASP ASP A . n A 1 201 LYS 201 201 201 LYS LYS A . n A 1 202 GLU 202 202 202 GLU GLU A . n A 1 203 ILE 203 203 203 ILE ILE A . n A 1 204 ALA 204 204 204 ALA ALA A . n A 1 205 ASP 205 205 205 ASP ASP A . n A 1 206 GLU 206 206 206 GLU GLU A . n A 1 207 ALA 207 207 207 ALA ALA A . n A 1 208 GLU 208 208 208 GLU GLU A . n A 1 209 LYS 209 209 209 LYS LYS A . n A 1 210 THR 210 210 210 THR THR A . n A 1 211 LYS 211 211 211 LYS LYS A . n A 1 212 ALA 212 212 212 ALA ALA A . n A 1 213 ALA 213 213 ? ? ? A . n B 1 1 MET 1 1 ? ? ? B . n B 1 2 ALA 2 2 ? ? ? B . n B 1 3 GLU 3 3 ? ? ? B . n B 1 4 ALA 4 4 ? ? ? B . n B 1 5 GLN 5 5 ? ? ? B . n B 1 6 VAL 6 6 ? ? ? B . n B 1 7 ALA 7 7 ? ? ? B . n B 1 8 LEU 8 8 ? ? ? B . n B 1 9 ASP 9 9 ? ? ? B . n B 1 10 THR 10 10 ? ? ? B . n B 1 11 ASN 11 11 ? ? ? B . n B 1 12 ASN 12 12 ? ? ? B . n B 1 13 ASP 13 13 ? ? ? B . n B 1 14 ARG 14 14 ? ? ? B . n B 1 15 SER 15 15 ? ? ? B . n B 1 16 ASN 16 16 ? ? ? B . n B 1 17 HIS 17 17 ? ? ? B . n B 1 18 TYR 18 18 ? ? ? B . n B 1 19 SER 19 19 19 SER SER B . n B 1 20 ARG 20 20 20 ARG ARG B . n B 1 21 PRO 21 21 21 PRO PRO B . n B 1 22 VAL 22 22 22 VAL VAL B . n B 1 23 PHE 23 23 23 PHE PHE B . n B 1 24 LYS 24 24 24 LYS LYS B . n B 1 25 GLN 25 25 25 GLN GLN B . n B 1 26 VAL 26 26 26 VAL VAL B . n B 1 27 LEU 27 27 27 LEU LEU B . n B 1 28 LYS 28 28 28 LYS LYS B . n B 1 29 VAL 29 29 29 VAL VAL B . n B 1 30 ASN 30 30 30 ASN ASN B . n B 1 31 SER 31 31 31 SER SER B . n B 1 32 LEU 32 32 32 LEU LEU B . n B 1 33 GLN 33 33 33 GLN GLN B . n B 1 34 ALA 34 34 34 ALA ALA B . n B 1 35 GLN 35 35 35 GLN GLN B . n B 1 36 ARG 36 36 36 ARG ARG B . n B 1 37 VAL 37 37 37 VAL VAL B . n B 1 38 MET 38 38 38 MET MET B . n B 1 39 GLU 39 39 39 GLU GLU B . n B 1 40 ARG 40 40 40 ARG ARG B . n B 1 41 SER 41 41 41 SER SER B . n B 1 42 PHE 42 42 42 PHE PHE B . n B 1 43 GLU 43 43 43 GLU GLU B . n B 1 44 ARG 44 44 44 ARG ARG B . n B 1 45 VAL 45 45 45 VAL VAL B . n B 1 46 SER 46 46 46 SER SER B . n B 1 47 ASN 47 47 47 ASN ASN B . n B 1 48 SER 48 48 48 SER SER B . n B 1 49 LEU 49 49 49 LEU LEU B . n B 1 50 PHE 50 50 50 PHE PHE B . n B 1 51 SER 51 51 51 SER SER B . n B 1 52 ILE 52 52 52 ILE ILE B . n B 1 53 ASP 53 53 53 ASP ASP B . n B 1 54 VAL 54 54 54 VAL VAL B . n B 1 55 ILE 55 55 55 ILE ILE B . n B 1 56 LEU 56 56 56 LEU LEU B . n B 1 57 ARG 57 57 57 ARG ARG B . n B 1 58 ILE 58 58 58 ILE ILE B . n B 1 59 ILE 59 59 59 ILE ILE B . n B 1 60 GLY 60 60 60 GLY GLY B . n B 1 61 GLU 61 61 61 GLU GLU B . n B 1 62 GLN 62 62 62 GLN GLN B . n B 1 63 ASP 63 63 63 ASP ASP B . n B 1 64 GLU 64 64 64 GLU GLU B . n B 1 65 ILE 65 65 65 ILE ILE B . n B 1 66 ASP 66 66 66 ASP ASP B . n B 1 67 GLN 67 67 67 GLN GLN B . n B 1 68 VAL 68 68 68 VAL VAL B . n B 1 69 GLU 69 69 69 GLU GLU B . n B 1 70 THR 70 70 70 THR THR B . n B 1 71 VAL 71 71 71 VAL VAL B . n B 1 72 ILE 72 72 72 ILE ILE B . n B 1 73 LEU 73 73 73 LEU LEU B . n B 1 74 GLU 74 74 74 GLU GLU B . n B 1 75 HIS 75 75 75 HIS HIS B . n B 1 76 ILE 76 76 76 ILE ILE B . n B 1 77 SER 77 77 77 SER SER B . n B 1 78 LYS 78 78 78 LYS LYS B . n B 1 79 VAL 79 79 79 VAL VAL B . n B 1 80 SER 80 80 80 SER SER B . n B 1 81 GLU 81 81 81 GLU GLU B . n B 1 82 ASP 82 82 82 ASP ASP B . n B 1 83 LEU 83 83 83 LEU LEU B . n B 1 84 ASP 84 84 84 ASP ASP B . n B 1 85 LYS 85 85 85 LYS LYS B . n B 1 86 ALA 86 86 86 ALA ALA B . n B 1 87 THR 87 87 87 THR THR B . n B 1 88 ALA 88 88 88 ALA ALA B . n B 1 89 GLN 89 89 89 GLN GLN B . n B 1 90 LEU 90 90 90 LEU LEU B . n B 1 91 ASN 91 91 91 ASN ASN B . n B 1 92 LYS 92 92 92 LYS LYS B . n B 1 93 LEU 93 93 93 LEU LEU B . n B 1 94 MET 94 94 94 MET MET B . n B 1 95 GLU 95 95 95 GLU GLU B . n B 1 96 ASP 96 96 96 ASP ASP B . n B 1 97 ASN 97 97 97 ASN ASN B . n B 1 98 GLY 98 98 98 GLY GLY B . n B 1 99 ILE 99 99 99 ILE ILE B . n B 1 100 ASP 100 100 100 ASP ASP B . n B 1 101 MET 101 101 101 MET MET B . n B 1 102 MET 102 102 102 MET MET B . n B 1 103 PRO 103 103 103 PRO PRO B . n B 1 104 GLY 104 104 104 GLY GLY B . n B 1 105 TYR 105 105 105 TYR TYR B . n B 1 106 THR 106 106 106 THR THR B . n B 1 107 ASN 107 107 107 ASN ASN B . n B 1 108 PRO 108 108 108 PRO PRO B . n B 1 109 ASN 109 109 109 ASN ASN B . n B 1 110 GLU 110 110 110 GLU GLU B . n B 1 111 TYR 111 111 111 TYR TYR B . n B 1 112 THR 112 112 112 THR THR B . n B 1 113 ILE 113 113 