data_6NAF # _entry.id 6NAF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6NAF pdb_00006naf 10.2210/pdb6naf/pdb WWPDB D_1000238439 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'High resolution X-ray structure of a de novo homo-trimeric amantadine-binding protein' _pdbx_database_related.db_id 6N9H _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6NAF _pdbx_database_status.recvd_initial_deposition_date 2018-12-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Selvaraj, B.' 1 0000-0002-9980-7765 'Park, J.' 2 0000-0001-8557-641X 'Cuneo, M.J.' 3 0000-0002-1475-6656 'Myles, D.A.A.' 4 0000-0002-7693-4964 'Baker, D.' 5 0000-0001-7896-6217 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Elife _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2050-084X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 8 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'De novo design of a homo-trimeric amantadine-binding protein.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.7554/eLife.47839 _citation.pdbx_database_id_PubMed 31854299 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Park, J.' 1 0000-0001-8557-641X primary 'Selvaraj, B.' 2 ? primary 'McShan, A.C.' 3 0000-0002-3212-9867 primary 'Boyken, S.E.' 4 0000-0002-5378-0632 primary 'Wei, K.Y.' 5 0000-0002-8794-1385 primary 'Oberdorfer, G.' 6 ? primary 'DeGrado, W.' 7 ? primary 'Sgourakis, N.G.' 8 0000-0003-3655-3902 primary 'Cuneo, M.J.' 9 0000-0002-1475-6656 primary 'Myles, D.A.' 10 0000-0002-7693-4964 primary 'Baker, D.' 11 0000-0001-7896-6217 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6NAF _cell.details ? _cell.formula_units_Z ? _cell.length_a 50.610 _cell.length_a_esd ? _cell.length_b 50.610 _cell.length_b_esd ? _cell.length_c 68.820 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6NAF _symmetry.cell_setting ? _symmetry.Int_Tables_number 173 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 63' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'amantadine-binding protein' 9139.512 1 ? ? ? ? 2 non-polymer syn '(3S,5S,7S)-tricyclo[3.3.1.1~3,7~]decan-1-amine' 151.249 1 ? ? ? ? 3 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 4 water nat water 18.015 41 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSHMGDAQDKLKYLVKQLERALRELKKSLDELERSLEELEKNPSEDALVENNRLNVENNKIIVEVLRIILELAKASAKLA _entity_poly.pdbx_seq_one_letter_code_can GSHMGDAQDKLKYLVKQLERALRELKKSLDELERSLEELEKNPSEDALVENNRLNVENNKIIVEVLRIILELAKASAKLA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 GLY n 1 6 ASP n 1 7 ALA n 1 8 GLN n 1 9 ASP n 1 10 LYS n 1 11 LEU n 1 12 LYS n 1 13 TYR n 1 14 LEU n 1 15 VAL n 1 16 LYS n 1 17 GLN n 1 18 LEU n 1 19 GLU n 1 20 ARG n 1 21 ALA n 1 22 LEU n 1 23 ARG n 1 24 GLU n 1 25 LEU n 1 26 LYS n 1 27 LYS n 1 28 SER n 1 29 LEU n 1 30 ASP n 1 31 GLU n 1 32 LEU n 1 33 GLU n 1 34 ARG n 1 35 SER n 1 36 LEU n 1 37 GLU n 1 38 GLU n 1 39 LEU n 1 40 GLU n 1 41 LYS n 1 42 ASN n 1 43 PRO n 1 44 SER n 1 45 GLU n 1 46 ASP n 1 47 ALA n 1 48 LEU n 1 49 VAL n 1 50 GLU n 1 51 ASN n 1 52 ASN n 1 53 ARG n 1 54 LEU n 1 55 ASN n 1 56 VAL n 1 57 GLU n 1 58 ASN n 1 59 ASN n 1 60 LYS n 1 61 ILE n 1 62 ILE n 1 63 VAL n 1 64 GLU n 1 65 VAL n 1 66 LEU n 1 67 ARG n 1 68 ILE n 1 69 ILE n 1 70 LEU n 1 71 GLU n 1 72 LEU n 1 73 ALA n 1 74 LYS n 1 75 ALA n 1 76 SER n 1 77 ALA n 1 78 LYS n 1 79 LEU n 1 80 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 80 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli-Pichia pastoris shuttle vector pPpARG4' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 1182032 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pPpARG4 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6NAF _struct_ref.pdbx_db_accession 6NAF _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6NAF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 80 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 6NAF _struct_ref_seq.db_align_beg -4 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 75 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -4 _struct_ref_seq.pdbx_auth_seq_align_end 75 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 308 non-polymer . '(3S,5S,7S)-tricyclo[3.3.1.1~3,7~]decan-1-amine' Amantadine 'C10 H17 N' 151.249 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 DOD non-polymer . 'DEUTERATED WATER' ? 'D2 O' 20.028 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _exptl.absorpt_coefficient_mu _exptl.absorpt_correction_T_max _exptl.absorpt_correction_T_min _exptl.absorpt_correction_type _exptl.absorpt_process_details _exptl.entry_id _exptl.crystals_number _exptl.details _exptl.method _exptl.method_details ? ? ? ? ? 6NAF 1 ? 'X-RAY DIFFRACTION' ? ? ? ? ? ? 6NAF 1 ? 'NEUTRON DIFFRACTION' ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.78 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.82 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '9% PEG6000, 0.1 M citric acid, pH 4.0' _exptl_crystal_grow.pdbx_pH_range 4-5 # loop_ _diffrn.ambient_environment _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.ambient_temp_esd _diffrn.crystal_id _diffrn.crystal_support _diffrn.crystal_treatment _diffrn.details _diffrn.id _diffrn.ambient_pressure _diffrn.ambient_pressure_esd _diffrn.ambient_pressure_gt _diffrn.ambient_pressure_lt _diffrn.ambient_temp_gt _diffrn.ambient_temp_lt _diffrn.pdbx_serial_crystal_experiment ? 298 ? ? 1 ? ? ? 1 ? ? ? ? ? ? N ? 298 ? ? 1 ? ? ? 2 ? ? ? ? ? ? N # loop_ _diffrn_detector.details _diffrn_detector.detector _diffrn_detector.diffrn_id _diffrn_detector.type _diffrn_detector.area_resol_mean _diffrn_detector.dtime _diffrn_detector.pdbx_frames_total _diffrn_detector.pdbx_collection_time_total _diffrn_detector.pdbx_collection_date _diffrn_detector.pdbx_frequency ? 'IMAGE PLATE' 1 RIGAKU ? ? ? ? 2017-12-09 ? ? 'IMAGE PLATE' 2 'MAATEL IMAGINE' ? ? ? ? 2018-06-12 ? # loop_ _diffrn_radiation.collimation _diffrn_radiation.diffrn_id _diffrn_radiation.filter_edge _diffrn_radiation.inhomogeneity _diffrn_radiation.monochromator _diffrn_radiation.polarisn_norm _diffrn_radiation.polarisn_ratio _diffrn_radiation.probe _diffrn_radiation.type _diffrn_radiation.xray_symbol _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.pdbx_wavelength_list _diffrn_radiation.pdbx_wavelength _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_analyzer _diffrn_radiation.pdbx_scattering_type ? 1 ? ? ? ? ? ? ? ? 1 M ? ? 'SINGLE WAVELENGTH' ? x-ray ? 2 ? ? ? ? ? ? ? ? 2 L ? ? LAUE ? neutron # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 1.5417 1.0 2 2.8 1.0 3 4.5 1.0 # loop_ _diffrn_source.current _diffrn_source.details _diffrn_source.diffrn_id _diffrn_source.power _diffrn_source.size _diffrn_source.source _diffrn_source.target _diffrn_source.type _diffrn_source.voltage _diffrn_source.take-off_angle _diffrn_source.pdbx_wavelength_list _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_synchrotron_site ? ? 1 ? ? 'ROTATING ANODE' ? 'RIGAKU MICROMAX-007 HF' ? ? 1.5417 ? ? ? ? ? 2 ? ? 'NUCLEAR REACTOR' ? 'ORNL High Flux Isotope Reactor BEAMLINE CG4D' ? ? 2.8-4.5 ? CG4D 'ORNL High Flux Isotope Reactor' # loop_ _reflns.B_iso_Wilson_estimate _reflns.entry_id _reflns.data_reduction_details _reflns.data_reduction_method _reflns.d_resolution_high _reflns.d_resolution_low _reflns.details _reflns.limit_h_max _reflns.limit_h_min _reflns.limit_k_max _reflns.limit_k_min _reflns.limit_l_max _reflns.limit_l_min _reflns.number_all _reflns.number_obs _reflns.observed_criterion _reflns.observed_criterion_F_max _reflns.observed_criterion_F_min _reflns.observed_criterion_I_max _reflns.observed_criterion_I_min _reflns.observed_criterion_sigma_F _reflns.observed_criterion_sigma_I _reflns.percent_possible_obs _reflns.R_free_details _reflns.Rmerge_F_all _reflns.Rmerge_F_obs _reflns.Friedel_coverage _reflns.number_gt _reflns.threshold_expression _reflns.pdbx_redundancy _reflns.pdbx_Rmerge_I_obs _reflns.pdbx_Rmerge_I_all _reflns.pdbx_Rsym_value _reflns.pdbx_netI_over_av_sigmaI _reflns.pdbx_netI_over_sigmaI _reflns.pdbx_res_netI_over_av_sigmaI_2 _reflns.pdbx_res_netI_over_sigmaI_2 _reflns.pdbx_chi_squared _reflns.pdbx_scaling_rejects _reflns.pdbx_d_res_high_opt _reflns.pdbx_d_res_low_opt _reflns.pdbx_d_res_opt_method _reflns.phase_calculation_details _reflns.pdbx_Rrim_I_all _reflns.pdbx_Rpim_I_all _reflns.pdbx_d_opt _reflns.pdbx_number_measured_all _reflns.pdbx_diffrn_id _reflns.pdbx_ordinal _reflns.pdbx_CC_half _reflns.pdbx_R_split ? 6NAF ? ? 1.92 68.82 ? ? ? ? ? ? ? ? 7655 ? ? ? ? ? ? ? 100 ? ? ? ? ? ? 17.8 0.09 ? ? ? 23.2 ? ? ? ? ? ? ? ? ? ? ? ? 1 1 ? ? ? 6NAF ? ? 2.3 36.72 ? ? ? ? ? ? ? ? 2639 ? ? ? ? ? ? ? 73.5 ? ? ? ? ? ? 4.0 0.143 ? ? ? 8.7 ? ? ? ? ? ? ? ? ? ? ? ? 2 2 ? ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.92 9.02 ? ? ? ? ? ? 7686 100 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 1 ? ? 2.5 7.27 ? ? ? ? ? ? 