113 ILE ILE B . n B 1 114 GLU 114 114 114 GLU GLU B . n B 1 115 ILE 115 115 115 ILE ILE B . n B 1 116 ASN 116 116 116 ASN ASN B . n B 1 117 SER 117 117 117 SER SER B . n B 1 118 PRO 118 118 118 PRO PRO B . n B 1 119 GLN 119 119 119 GLN GLN B . n B 1 120 VAL 120 120 120 VAL VAL B . n B 1 121 ALA 121 121 121 ALA ALA B . n B 1 122 GLN 122 122 122 GLN GLN B . n B 1 123 PHE 123 123 123 PHE PHE B . n B 1 124 ALA 124 124 124 ALA ALA B . n B 1 125 HIS 125 125 125 HIS HIS B . n B 1 126 LEU 126 126 126 LEU LEU B . n B 1 127 ILE 127 127 127 ILE ILE B . n B 1 128 ARG 128 128 128 ARG ARG B . n B 1 129 LYS 129 129 129 LYS LYS B . n B 1 130 LEU 130 130 130 LEU LEU B . n B 1 131 ASP 131 131 131 ASP ASP B . n B 1 132 THR 132 132 132 THR THR B . n B 1 133 LEU 133 133 133 LEU LEU B . n B 1 134 MET 134 134 134 MET MET B . n B 1 135 GLY 135 135 135 GLY GLY B . n B 1 136 ILE 136 136 136 ILE ILE B . n B 1 137 VAL 137 137 137 VAL VAL B . n B 1 138 ASP 138 138 138 ASP ASP B . n B 1 139 THR 139 139 139 THR THR B . n B 1 140 LEU 140 140 140 LEU LEU B . n B 1 141 TRP 141 141 141 TRP TRP B . n B 1 142 LEU 142 142 142 LEU LEU B . n B 1 143 ASN 143 143 143 ASN ASN B . n B 1 144 THR 144 144 144 THR THR B . n B 1 145 VAL 145 145 145 VAL VAL B . n B 1 146 LEU 146 146 146 LEU LEU B . n B 1 147 THR 147 147 147 THR THR B . n B 1 148 SER 148 148 148 SER SER B . n B 1 149 LYS 149 149 149 LYS LYS B . n B 1 150 GLN 150 150 150 GLN GLN B . n B 1 151 ARG 151 151 151 ARG ARG B . n B 1 152 THR 152 152 152 THR THR B . n B 1 153 ASP 153 153 153 ASP ASP B . n B 1 154 ALA 154 154 154 ALA ALA B . n B 1 155 THR 155 155 155 THR THR B . n B 1 156 TYR 156 156 156 TYR TYR B . n B 1 157 GLN 157 157 157 GLN GLN B . n B 1 158 TRP 158 158 158 TRP TRP B . n B 1 159 GLN 159 159 159 GLN GLN B . n B 1 160 GLN 160 160 160 GLN GLN B . n B 1 161 ARG 161 161 161 ARG ARG B . n B 1 162 LEU 162 162 162 LEU LEU B . n B 1 163 ILE 163 163 163 ILE ILE B . n B 1 164 LYS 164 164 164 LYS LYS B . n B 1 165 LEU 165 165 165 LEU LEU B . n B 1 166 ALA 166 166 166 ALA ALA B . n B 1 167 GLY 167 167 167 GLY GLY B . n B 1 168 ARG 168 168 168 ARG ARG B . n B 1 169 ILE 169 169 169 ILE ILE B . n B 1 170 ILE 170 170 170 ILE ILE B . n B 1 171 GLY 171 171 171 GLY GLY B . n B 1 172 ILE 172 172 172 ILE ILE B . n B 1 173 GLU 173 173 173 GLU GLU B . n B 1 174 LYS 174 174 174 LYS LYS B . n B 1 175 ARG 175 175 175 ARG ARG B . n B 1 176 ALA 176 176 176 ALA ALA B . n B 1 177 ARG 177 177 177 ARG ARG B . n B 1 178 ILE 178 178 178 ILE ILE B . n B 1 179 SER 179 179 179 SER SER B . n B 1 180 ALA 180 180 180 ALA ALA B . n B 1 181 HIS 181 181 181 HIS HIS B . n B 1 182 SER 182 182 182 SER SER B . n B 1 183 LYS 183 183 183 LYS LYS B . n B 1 184 GLY 184 184 184 GLY GLY B . n B 1 185 LYS 185 185 185 LYS LYS B . n B 1 186 GLU 186 186 186 GLU GLU B . n B 1 187 GLY 187 187 187 GLY GLY B . n B 1 188 GLU 188 188 188 GLU GLU B . n B 1 189 VAL 189 189 189 VAL VAL B . n B 1 190 ALA 190 190 190 ALA ALA B . n B 1 191 GLU 191 191 191 GLU GLU B . n B 1 192 ALA 192 192 192 ALA ALA B . n B 1 193 ALA 193 193 193 ALA ALA B . n B 1 194 PRO 194 194 194 PRO PRO B . n B 1 195 GLU 195 195 195 GLU GLU B . n B 1 196 SER 196 196 196 SER SER B . n B 1 197 ALA 197 197 197 ALA ALA B . n B 1 198 THR 198 198 198 THR THR B . n B 1 199 GLY 199 199 199 GLY GLY B . n B 1 200 ASP 200 200 200 ASP ASP B . n B 1 201 LYS 201 201 201 LYS LYS B . n B 1 202 GLU 202 202 202 GLU GLU B . n B 1 203 ILE 203 203 203 ILE ILE B . n B 1 204 ALA 204 204 204 ALA ALA B . n B 1 205 ASP 205 205 205 ASP ASP B . n B 1 206 GLU 206 206 206 GLU GLU B . n B 1 207 ALA 207 207 207 ALA ALA B . n B 1 208 GLU 208 208 208 GLU GLU B . n B 1 209 LYS 209 209 209 LYS LYS B . n B 1 210 THR 210 210 210 THR THR B . n B 1 211 LYS 211 211 211 LYS LYS B . n B 1 212 ALA 212 212 212 ALA ALA B . n B 1 213 ALA 213 213 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 CA 1 301 1 CA CA A . D 3 HOH 1 401 1 HOH HOH A . D 3 HOH 2 402 6 HOH HOH A . D 3 HOH 3 403 5 HOH HOH A . D 3 HOH 4 404 4 HOH HOH A . D 3 HOH 5 405 9 HOH HOH A . D 3 HOH 6 406 8 HOH HOH A . D 3 HOH 7 407 10 HOH HOH A . D 3 HOH 8 408 11 HOH HOH A . D 3 HOH 9 409 7 HOH HOH A . E 3 HOH 1 301 2 HOH HOH B . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10.1_2155 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6N8B _cell.details ? _cell.formula_units_Z ? _cell.length_a 167.188 _cell.length_a_esd ? _cell.length_b 167.188 _cell.length_b_esd ? _cell.length_c 167.188 _cell.length_c_esd ? _cell.volume 4673210.110 _cell.volume_esd ? _cell.Z_PDB 48 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6N8B _symmetry.cell_setting ? _symmetry.Int_Tables_number 199 _symmetry.space_group_name_Hall 'I 2b 2c 3' _symmetry.space_group_name_H-M 'I 21 3' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6N8B _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.06 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 69.74 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Tris, pH 8.0, 23% (w/v) PEG 350 monomethyl ether, in the presence of alpha-chymotrypsin' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-07-09 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.954 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.954 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX2 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate 57.2293254425 _reflns.entry_id 6N8B _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.94 _reflns.d_resolution_low 44.68 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 16642 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 22.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 19.33 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.94 _reflns_shell.d_res_low 3.05 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 56.992440657 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6N8B _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.94 _refine.ls_d_res_low 44.68 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16602 _refine.ls_number_reflns_R_free 917 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.5323741007 _refine.ls_percent_reflns_R_free 5.52343091194 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.229569350883 _refine.ls_R_factor_R_free 0.257851722805 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.227957000307 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34606795746 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 25.1849787301 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.354139512882 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 3062 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 10 _refine_hist.number_atoms_total 3073 _refine_hist.d_res_high 2.94 _refine_hist.d_res_low 44.68 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.00498777862695 ? 3098 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.884413269662 ? 4178 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0514417647727 ? 488 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.00468815481027 ? 542 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 17.976282859 ? 1934 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.9408 3.0958 . . 145 2129 96.7247979583 . . . 0.338327523432 . 0.311331675103 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0958 3.2897 . . 107 2251 100.0 . . . 0.294633391413 . 0.301393162239 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2897 3.5437 . . 157 2211 100.0 . . . 0.285194612672 . 0.268188686667 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5437 3.9001 . . 143 2222 100.0 . . . 0.280001691069 . 0.236958746488 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.9001 4.464 . . 128 2241 100.0 . . . 0.242157833003 . 0.200833344545 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.464 5.6224 . . 110 2286 100.0 . . . 0.215783728102 . 0.210555325558 . . . . . . . . . . 'X-RAY DIFFRACTION' 5.6224 44.688 . . 127 2345 99.9595632835 . . . 0.230325141174 . 0.191820694802 . . . . . . . . . . # loop_ _struct_ncs_dom.id _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.details 1 1 ? 