3091 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 2 ? ? # loop_ _refine.aniso_B[1][1] _refine.aniso_B[1][2] _refine.aniso_B[1][3] _refine.aniso_B[2][2] _refine.aniso_B[2][3] _refine.aniso_B[3][3] _refine.B_iso_max _refine.B_iso_mean _refine.B_iso_min _refine.correlation_coeff_Fo_to_Fc _refine.correlation_coeff_Fo_to_Fc_free _refine.details _refine.diff_density_max _refine.diff_density_max_esd _refine.diff_density_min _refine.diff_density_min_esd _refine.diff_density_rms _refine.diff_density_rms_esd _refine.entry_id _refine.pdbx_refine_id _refine.ls_abs_structure_details _refine.ls_abs_structure_Flack _refine.ls_abs_structure_Flack_esd _refine.ls_abs_structure_Rogers _refine.ls_abs_structure_Rogers_esd _refine.ls_d_res_high _refine.ls_d_res_low _refine.ls_extinction_coef _refine.ls_extinction_coef_esd _refine.ls_extinction_expression _refine.ls_extinction_method _refine.ls_goodness_of_fit_all _refine.ls_goodness_of_fit_all_esd _refine.ls_goodness_of_fit_obs _refine.ls_goodness_of_fit_obs_esd _refine.ls_hydrogen_treatment _refine.ls_matrix_type _refine.ls_number_constraints _refine.ls_number_parameters _refine.ls_number_reflns_all _refine.ls_number_reflns_obs _refine.ls_number_reflns_R_free _refine.ls_number_reflns_R_work _refine.ls_number_restraints _refine.ls_percent_reflns_obs _refine.ls_percent_reflns_R_free _refine.ls_R_factor_all _refine.ls_R_factor_obs _refine.ls_R_factor_R_free _refine.ls_R_factor_R_free_error _refine.ls_R_factor_R_free_error_details _refine.ls_R_factor_R_work _refine.ls_R_Fsqd_factor_obs _refine.ls_R_I_factor_obs _refine.ls_redundancy_reflns_all _refine.ls_redundancy_reflns_obs _refine.ls_restrained_S_all _refine.ls_restrained_S_obs _refine.ls_shift_over_esd_max _refine.ls_shift_over_esd_mean _refine.ls_structure_factor_coef _refine.ls_weighting_details _refine.ls_weighting_scheme _refine.ls_wR_factor_all _refine.ls_wR_factor_obs _refine.ls_wR_factor_R_free _refine.ls_wR_factor_R_work _refine.occupancy_max _refine.occupancy_min _refine.solvent_model_details _refine.solvent_model_param_bsol _refine.solvent_model_param_ksol _refine.ls_R_factor_gt _refine.ls_goodness_of_fit_gt _refine.ls_goodness_of_fit_ref _refine.ls_shift_over_su_max _refine.ls_shift_over_su_max_lt _refine.ls_shift_over_su_mean _refine.ls_shift_over_su_mean_lt _refine.pdbx_ls_sigma_I _refine.pdbx_ls_sigma_F _refine.pdbx_ls_sigma_Fsqd _refine.pdbx_data_cutoff_high_absF _refine.pdbx_data_cutoff_high_rms_absF _refine.pdbx_data_cutoff_low_absF _refine.pdbx_isotropic_thermal_model _refine.pdbx_ls_cross_valid_method _refine.pdbx_method_to_determine_struct _refine.pdbx_starting_model _refine.pdbx_stereochemistry_target_values _refine.pdbx_R_Free_selection_details _refine.pdbx_stereochem_target_val_spec_case _refine.pdbx_overall_ESU_R _refine.pdbx_overall_ESU_R_Free _refine.pdbx_solvent_vdw_probe_radii _refine.pdbx_solvent_ion_probe_radii _refine.pdbx_solvent_shrinkage_radii _refine.pdbx_real_space_R _refine.pdbx_density_correlation _refine.pdbx_pd_number_of_powder_patterns _refine.pdbx_pd_number_of_points _refine.pdbx_pd_meas_number_of_points _refine.pdbx_pd_proc_ls_prof_R_factor _refine.pdbx_pd_proc_ls_prof_wR_factor _refine.pdbx_pd_Marquardt_correlation_coeff _refine.pdbx_pd_Fsqrd_R_factor _refine.pdbx_pd_ls_matrix_band_width _refine.pdbx_overall_phase_error _refine.pdbx_overall_SU_R_free_Cruickshank_DPI _refine.pdbx_overall_SU_R_free_Blow_DPI _refine.pdbx_overall_SU_R_Blow_DPI _refine.pdbx_TLS_residual_ADP_flag _refine.pdbx_diffrn_id _refine.overall_SU_B _refine.overall_SU_ML _refine.overall_SU_R_Cruickshank_DPI _refine.overall_SU_R_free _refine.overall_FOM_free_R_set _refine.overall_FOM_work_R_set _refine.pdbx_average_fsc_overall _refine.pdbx_average_fsc_work _refine.pdbx_average_fsc_free ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 6NAF 'X-RAY DIFFRACTION' ? ? ? ? ? 1.923 36.969 ? ? ? ? ? ? ? ? ? ? ? ? ? 7655 770 ? ? 99.87 10.06 ? 0.1777 0.2039 ? ? 0.1748 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1.38 ? ? ? ? ? 'FREE R-VALUE' 'MOLECULAR REPLACEMENT' 'PDB entry 6N9H' ? ? ? ? ? 1.11 ? 0.90 ? ? ? ? ? ? ? ? ? ? 18.84 ? ? ? ? ? ? 0.16 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 6NAF 'NEUTRON DIFFRACTION' ? ? ? ? ? 2.500 27.065 ? ? ? ? ? ? ? ? ? ? ? ? ? 2639 261 ? ? 75.34 9.89 ? 0.2801 0.3179 ? ? 0.2771 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 23.7 ? ? ? ? ? 'FREE R-VALUE' 'MOLECULAR REPLACEMENT' 'PDB entry 6N9H' ? ? ? ? ? 1.11 ? 0.90 ? ? ? ? ? ? ? ? ? ? 18.84 ? ? ? ? ? ? 0.16 ? ? ? ? ? ? ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 596 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 12 _refine_hist.number_atoms_solvent 41 _refine_hist.number_atoms_total 649 _refine_hist.d_res_high 1.923 _refine_hist.d_res_low 36.969 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 ? 1390 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 2.001 ? 2433 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 14.512 ? 566 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.073 ? 102 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 ? 214 ? f_plane_restr ? ? 'NEUTRON DIFFRACTION' ? 0.013 ? 1390 ? f_bond_d ? ? 'NEUTRON DIFFRACTION' ? 2.001 ? 2433 ? f_angle_d ? ? 'NEUTRON DIFFRACTION' ? 14.512 ? 566 ? f_dihedral_angle_d ? ? 'NEUTRON DIFFRACTION' ? 0.073 ? 102 ? f_chiral_restr ? ? 