2 1 ? # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A SER 19 . A GLN 35 . A SER 19 A GLN 35 ? ;(chain A and (resseq 19:22 or (resid 23 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 24:35 or resseq 37:56 or resseq 58:62 or (resid 63 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 64:65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 67:68 or resseq 70:81 or (resid 82 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 83:100 or resseq 102:127 or resseq 129:152 or (resid 153 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 154:167 or resseq 169:199 or (resid 200 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 201:212)) ; 1 1 2 A VAL 37 . A LEU 56 . A VAL 37 A LEU 56 ? ;(chain A and (resseq 19:22 or (resid 23 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 24:35 or resseq 37:56 or resseq 58:62 or (resid 63 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 64:65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 67:68 or resseq 70:81 or (resid 82 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 83:100 or resseq 102:127 or resseq 129:152 or (resid 153 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 154:167 or resseq 169:199 or (resid 200 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 201:212)) ; 1 1 3 A ILE 58 . A VAL 68 . A ILE 58 A VAL 68 ? ;(chain A and (resseq 19:22 or (resid 23 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 24:35 or resseq 37:56 or resseq 58:62 or (resid 63 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 64:65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 67:68 or resseq 70:81 or (resid 82 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 83:100 or resseq 102:127 or resseq 129:152 or (resid 153 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 154:167 or resseq 169:199 or (resid 200 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 201:212)) ; 1 1 4 A THR 70 . A ASP 100 . A THR 70 A ASP 100 ? ;(chain A and (resseq 19:22 or (resid 23 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 24:35 or resseq 37:56 or resseq 58:62 or (resid 63 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 64:65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 67:68 or resseq 70:81 or (resid 82 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 83:100 or resseq 102:127 or resseq 129:152 or (resid 153 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 154:167 or resseq 169:199 or (resid 200 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 201:212)) ; 1 1 5 A MET 102 . A ILE 127 . A MET 102 A ILE 127 ? ;(chain A and (resseq 19:22 or (resid 23 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 24:35 or resseq 37:56 or resseq 58:62 or (resid 63 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 64:65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 67:68 or resseq 70:81 or (resid 82 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 83:100 or resseq 102:127 or resseq 129:152 or (resid 153 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 154:167 or resseq 169:199 or (resid 200 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 201:212)) ; 1 1 6 A LYS 129 . A ALA 166 . A LYS 129 A ALA 166 ? ;(chain A and (resseq 19:22 or (resid 23 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 24:35 or resseq 37:56 or resseq 58:62 or (resid 63 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 64:65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 67:68 or resseq 70:81 or (resid 82 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 83:100 or resseq 102:127 or resseq 129:152 or (resid 153 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 154:167 or resseq 169:199 or (resid 200 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 201:212)) ; 1 1 7 A ILE 169 . A LYS 211 . A ILE 169 A LYS 211 ? ;(chain A and (resseq 19:22 or (resid 23 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 24:35 or resseq 37:56 or resseq 58:62 or (resid 63 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 64:65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 67:68 or resseq 70:81 or (resid 82 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 83:100 or resseq 102:127 or resseq 129:152 or (resid 153 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 154:167 or resseq 169:199 or (resid 200 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 201:212)) ; 1 2 1 B SER 19 . B GLN 35 . B SER 19 B GLN 35 ? ;(chain B and (resseq 19:22 or (resid 23 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 24:35 or resseq 37:56 or resseq 58:62 or (resid 63 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 64:65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 67:68 or resseq 70:81 or (resid 82 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 83:100 or resseq 102:127 or resseq 129:152 or (resid 153 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 154:167 or resseq 169:199 or (resid 200 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 201:212)) ; 1 2 2 B VAL 37 . B LEU 56 . B VAL 37 B LEU 56 ? ;(chain B and (resseq 19:22 or (resid 23 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 24:35 or resseq 37:56 or resseq 58:62 or (resid 63 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 64:65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 67:68 or resseq 70:81 or (resid 82 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 83:100 or resseq 102:127 or resseq 129:152 or (resid 153 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 154:167 or resseq 169:199 or (resid 200 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 201:212)) ; 1 2 3 B ILE 58 . B VAL 68 . B ILE 58 B VAL 68 ? ;(chain B and (resseq 19:22 or (resid 23 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 24:35 or resseq 37:56 or resseq 58:62 or (resid 63 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 64:65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 67:68 or resseq 70:81 or (resid 82 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 83:100 or resseq 102:127 or resseq 129:152 or (resid 153 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 154:167 or resseq 169:199 or (resid 200 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 201:212)) ; 1 2 4 B THR 70 . B ASP 100 . B THR 70 B ASP 100 ? ;(chain B and (resseq 19:22 or (resid 23 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 24:35 or resseq 37:56 or resseq 58:62 or (resid 63 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 64:65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 67:68 or resseq 70:81 or (resid 82 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 83:100 or resseq 102:127 or resseq 129:152 or (resid 153 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 154:167 or resseq 169:199 or (resid 200 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 201:212)) ; 1 2 5 B MET 102 . B ILE 127 . B MET 102 B ILE 127 ? ;(chain B and (resseq 19:22 or (resid 23 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 24:35 or resseq 37:56 or resseq 58:62 or (resid 63 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 64:65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 67:68 or resseq 70:81 or (resid 82 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 83:100 or resseq 102:127 or resseq 129:152 or (resid 153 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 154:167 or resseq 169:199 or (resid 200 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 201:212)) ; 1 2 6 B LYS 129 . B ALA 166 . B LYS 129 B ALA 166 ? ;(chain B and (resseq 19:22 or (resid 23 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 24:35 or resseq 37:56 or resseq 58:62 or (resid 63 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 64:65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 67:68 or resseq 70:81 or (resid 82 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 83:100 or resseq 102:127 or resseq 129:152 or (resid 153 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 154:167 or resseq 169:199 or (resid 200 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 201:212)) ; 1 2 7 B ILE 169 . B LYS 211 . B ILE 169 B LYS 211 ? ;(chain B and (resseq 19:22 or (resid 23 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CE1 or name CZ )) or resseq 24:35 or resseq 37:56 or resseq 58:62 or (resid 63 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 64:65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 67:68 or resseq 70:81 or (resid 82 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 83:100 or resseq 102:127 or resseq 129:152 or (resid 153 and (name N or name CA or name C or name O or name CB or name CG or name OD2)) or resseq 154:167 or resseq 169:199 or (resid 200 and (name N or name CA or name C or name O or name CB or name CG or name OD1)) or resseq 201:212)) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 6N8B _struct.title 'Crystal structure of transcription regulator AcaB from uropathogenic E. coli' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6N8B _struct_keywords.text 'uropathogenic E. coli; New-Delhi metallo-beta-lactamase; NDM; A/C plasmid; AcaB; transcription regulation, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C4NVV6_ECOLX _struct_ref.pdbx_db_accession C4NVV6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAEAQVALDTNNDRSNHYSRPVFKQVLKVNSLQAQRVMERSFERVSNSLFSIDVILRIIGEQDEIDQVETVILEHISKVS EDLDKATAQLNKLMEDNGIDMMPGYTNPNEYTIEINSPQVAQFAHLIRKLDTLMGIVDTLWLNTVLTSKQRTDATYQWQQ RLIKLAGRIIGIEKRARISAHSKGKEGEVAEAAPESATGDKEIADEAEKTKAA ; _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6N8B A 1 ? 