'NEUTRON DIFFRACTION' ? 0.010 ? 214 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.9231 2.0716 . . 147 1368 100.00 . . . 0.2139 . 0.1909 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0716 2.2801 . . 156 1377 100.00 . . . 0.1834 . 0.1824 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2801 2.6099 . . 158 1362 100.00 . . . 0.2096 . 0.1740 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6099 3.2879 . . 147 1389 100.00 . . . 0.2142 . 0.1907 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2879 36.9756 . . 162 1389 99.00 . . . 0.2001 . 0.1598 . . . . . . . . . . 'NEUTRON DIFFRACTION' 2.5002 3.1492 . . 103 986 63.00 . . . 0.3389 . 0.3266 . . . . . . . . . . 'NEUTRON DIFFRACTION' 3.1492 27.0670 . . 158 1392 88.00 . . . 0.3090 . 0.2518 . . . . . . . . . . # _struct.entry_id 6NAF _struct.title 'De novo designed homo-trimeric amantadine-binding protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6NAF _struct_keywords.text 'helical bundle, trimer, amantadine-binding protein, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 6 ? ASN A 42 ? ASP A 1 ASN A 37 1 ? 37 HELX_P HELX_P2 AA2 SER A 44 ? ALA A 77 ? SER A 39 ALA A 72 1 ? 34 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASN 52 OD1 ? ? ? 1_555 C NA . NA ? ? A ASN 47 A NA 102 1_555 ? ? ? ? ? ? ? 2.560 ? ? metalc2 metalc ? ? A ASN 52 OD1 ? ? ? 1_555 C NA . NA ? ? A ASN 47 A NA 102 3_655 ? ? ? ? ? ? ? 2.559 ? ? metalc3 metalc ? ? C NA . NA ? ? ? 1_555 D DOD . O ? ? A NA 102 A DOD 212 1_555 ? ? ? ? ? ? ? 2.529 ? ? metalc4 metalc ? ? C NA . NA ? ? ? 1_555 D DOD . O ? ? A NA 102 A DOD 212 2_545 ? ? ? ? ? ? ? 2.529 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A 308 101 ? 1 'binding site for residue 308 A 101' AC2 Software A NA 102 ? 2 'binding site for residue NA A 102' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 1 DOD D . ? DOD A 203 . ? 1_555 ? 2 AC2 2 ASN A 52 ? ASN A 47 . ? 1_555 ? 3 AC2 2 DOD D . ? DOD A 212 . ? 1_555 ? # _atom_sites.entry_id 6NAF _atom_sites.fract_transf_matrix[1][1] 0.019759 _atom_sites.fract_transf_matrix[1][2] 0.011408 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022816 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014531 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C D H N NA O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -4 ? ? ? A . n A 1 2 SER 2 -3 ? ? ? A . n A 1 3 HIS 3 -2 ? ? ? A . n A 1 4 MET 4 -1 ? ? ? A . n A 1 5 GLY 5 0 ? ? ? A . n A 1 6 ASP 6 1 1 ASP ASP A . n A 1 7 ALA 7 2 2 ALA ALA A . n A 1 8 GLN 8 3 3 GLN GLN A . n A 1 9 ASP 9 4 4 ASP ASP A . n A 1 10 LYS 10 5 5 LYS LYS A . n A 1 11 LEU 11 6 6 LEU LEU A . n A 1 12 LYS 12 7 7 LYS LYS A . n A 1 13 TYR 13 8 8 TYR TYR A . n A 1 14 LEU 14 9 9 LEU LEU A . n A 1 15 VAL 15 10 10 VAL VAL A . n A 1 16 LYS 16 11 11 LYS LYS A . n A 1 17 GLN 17 12 12 GLN GLN A . n A 1 18 LEU 18 13 13 LEU LEU A . n A 1 19 GLU 19 14 14 GLU GLU A . n A 1 20 ARG 20 15 15 ARG ARG A . n A 1 21 ALA 21 16 16 ALA ALA A . n A 1 22 LEU 22 17 17 LEU LEU A . n A 1 23 ARG 23 18 18 ARG ARG A . n A 1 24 GLU 24 19 19 GLU GLU A . n A 1 25 LEU 25 20 20 LEU LEU A . n A 1 26 LYS 26 21 21 LYS LYS A . n A 1 27 LYS 27 22 22 LYS LYS A . n A 1 28 SER 28 23 23 SER SER A . n A 1 29 LEU 29 24 24 LEU LEU A . n A 1 30 ASP 30 25 25 ASP ASP A . n A 1 31 GLU 31 26 26 GLU GLU A . n A 1 32 LEU 32 27 27 LEU LEU A . n A 1 33 GLU 33 28 28 GLU GLU A . n A 1 34 ARG 34 29 29 ARG ARG A . n A 1 35 SER 35 30 30 SER SER A . n A 1 36 LEU 36 31 31 LEU LEU A . n A 1 37 GLU 37 32 32 GLU GLU A . n A 1 38 GLU 38 33 33 GLU GLU A . n A 1 39 LEU 39 34 34 LEU LEU A . n A 1 40 GLU 40 35 35 GLU GLU A . n A 1 41 LYS 41 36 36 LYS LYS A . n A 1 42 ASN 42 37 37 ASN ASN A . n A 1 43 PRO 43 38 38 PRO PRO A . n A 1 44 SER 44 39 39 SER SER A . n A 1 45 GLU 45 40 40 GLU GLU A . n A 1 46 ASP 46 41 41 ASP ASP A . n A 1 47 ALA 47 42 42 ALA ALA A . n A 1 48 LEU 48 43 43 LEU LEU A . n A 1 49 VAL 49 44 44 VAL VAL A . n A 1 50 GLU 50 45 45 GLU GLU A . n A 1 51 ASN 51 46 46 ASN ASN A . n A 1 52 ASN 52 47 47 ASN ASN A . n A 1 53 ARG 53 48 48 ARG ARG A . n A 1 54 LEU 54 49 49 LEU LEU A . n A 1 55 ASN 55 50 50 ASN ASN A . n A 1 56 VAL 56 51 51 VAL VAL A . n A 1 57 GLU 57 52 52 GLU GLU A . n A 1 58 ASN 58 53 53 ASN ASN A . n A 1 59 ASN 59 54 54 ASN ASN A . n A 1 60 LYS 60 55 55 LYS LYS A . n A 1 61 ILE 61 56 56 ILE ILE A . n A 1 62 ILE 62 57 57 ILE ILE A . n A 1 63 VAL 63 58 58 VAL VAL A . n A 1 64 GLU 64 59 59 GLU GLU A . n A 1 65 VAL 65 60 60 VAL VAL A . n A 1 66 LEU 66 61 61 LEU LEU A . n A 1 67 ARG 67 62 62 ARG ARG A . n A 1 68 ILE 68 63 63 ILE ILE A . n A 1 69 ILE 69 64 64 ILE ILE A . n A 1 70 LEU 70 65 65 LEU LEU A . n A 1 71 GLU 71 66 66 GLU GLU A . n A 1 72 LEU 72 67 67 LEU LEU A . n A 1 73 ALA 73 68 68 ALA ALA