213 ? C4NVV6 1 ? 213 ? 1 213 2 1 6N8B B 1 ? 213 ? C4NVV6 1 ? 213 ? 1 213 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 author_defined_assembly ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C,D 2 1 B,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 31 ? GLY A 60 ? SER A 31 GLY A 60 1 ? 30 HELX_P HELX_P2 AA2 GLU A 61 ? ASN A 97 ? GLU A 61 ASN A 97 1 ? 37 HELX_P HELX_P3 AA3 SER A 117 ? ASN A 143 ? SER A 117 ASN A 143 1 ? 27 HELX_P HELX_P4 AA4 THR A 147 ? LYS A 183 ? THR A 147 LYS A 183 1 ? 37 HELX_P HELX_P5 AA5 LYS A 185 ? ALA A 193 ? LYS A 185 ALA A 193 1 ? 9 HELX_P HELX_P6 AA6 ASP A 200 ? ALA A 212 ? ASP A 200 ALA A 212 1 ? 13 HELX_P HELX_P7 AA7 SER B 31 ? GLY B 60 ? SER B 31 GLY B 60 1 ? 30 HELX_P HELX_P8 AA8 GLU B 61 ? ASN B 97 ? GLU B 61 ASN B 97 1 ? 37 HELX_P HELX_P9 AA9 SER B 117 ? ASN B 143 ? SER B 117 ASN B 143 1 ? 27 HELX_P HELX_P10 AB1 THR B 147 ? LYS B 183 ? THR B 147 LYS B 183 1 ? 37 HELX_P HELX_P11 AB2 LYS B 185 ? ALA B 193 ? LYS B 185 ALA B 193 1 ? 9 HELX_P HELX_P12 AB3 ASP B 200 ? THR B 210 ? ASP B 200 THR B 210 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 23 ? VAL A 29 ? PHE A 23 VAL A 29 AA1 2 ASN A 109 ? ILE A 115 ? ASN A 109 ILE A 115 AA2 1 PHE B 23 ? VAL B 29 ? PHE B 23 VAL B 29 AA2 2 ASN B 109 ? ILE B 115 ? ASN B 109 ILE B 115 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 29 ? N VAL A 29 O ASN A 109 ? O ASN A 109 AA2 1 2 N VAL B 29 ? N VAL B 29 O ASN B 109 ? O ASN B 109 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CA _struct_site.pdbx_auth_seq_id 301 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'binding site for residue CA A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 GLU A 81 ? GLU A 81 . ? 1_555 ? 2 AC1 2 GLU B 74 ? GLU B 74 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LEU 73 ? ? OG A SER 77 ? ? 2.05 2 1 NH2 A ARG 177 ? ? O A ALA 193 ? ? 2.12 3 1 ND2 A ASN 47 ? ? OG A SER 196 ? ? 2.16 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 OE1 A GLN 62 ? ? 1_555 NZ A LYS 185 ? ? 14_555 2.13 2 1 O A HOH 405 ? ? 1_555 O A HOH 408 ? ? 15_455 2.18 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 N _pdbx_validate_rmsd_angle.auth_asym_id_1 B _pdbx_validate_rmsd_angle.auth_comp_id_1 GLU _pdbx_validate_rmsd_angle.auth_seq_id_1 64 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 B _pdbx_validate_rmsd_angle.auth_comp_id_2 GLU _pdbx_validate_rmsd_angle.auth_seq_id_2 64 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CB _pdbx_validate_rmsd_angle.auth_asym_id_3 B _pdbx_validate_rmsd_angle.auth_comp_id_3 GLU _pdbx_validate_rmsd_angle.auth_seq_id_3 64 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 121.52 _pdbx_validate_rmsd_angle.angle_target_value 110.60 _pdbx_validate_rmsd_angle.angle_deviation 10.92 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.80 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 107 ? ? -156.11 80.99 2 1 ALA A 193 ? ? -157.07 86.43 3 1 ASN B 107 ? ? -154.58 82.11 4 1 ALA B 193 ? ? -156.46 84.06 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.pdbx_refine_id 1 ? refined -20.60462622 29.8550641424 -8.8340321865 0.253647412475 0.342925353886 0.347652876957 0.0394567954147 0.0721385495082 0.0756820391457 8.09743612451 2.63048476149 2.28969595376 2.90644673952 -0.228841684636 -0.507838320377 -0.0451144474699 -0.522360598322 -0.332149967454 0.0358296812682 -0.321854591695 -0.232788079508 0.119282531435 0.37203819289 0.285558493711 'X-RAY DIFFRACTION' 2 ? refined -30.21739482 28.0346550616 -10.8774158505 0.276930244697 0.297374112396 0.289034887856 -0.0170875005441 0.0128408160457 0.0191183421232 8.56285987193 4.9089348405 1.22075320708 3.96816531775 -0.939099648621 -0.603607464034 0.1132241614 -0.109885946527 -0.260737468297 0.11251073727 -0.164893464605 0.148807212722 0.229273525399 -0.0849279592044 0.0636460506169 'X-RAY DIFFRACTION' 3 ? refined -18.9296362289 46.7974623723 -6.08808268035 0.384509431099 0.475877406457 0.588258919105 -0.0391598163638 0.0712813505281 -0.164693281933 5.05644297 2.27456347254 6.3077176211 0.299556696045 0.0662886376176 -0.40981245953 0.0967619367814 -1.0296474235 1.00799462348 0.0875410926211 -0.251601251666 0.474917609774 -0.615280420628 -0.191699917303 0.0566130714307 'X-RAY DIFFRACTION' 4 ? refined -28.5366620164 19.0655514274 24.9114394317 0.418350982604 0.423952037169 0.462133245317 0.0740102704378 0.0749250434185 0.0696349961546 4.23256211833 3.68147901362 2.59441734925 -2.89255518213 1.54966008433 -0.0963645371172 -0.345764495441 -0.159837675846 0.300662589316 0.322953183315 0.509925410872 0.480227861635 -0.64426660271 -0.430816028141 -0.142281258043 'X-RAY DIFFRACTION' 5 ? refined -21.43057996 11.9285936946 11.0870449748 0.344052884461 0.545436258001 0.340317157664 0.0982199171684 0.0191225455203 0.0222512891473 4.1368415132 4.59003275741 4.31390935359 -1.70758854299 1.32074872389 -0.175907927677 0.2928758187 0.453076532374 0.42377562182 -1.4532154991 -0.0174077654275 -0.215915420675 0.196549835814 -0.119801749833 -0.27501251222 'X-RAY DIFFRACTION' 6 ? refined -20.0645081662 8.35878252447 22.5187774553 0.235523880674 0.27599817487 0.141122143278 -0.000472732699276 0.00175965456332 0.0037876920949 3.87889842845 7.90996092795 3.42634867491 -2.3401642682 0.552285337469 -1.22460060483 0.0474922395962 0.025184829448 -0.0410579960399 -0.181369737451 0.0642609382144 0.0558766392456 -0.0292343376225 0.00359887586113 -0.0799914771173 'X-RAY DIFFRACTION' 7 ? refined -19.3001305509 30.4086845073 26.2527882222 0.603377243496 0.340460179705 0.596334833711 -0.113883896239 0.0504319263207 0.0120262051554 4.78614645413 6.91688258158 6.62277512722 -2.64127760293 2.55448814787 -3.79562048079 -0.526708491425 -0.455969417534 0.995927591298 0.588605200509 0.483621495792 -0.143723359011 -0.736911452256 -0.00526720540206 0.0820456998948 'X-RAY DIFFRACTION' # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id 1 1 ? ;chain 'A' and (resid 19 through 96 ) ; 'X-RAY DIFFRACTION' ? ? ? ? ? ? ? ? 2 2 ? ;chain 'A' and (resid 97 through 182 ) ; 'X-RAY DIFFRACTION' ? ? ? ? ? ? ? ? 3 3 ? ;chain 'A' and (resid 183 through 212 ) ; 'X-RAY DIFFRACTION' ? ? ? ? ? ? ? ? 4 4 ? ;chain 'B' and (resid 19 through 61 ) ; 'X-RAY DIFFRACTION' ? ? ? ? ? ? ? ? 5 5 ? ;chain 'B' and (resid 62 through 96 ) ; 'X-RAY DIFFRACTION' ? ? ? ? ? ? ? ? 6 6 ? ;chain 'B' and (resid 97 through 182 ) ; 'X-RAY DIFFRACTION' ? ? ? ? ? ? ? ? 7 7 ? ;chain 'B' and (resid 183 through 212 ) ; 'X-RAY DIFFRACTION' ? ? ? ? ? ? ? ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A GLU 3 ? A GLU 3 4 1 Y 1 A ALA 4 ? A ALA 4 5 1 Y 1 A GLN 5 ? A GLN 5 6 1 Y 1 A VAL 6 ? A VAL 6 7 1 Y 1 A ALA 7 ? A ALA 7 8 1 Y 1 A LEU 8 ? A LEU 8 9 1 Y 1 A ASP 9 ? A ASP 9 10 1 Y 1 A THR 10 ? A THR 10 11 1 Y 1 A ASN 11 ? A ASN 11 12 1 Y 1 A ASN 12 ? A ASN 12 13 1 Y 1 A ASP 13 ? A ASP 13 14 1 Y 1 A ARG 14 ? A ARG 14 15 1 Y 1 A SER 15 ? A SER 15 16 1 Y 1 A ASN 16 ? A ASN 16 17 1 Y 1 A HIS 17 ? A HIS 17 18 1 Y 1 A TYR 18 ? A TYR 18 19 1 Y 1 A ALA 213 ? A ALA 213 20 1 Y 1 B MET 1 ? B MET 1 21 1 Y 1 B ALA 2 ? B ALA 2 22 1 Y 1 B GLU 3 ? B GLU 3 23 1 Y 1 B ALA 4 ? B ALA 4 24 1 Y 1 B GLN 5 ? B GLN 5 25 1 Y 1 B VAL 6 ? B VAL 6 26 1 Y 1 B ALA 7 ? B ALA 7 27 1 Y 1 B LEU 8 ? B LEU 8 28 1 Y 1 B ASP 9 ? B ASP 9 29 1 Y 1 B THR 10 ? B THR 10 30 1 Y 1 B ASN 11 ? B ASN 11 31 1 Y 1 B ASN 12 ? B ASN 12 32 1 Y 1 B ASP 13 ? B ASP 13 33 1 Y 1 B ARG 14 ? B ARG 14 34 1 Y 1 B SER 15 ? B SER 15 35 1 Y 1 B ASN 16 ? B ASN 16 36 1 Y 1 B HIS 17 ? B HIS 17 37 1 Y 1 B TYR 18 ? B TYR 18 38 1 Y 1 B ALA 213 ? B ALA 213 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 HOH O O N N 145 HOH H1 H N N 146 HOH H2 H N N 147 ILE N N N N 148 ILE CA C N S 149 ILE C C N N 150 ILE O O N N 151 ILE CB C N S 152 ILE CG1 C N N 153 ILE CG2 C N N 154 ILE CD1 C N N 155 ILE OXT O N N 156 ILE H H N N 157 ILE H2 H N N 158 ILE HA H N N 159 ILE HB H N N 160 ILE HG12 H N N 161 ILE HG13 H N N 162 ILE HG21 H N N 163 ILE HG22 H N N 164 ILE HG23 H N N 165 ILE HD11 H N N 166 ILE HD12 H N N 167 ILE HD13 H N N 168 ILE HXT H N N 169 LEU N N N N 170 LEU