A . n A 1 74 LYS 74 69 69 LYS LYS A . n A 1 75 ALA 75 70 70 ALA ALA A . n A 1 76 SER 76 71 71 SER SER A . n A 1 77 ALA 77 72 72 ALA ALA A . n A 1 78 LYS 78 73 73 LYS LYS A . n A 1 79 LEU 79 74 74 LEU LEU A . n A 1 80 ALA 80 75 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 308 1 101 1 308 308 A . C 3 NA 1 102 1 NA NA A . D 4 DOD 1 201 4 DOD DOD A . D 4 DOD 2 202 27 DOD DOD A . D 4 DOD 3 203 31 DOD DOD A . D 4 DOD 4 204 10 DOD DOD A . D 4 DOD 5 205 20 DOD DOD A . D 4 DOD 6 206 29 DOD DOD A . D 4 DOD 7 207 41 DOD DOD A . D 4 DOD 8 208 26 DOD DOD A . D 4 DOD 9 209 15 DOD DOD A . D 4 DOD 10 210 7 DOD DOD A . D 4 DOD 11 211 24 DOD DOD A . D 4 DOD 12 212 2 DOD DOD A . D 4 DOD 13 213 19 DOD DOD A . D 4 DOD 14 214 9 DOD DOD A . D 4 DOD 15 215 6 DOD DOD A . D 4 DOD 16 216 40 DOD DOD A . D 4 DOD 17 217 42 DOD DOD A . D 4 DOD 18 218 5 DOD DOD A . D 4 DOD 19 219 48 DOD DOD A . D 4 DOD 20 220 50 DOD DOD A . D 4 DOD 21 221 38 DOD DOD A . D 4 DOD 22 222 37 DOD DOD A . D 4 DOD 23 223 12 DOD DOD A . D 4 DOD 24 224 46 DOD DOD A . D 4 DOD 25 225 3 DOD DOD A . D 4 DOD 26 226 32 DOD DOD A . D 4 DOD 27 227 18 DOD DOD A . D 4 DOD 28 228 45 DOD DOD A . D 4 DOD 29 229 14 DOD DOD A . D 4 DOD 30 230 22 DOD DOD A . D 4 DOD 31 231 39 DOD DOD A . D 4 DOD 32 232 16 DOD DOD A . D 4 DOD 33 233 21 DOD DOD A . D 4 DOD 34 234 8 DOD DOD A . D 4 DOD 35 235 13 DOD DOD A . D 4 DOD 36 236 28 DOD DOD A . D 4 DOD 37 237 30 DOD DOD A . D 4 DOD 38 238 44 DOD DOD A . D 4 DOD 39 239 23 DOD DOD A . D 4 DOD 40 240 35 DOD DOD A . D 4 DOD 41 241 34 DOD DOD A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 18420 ? 1 MORE -50 ? 1 'SSA (A^2)' 12680 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_545 -y,x-y-1,z -0.5000000000 -0.8660254038 0.0000000000 25.3050000000 0.8660254038 -0.5000000000 0.0000000000 -43.8295456855 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_655 -x+y+1,-x,z -0.5000000000 0.8660254038 0.0000000000 50.6100000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A 308 101 ? B 308 . 2 1 A 308 101 ? B 308 . 3 1 A NA 102 ? C NA . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASN 52 ? A ASN 47 ? 1_555 NA ? C NA . ? A NA 102 ? 1_555 OD1 ? A ASN 52 ? A ASN 47 ? 1_555 0.0 ? 2 OD1 ? A ASN 52 ? A ASN 47 ? 1_555 NA ? C NA . ? A NA 102 ? 1_555 O ? D DOD . ? A DOD 212 ? 1_555 87.1 ? 3 OD1 ? A ASN 52 ? A ASN 47 ? 1_555 NA ? C NA . ? A NA 102 ? 1_555 O ? D DOD . ? A DOD 212 ? 1_555 87.1 ? 4 OD1 ? A ASN 52 ? A ASN 47 ? 1_555 NA ? C NA . ? A NA 102 ? 1_555 O ? D DOD . ? A DOD 212 ? 2_545 171.7 ? 5 OD1 ? A ASN 52 ? A ASN 47 ? 1_555 NA ? C NA . ? A NA 102 ? 1_555 O ? D DOD . ? A DOD 212 ? 2_545 171.7 ? 6 O ? D DOD . ? A DOD 212 ? 1_555 NA ? C NA . ? A NA 102 ? 1_555 O ? D DOD . ? A DOD 212 ? 2_545 97.1 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-12-18 2 'Structure model' 1 1 2020-01-01 3 'Structure model' 1 2 2023-10-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' diffrn_source 7 3 'Structure model' pdbx_initial_refinement_model 8 3 'Structure model' pdbx_struct_conn_angle 9 3 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.year' 9 2 'Structure model' '_citation_author.identifier_ORCID' 10 2 'Structure model' '_citation_author.name' 11 3 'Structure model' '_database_2.pdbx_DOI' 12 3 'Structure model' '_database_2.pdbx_database_accession' 13 3 'Structure model' '_diffrn_source.pdbx_synchrotron_beamline' 14 3 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 17 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 18 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 19 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 20 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 21 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 22 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 23 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 24 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 25 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 26 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 27 3 'Structure model' '_pdbx_struct_conn_angle.value' 28 3 'Structure model' '_struct_conn.pdbx_dist_value' 29 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 30 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 31 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 32 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 33 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 34 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 35 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 36 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 37 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 38 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 39 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 40 3 'Structure model' '_struct_conn.ptnr2_symmetry' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? LAUEGEN ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? LSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A DOD 240 ? 6.96 . 2 1 O ? A DOD 241 ? 6.97 . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 62 ? CG ? A ARG 67 CG 2 1 Y 1 A ARG 62 ? CD ? A ARG 67 CD 3 1 Y 1 A ARG 62 ? NE ? A ARG 67 NE 4 1 Y 1 A ARG 62 ? CZ ? A ARG 67 CZ 5 1 Y 1 A ARG 62 ? NH1 ? A ARG 67 NH1 6 1 Y 1 A ARG 62 ? NH2 ? A ARG 67 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -4 ? A GLY 1 2 1 Y 1 A SER -3 ? A SER 2 3 1 Y 1 A HIS -2 ? A HIS 3 4 1 Y 1 A MET -1 ? A MET 4 5 1 Y 1 A GLY 0 ? A GLY 5 6 1 Y 1 A ALA 75 ? A ALA 80 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 308 N1 N N N 1 308 C10 C N N 2 308 C7 C N N 3 308 C1 C N N 4 308 C8 C N N 5 308 C5 C N N 6 308 C6 C N N 7 308 C4 C N N 8 308 C9 C N N 9 308 C3 C N N 10 308 C2 C N N 11 308 HN1 H N N 12 308 HN1A H N N 13 308 H7 H N N 14 308 H7A H N N 15 308 H1 H N N 16 308 H8 H N N 17 308 H8A H N N 18 308 H5 H N N 19 308 H6 H N N 20 308 H6A H N N 21 308 H4 H N N 22 308 H4A H N N 23 308 H9 H N N 24 308 H9A H N N 25 308 H3 H N N 26 308 H2 H N N 27 308 H2A H N N 28 ALA N N N N 29 ALA CA C N S 30 ALA C C N N 31 ALA O O N N 32 ALA CB C N N 33 ALA OXT O N N 34 ALA H H N N 35 ALA H2 H N N 36 ALA HA H N N 37 ALA HB1 H N N 38 ALA HB2 H N N 39 ALA HB3 H N N 40 ALA HXT H N N 41 ARG N N N N 42 ARG CA C N S 43 ARG C C N N 44 ARG O O N N 45 ARG CB C N N 46 ARG CG C N N 47 ARG CD C N N 48 ARG NE N N N 49 ARG CZ C N N 50 ARG NH1 N N N 51 ARG NH2 N N N 52 ARG OXT O N N 53 ARG H H N N 54 ARG H2 H N N 55 ARG HA H N N 56 ARG HB2 H N N 57 ARG HB3 H N N 58 ARG HG2 H N N 59 ARG HG3 H N N 60 ARG HD2 H N N 61 ARG HD3 H N N 62 ARG HE H N N 63 ARG HH11 H N N 64 ARG HH12 H N N 65 ARG HH21 H N N 66 ARG HH22 H N N 67 ARG HXT H N N 68 ASN N N N N 69 ASN CA C N S 70 ASN C C N N 71 ASN O O N N 72 ASN CB C N N 73 ASN CG C N N 74 ASN OD1 O N N 75 ASN ND2 N N N 76 ASN OXT O N N 77 ASN H H N N 78 ASN H2 H N N 79 ASN HA H N N 80 ASN HB2 H N N 81 ASN HB3 H N N 82 ASN HD21 H N N 83 ASN HD22 H N N 84 ASN HXT H N N 85 ASP N N N N 86 ASP CA C N S 87 ASP C C N N 88 ASP O O N N 89 ASP CB C N N 90 ASP CG C N N 91 ASP OD1 O N N 92 ASP OD2 O N N 93 ASP OXT O N N 94 ASP H H N N 95 ASP H2 H N N 96 ASP HA H N N 97 ASP HB2 H N N 98 ASP HB3 H N N 99 ASP HD2 H N N 100 ASP HXT H N N 101 DOD O O N N 102 DOD D1 D N N 103 DOD D2 D N N 104 GLN N N N N 105 GLN CA C N S 106 GLN C C N N 107 GLN O O N N 108 GLN CB C N N 109 GLN CG C N N 110 GLN CD C N N 111 GLN OE1 O N N 112 GLN NE2 N N N 113 GLN OXT O N N 114 GLN H H N N 115 GLN H2 H N N 116 GLN HA H N N 117 GLN HB2 H N N 118 GLN HB3 H N N 119 GLN HG2 H N N 120 GLN HG3 H N N 121 GLN HE21 H N N 122 GLN HE22 H N N 123 GLN HXT H N N 124 GLU N N N N 125 GLU CA C N S 126 GLU C C N N 127 GLU O O N N 128 GLU CB C N N 129 GLU CG C N N 130 GLU CD C N N 131 GLU OE1 O N N 132 GLU OE2 O N N 133 GLU OXT O N N 134 GLU H H N N 135 GLU H2 H N N 136 GLU HA H N N 137 GLU HB2 H N N 138 GLU HB3 H N N 139 GLU HG2 H N N 140 GLU HG3 H N N 141 GLU HE2 H N N 142 GLU HXT H N N 143 GLY N N N N 144 GLY CA C N N 145 GLY C C N N 146 GLY O O N N 147 GLY OXT O N N 148 GLY H H N N 149 GLY H2 H N N 150 GLY HA2 H N N 151 GLY HA3 H N N 152 GLY HXT H N N 153 HIS N N N N 154 HIS CA C N S 155 HIS C C N N 156 HIS O O N N 157 HIS CB C N N 158 HIS CG C Y N 159 HIS ND1 N Y N 160 HIS CD2 C Y N 161 HIS CE1 C Y N 162 HIS NE2 N Y N 163 HIS OXT O N N 164 HIS H H N N 165 HIS H2 H N N 166 HIS HA H N N 167 HIS HB2 H N N 168 HIS HB3 H N N 169 HIS HD1 H N N 170 HIS HD2 H N N 171 HIS HE1 H N N 172 HIS HE2 H N N 173 HIS HXT H N N 174 ILE N N N N 175 ILE CA C N S 176 ILE C C N N 177 ILE O O N N 178 ILE CB C N S 179 ILE CG1 C N N 180 ILE CG2 C N N 181 ILE CD1 C N N 182 ILE OXT O N N 183 ILE H H N N 184 ILE H2 H N N 185 ILE HA H N N 186 ILE HB H N N 187 ILE HG12 H N N 188 ILE HG13 H N N 189 ILE HG21 H N N 190 ILE HG22 H N N 191 ILE HG23 H N N 192 ILE HD11 H N N 193 ILE HD12 H N N 194 ILE HD13 H N N 195 ILE HXT H N N 196 LEU N N N N 197 LEU CA C N S 198 LEU C C N N 199 LEU O O N N 200 LEU CB C N N 201 LEU CG C N N 202 LEU CD1 C N N 203 LEU CD2 C N N 204 LEU OXT O N N 205 LEU H H N N 206 LEU H2 H N N 207 LEU HA H N N 208 LEU HB2 H N N 209 LEU HB3 H N N 210 LEU HG H N N 211 LEU HD11 H N N 212 LEU HD12 H N N 213 LEU HD13 H N N 214 LEU HD21 H N N 215 LEU HD22 H N N 216 LEU HD23 H N N 217 LEU HXT H N N 218 LYS N N N N 219 LYS CA C N S 220 LYS C C N N 221 LYS O O N N 222 LYS CB C N N 223 LYS CG C N N 224 LYS CD C N N 225 LYS CE C N N 226 LYS NZ N N N 227 LYS OXT O N N 228 LYS H H N N 229 LYS H2 H N N 230 LYS HA H N N 231 LYS HB2 