CA C N S 171 LEU C C N N 172 LEU O O N N 173 LEU CB C N N 174 LEU CG C N N 175 LEU CD1 C N N 176 LEU CD2 C N N 177 LEU OXT O N N 178 LEU H H N N 179 LEU H2 H N N 180 LEU HA H N N 181 LEU HB2 H N N 182 LEU HB3 H N N 183 LEU HG H N N 184 LEU HD11 H N N 185 LEU HD12 H N N 186 LEU HD13 H N N 187 LEU HD21 H N N 188 LEU HD22 H N N 189 LEU HD23 H N N 190 LEU HXT H N N 191 LYS N N N N 192 LYS CA C N S 193 LYS C C N N 194 LYS O O N N 195 LYS CB C N N 196 LYS CG C N N 197 LYS CD C N N 198 LYS CE C N N 199 LYS NZ N N N 200 LYS OXT O N N 201 LYS H H N N 202 LYS H2 H N N 203 LYS HA H N N 204 LYS HB2 H N N 205 LYS HB3 H N N 206 LYS HG2 H N N 207 LYS HG3 H N N 208 LYS HD2 H N N 209 LYS HD3 H N N 210 LYS HE2 H N N 211 LYS HE3 H N N 212 LYS HZ1 H N N 213 LYS HZ2 H N N 214 LYS HZ3 H N N 215 LYS HXT H N N 216 MET N N N N 217 MET CA C N S 218 MET C C N N 219 MET O O N N 220 MET CB C N N 221 MET CG C N N 222 MET SD S N N 223 MET CE C N N 224 MET OXT O N N 225 MET H H N N 226 MET H2 H N N 227 MET HA H N N 228 MET HB2 H N N 229 MET HB3 H N N 230 MET HG2 H N N 231 MET HG3 H N N 232 MET HE1 H N N 233 MET HE2 H N N 234 MET HE3 H N N 235 MET HXT H N N 236 PHE N N N N 237 PHE CA C N S 238 PHE C C N N 239 PHE O O N N 240 PHE CB C N N 241 PHE CG C Y N 242 PHE CD1 C Y N 243 PHE CD2 C Y N 244 PHE CE1 C Y N 245 PHE CE2 C Y N 246 PHE CZ C Y N 247 PHE OXT O N N 248 PHE H H N N 249 PHE H2 H N N 250 PHE HA H N N 251 PHE HB2 H N N 252 PHE HB3 H N N 253 PHE HD1 H N N 254 PHE HD2 H N N 255 PHE HE1 H N N 256 PHE HE2 H N N 257 PHE HZ H N N 258 PHE HXT H N N 259 PRO N N N N 260 PRO CA C N S 261 PRO C C N N 262 PRO O O N N 263 PRO CB C N N 264 PRO CG C N N 265 PRO CD C N N 266 PRO OXT O N N 267 PRO H H N N 268 PRO HA H N N 269 PRO HB2 H N N 270 PRO HB3 H N N 271 PRO HG2 H N N 272 PRO HG3 H N N 273 PRO HD2 H N N 274 PRO HD3 H N N 275 PRO HXT H N N 276 SER N N N N 277 SER CA C N S 278 SER C C N N 279 SER O O N N 280 SER CB C N N 281 SER OG O N N 282 SER OXT O N N 283 SER H H N N 284 SER H2 H N N 285 SER HA H N N 286 SER HB2 H N N 287 SER HB3 H N N 288 SER HG H N N 289 SER HXT H N N 290 THR N N N N 291 THR CA C N S 292 THR C C N N 293 THR O O N N 294 THR CB C N R 295 THR OG1 O N N 296 THR CG2 C N N 297 THR OXT O N N 298 THR H H N N 299 THR H2 H N N 300 THR HA H N N 301 THR HB H N N 302 THR HG1 H N N 303 THR HG21 H N N 304 THR HG22 H N N 305 THR HG23 H N N 306 THR HXT H N N 307 TRP N N N N 308 TRP CA C N S 309 TRP C C N N 310 TRP O O N N 311 TRP CB C N N 312 TRP CG C Y N 313 TRP CD1 C Y N 314 TRP CD2 C Y N 315 TRP NE1 N Y N 316 TRP CE2 C Y N 317 TRP CE3 C Y N 318 TRP CZ2 C Y N 319 TRP CZ3 C Y N 320 TRP CH2 C Y N 321 TRP OXT O N N 322 TRP H H N N 323 TRP H2 H N N 324 TRP HA H N N 325 TRP HB2 H N N 326 TRP HB3 H N N 327 TRP HD1 H N N 328 TRP HE1 H N N 329 TRP HE3 H N N 330 TRP HZ2 H N N 331 TRP HZ3 H N N 332 TRP HH2 H N N 333 TRP HXT H N N 334 TYR N N N N 335 TYR CA C N S 336 TYR C C N N 337 TYR O O N N 338 TYR CB C N N 339 TYR CG C Y N 340 TYR CD1 C Y N 341 TYR CD2 C Y N 342 TYR CE1 C Y N 343 TYR CE2 C Y N 344 TYR CZ C Y N 345 TYR OH O N N 346 TYR OXT O N N 347 TYR H H N N 348 TYR H2 H N N 349 TYR HA H N N 350 TYR HB2 H N N 351 TYR HB3 H N N 352 TYR HD1 H N N 353 TYR HD2 H N N 354 TYR HE1 H N N 355 TYR HE2 H N N 356 TYR HH H N N 357 TYR HXT H N N 358 VAL N N N N 359 VAL CA C N S 360 VAL C C N N 361 VAL O O N N 362 VAL CB C N N 363 VAL CG1 C N N 364 VAL CG2 C N N 365 VAL OXT O N N 366 VAL H H N N 367 VAL H2 H N N 368 VAL HA H N N 369 VAL HB H N N 370 VAL HG11 H N N 371 VAL HG12 H N N 372 VAL HG13 H N N 373 VAL HG21 H N N 374 VAL HG22 H N N 375 VAL HG23 H N N 376 VAL HXT H N N 377 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Health and Medical Research Council (NHMRC, Australia)' Australia GNT1106590 1 'National Health and Medical Research Council (NHMRC, Australia)' Australia GNT1033799 2 'National Health and Medical Research Council (NHMRC, Australia)' Australia GNT1067455 3 'National Health and Medical Research Council (NHMRC, Australia)' Australia GNT1071659 4 # _atom_sites.entry_id 6N8B _atom_sites.fract_transf_matrix[1][1] 0.005981 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.005981 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005981 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N NA O S SE # loop_