H N N 232 LYS HB3 H N N 233 LYS HG2 H N N 234 LYS HG3 H N N 235 LYS HD2 H N N 236 LYS HD3 H N N 237 LYS HE2 H N N 238 LYS HE3 H N N 239 LYS HZ1 H N N 240 LYS HZ2 H N N 241 LYS HZ3 H N N 242 LYS HXT H N N 243 MET N N N N 244 MET CA C N S 245 MET C C N N 246 MET O O N N 247 MET CB C N N 248 MET CG C N N 249 MET SD S N N 250 MET CE C N N 251 MET OXT O N N 252 MET H H N N 253 MET H2 H N N 254 MET HA H N N 255 MET HB2 H N N 256 MET HB3 H N N 257 MET HG2 H N N 258 MET HG3 H N N 259 MET HE1 H N N 260 MET HE2 H N N 261 MET HE3 H N N 262 MET HXT H N N 263 NA NA NA N N 264 PRO N N N N 265 PRO CA C N S 266 PRO C C N N 267 PRO O O N N 268 PRO CB C N N 269 PRO CG C N N 270 PRO CD C N N 271 PRO OXT O N N 272 PRO H H N N 273 PRO HA H N N 274 PRO HB2 H N N 275 PRO HB3 H N N 276 PRO HG2 H N N 277 PRO HG3 H N N 278 PRO HD2 H N N 279 PRO HD3 H N N 280 PRO HXT H N N 281 SER N N N N 282 SER CA C N S 283 SER C C N N 284 SER O O N N 285 SER CB C N N 286 SER OG O N N 287 SER OXT O N N 288 SER H H N N 289 SER H2 H N N 290 SER HA H N N 291 SER HB2 H N N 292 SER HB3 H N N 293 SER HG H N N 294 SER HXT H N N 295 TYR N N N N 296 TYR CA C N S 297 TYR C C N N 298 TYR O O N N 299 TYR CB C N N 300 TYR CG C Y N 301 TYR CD1 C Y N 302 TYR CD2 C Y N 303 TYR CE1 C Y N 304 TYR CE2 C Y N 305 TYR CZ C Y N 306 TYR OH O N N 307 TYR OXT O N N 308 TYR H H N N 309 TYR H2 H N N 310 TYR HA H N N 311 TYR HB2 H N N 312 TYR HB3 H N N 313 TYR HD1 H N N 314 TYR HD2 H N N 315 TYR HE1 H N N 316 TYR HE2 H N N 317 TYR HH H N N 318 TYR HXT H N N 319 VAL N N N N 320 VAL CA C N S 321 VAL C C N N 322 VAL O O N N 323 VAL CB C N N 324 VAL CG1 C N N 325 VAL CG2 C N N 326 VAL OXT O N N 327 VAL H H N N 328 VAL H2 H N N 329 VAL HA H N N 330 VAL HB H N N 331 VAL HG11 H N N 332 VAL HG12 H N N 333 VAL HG13 H N N 334 VAL HG21 H N N 335 VAL HG22 H N N 336 VAL HG23 H N N 337 VAL HXT H N N 338 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 308 N1 C10 sing N N 1 308 C10 C7 sing N N 2 308 C10 C8 sing N N 3 308 C10 C9 sing N N 4 308 C7 C1 sing N N 5 308 C1 C6 sing N N 6 308 C1 C2 sing N N 7 308 C8 C5 sing N N 8 308 C5 C6 sing N N 9 308 C5 C4 sing N N 10 308 C4 C3 sing N N 11 308 C9 C3 sing N N 12 308 C3 C2 sing N N 13 308 N1 HN1 sing N N 14 308 N1 HN1A sing N N 15 308 C7 H7 sing N N 16 308 C7 H7A sing N N 17 308 C1 H1 sing N N 18 308 C8 H8 sing N N 19 308 C8 H8A sing N N 20 308 C5 H5 sing N N 21 308 C6 H6 sing N N 22 308 C6 H6A sing N N 23 308 C4 H4 sing N N 24 308 C4 H4A sing N N 25 308 C9 H9 sing N N 26 308 C9 H9A sing N N 27 308 C3 H3 sing N N 28 308 C2 H2 sing N N 29 308 C2 H2A sing N N 30 ALA N CA sing N N 31 ALA N H sing N N 32 ALA N H2 sing N N 33 ALA CA C sing N N 34 ALA CA CB sing N N 35 ALA CA HA sing N N 36 ALA C O doub N N 37 ALA C OXT sing N N 38 ALA CB HB1 sing N N 39 ALA CB HB2 sing N N 40 ALA CB HB3 sing N N 41 ALA OXT HXT sing N N 42 ARG N CA sing N N 43 ARG N H sing N N 44 ARG N H2 sing N N 45 ARG CA C sing N N 46 ARG CA CB sing N N 47 ARG CA HA sing N N 48 ARG C O doub N N 49 ARG C OXT sing N N 50 ARG CB CG sing N N 51 ARG CB HB2 sing N N 52 ARG CB HB3 sing N N 53 ARG CG CD sing N N 54 ARG CG HG2 sing N N 55 ARG CG HG3 sing N N 56 ARG CD NE sing N N 57 ARG CD HD2 sing N N 58 ARG CD HD3 sing N N 59 ARG NE CZ sing N N 60 ARG NE HE sing N N 61 ARG CZ NH1 sing N N 62 ARG CZ NH2 doub N N 63 ARG NH1 HH11 sing N N 64 ARG NH1 HH12 sing N N 65 ARG NH2 HH21 sing N N 66 ARG NH2 HH22 sing N N 67 ARG OXT HXT sing N N 68 ASN N CA sing N N 69 ASN N H sing N N 70 ASN N H2 sing N N 71 ASN CA C sing N N 72 ASN CA CB sing N N 73 ASN CA HA sing N N 74 ASN C O doub N N 75 ASN C OXT sing N N 76 ASN CB CG sing N N 77 ASN CB HB2 sing N N 78 ASN CB HB3 sing N N 79 ASN CG OD1 doub N N 80 ASN CG ND2 sing N N 81 ASN ND2 HD21 sing N N 82 ASN ND2 HD22 sing N N 83 ASN OXT HXT sing N N 84 ASP N CA sing N N 85 ASP N H sing N N 86 ASP N H2 sing N N 87 ASP CA C sing N N 88 ASP CA CB sing N N 89 ASP CA HA sing N N 90 ASP C O doub N N 91 ASP C OXT sing N N 92 ASP CB CG sing N N 93 ASP CB HB2 sing N N 94 ASP CB HB3 sing N N 95 ASP CG OD1 doub N N 96 ASP CG OD2 sing N N 97 ASP OD2 HD2 sing N N 98 ASP OXT HXT sing N N 99 DOD O D1 sing N N 100 DOD O D2 sing N N 101 GLN N CA sing N N 102 GLN N H sing N N 103 GLN N H2 sing N N 104 GLN CA C sing N N 105 GLN CA CB sing N N 106 GLN CA HA sing N N 107 GLN C O doub N N 108 GLN C OXT sing N N 109 GLN CB CG sing N N 110 GLN CB HB2 sing N N 111 GLN CB HB3 sing N N 112 GLN CG CD sing N N 113 GLN CG HG2 sing N N 114 GLN CG HG3 sing N N 115 GLN CD OE1 doub N N 116 GLN CD NE2 sing N N 117 GLN NE2 HE21 sing N N 118 GLN NE2 HE22 sing N N 119 GLN OXT HXT sing N N 120 GLU N CA sing N N 121 GLU N H sing N N 122 GLU N H2 sing N N 123 GLU CA C sing N N 124 GLU CA CB sing N N 125 GLU CA HA sing N N 126 GLU C O doub N N 127 GLU C OXT sing N N 128 GLU CB CG sing N N 129 GLU CB HB2 sing N N 130 GLU CB HB3 sing N N 131 GLU CG CD sing N N 132 GLU CG HG2 sing N N 133 GLU CG HG3 sing N N 134 GLU CD OE1 doub N N 135 GLU CD OE2 sing N N 136 GLU OE2 HE2 sing N N 137 GLU OXT HXT sing N N 138 GLY N CA sing N N 139 GLY N H sing N N 140 GLY N H2 sing N N 141 GLY CA C sing N N 142 GLY CA HA2 sing N N 143 GLY CA HA3 sing N N 144 GLY C O doub N N 145 GLY C OXT sing N N 146 GLY OXT HXT sing N N 147 HIS N CA sing N N 148 HIS N H sing N N 149 HIS N H2 sing N N 150 HIS CA C sing N N 151 HIS CA CB sing N N 152 HIS CA HA sing N N 153 HIS C O doub N N 154 HIS C OXT sing N N 155 HIS CB CG sing N N 156 HIS CB HB2 sing N N 157 HIS CB HB3 sing N N 158 HIS CG ND1 sing Y N 159 HIS CG CD2 doub Y N 160 HIS ND1 CE1 doub Y N 161 HIS ND1 HD1 sing N N 162 HIS CD2 NE2 sing Y N 163 HIS CD2 HD2 sing N N 164 HIS CE1 NE2 sing Y N 165 HIS CE1 HE1 sing N N 166 HIS NE2 HE2 sing N N 167 HIS OXT HXT sing N N 168 ILE N CA sing N N 169 ILE N H sing N N 170 ILE N H2 sing N N 171 ILE CA C sing N N 172 ILE CA CB sing N N 173 ILE CA HA sing N N 174 ILE C O doub N N 175 ILE C OXT sing N N 176 ILE CB CG1 sing N N 177 ILE CB CG2 sing N N 178 ILE CB HB sing N N 179 ILE CG1 CD1 sing N N 180 ILE CG1 HG12 sing N N 181 ILE CG1 HG13 sing N N 182 ILE CG2 HG21 sing N N 183 ILE CG2 HG22 sing N N 184 ILE CG2 HG23 sing N N 185 ILE CD1 HD11 sing N N 186 ILE CD1 HD12 sing N N 187 ILE CD1 HD13 sing N N 188 ILE OXT HXT sing N N 189 LEU N CA sing N N 190 LEU N H sing N N 191 LEU N H2 sing N N 192 LEU CA C sing N N 193 LEU CA CB sing N N 194 LEU CA HA sing N N 195 LEU C O doub N N 196 LEU C OXT sing N N 197 LEU CB CG sing N N 198 LEU CB HB2 sing N N 199 LEU CB HB3 sing N N 200 LEU CG CD1 sing N N 201 LEU CG CD2 sing N N 202 LEU CG HG sing N N 203 LEU CD1 HD11 sing N N 204 LEU CD1 HD12 sing N N 205 LEU CD1 HD13 sing N N 206 LEU CD2 HD21 sing N N 207 LEU CD2 HD22 sing N N 208 LEU CD2 HD23 sing N N 209 LEU OXT HXT sing N N 210 LYS N CA sing N N 211 LYS N H sing N N 212 LYS N H2 sing N N 213 LYS CA C sing N N 214 LYS CA CB sing N N 215 LYS CA HA sing N N 216 LYS C O doub N N 217 LYS C OXT sing N N 218 LYS CB CG sing N N 219 LYS CB HB2 sing N N 220 LYS CB HB3 sing N N 221 LYS CG CD sing N N 222 LYS CG HG2 sing N N 223 LYS CG HG3 sing N N 224 LYS CD CE sing N N 225 LYS CD HD2 sing N N 226 LYS CD HD3 sing N N 227 LYS CE NZ sing N N 228 LYS CE HE2 sing N N 229 LYS CE HE3 sing N N 230 LYS NZ HZ1 sing N N 231 LYS NZ HZ2 sing N N 232 LYS NZ HZ3 sing N N 233 LYS OXT HXT sing N N 234 MET N CA sing N N 235 MET N H sing N N 236 MET N H2 sing N N 237 MET CA C sing N N 238 MET CA CB sing N N 239 MET CA HA sing N N 240 MET C O doub N N 241 MET C OXT sing N N 242 MET CB CG sing N N 243 MET CB HB2 sing N N 244 MET CB HB3 sing N N 245 MET CG SD sing N N 246 MET CG HG2 sing N N 247 MET CG HG3 sing N N 248 MET SD CE sing N N 249 MET CE HE1 sing N N 250 MET CE HE2 sing N N 251 MET CE HE3 sing N N 252 MET OXT HXT sing N N 253 PRO N CA sing N N 254 PRO N CD sing N N 255 PRO N H sing N N 256 PRO CA C sing N N 257 PRO CA CB sing N N 258 PRO CA HA sing N N 259 PRO C O doub N N 260 PRO C OXT sing N N 261 PRO CB CG sing N N 262 PRO CB HB2 sing N N 263 PRO CB HB3 sing N N 264 PRO CG CD sing N N 265 PRO CG HG2 sing N N 266 PRO CG HG3 sing N N 267 PRO CD HD2 sing N N 268 PRO CD HD3 sing N N 269 PRO OXT HXT sing N N 270 SER N CA sing N N 271 SER N H sing N N 272 SER N H2 sing N N 273 SER CA C sing N N 274 SER CA CB sing N N 275 SER CA HA sing N N 276 SER C O doub N N 277 SER C OXT sing N N 278 SER CB OG sing N N 279 SER CB HB2 sing N N 280 SER CB HB3 sing N N 281 SER OG HG sing N N 282 SER OXT HXT sing N N 283 TYR N CA sing N N 284 TYR N H sing N N 285 TYR N H2 sing N N 286 TYR CA C sing N N 287 TYR CA CB sing N N 288 TYR CA HA sing N N 289 TYR C O doub N N 290 TYR C OXT sing N N 291 TYR CB CG sing N N 292 TYR CB HB2 sing N N 293 TYR CB HB3 sing N N 294 TYR CG CD1 doub Y N 295 TYR CG CD2 sing Y N 296 TYR CD1 CE1 sing Y N 297 TYR CD1 HD1 sing N N 298 TYR CD2 CE2 doub Y N 299 TYR CD2 HD2 sing N N 300 TYR CE1 CZ doub Y N 301 TYR CE1 HE1 sing N N 302 TYR CE2 CZ sing Y N 303 TYR CE2 HE2 sing N N 304 TYR CZ OH sing N N 305 TYR OH HH sing N N 306 TYR OXT HXT sing N N 307 VAL N CA sing N N 308 VAL N H sing N N 309 VAL N H2 sing N N 310 VAL CA C sing N N 311 VAL CA CB sing N N 312 VAL CA HA sing N N 313 VAL C O doub N N 314 VAL C OXT sing N N 315 VAL CB CG1 sing N N 316 VAL CB CG2 sing N N 317 VAL CB HB sing N N 318 VAL CG1 HG11 sing N N 319 VAL CG1 HG12 sing N N 320 VAL CG1 HG13 sing N N 321 VAL CG2 HG21 sing N N 322 VAL CG2 HG22 sing N N 323 VAL CG2 HG23 sing N N 324 VAL OXT HXT sing N N 325 # _pdbx_audit_support.funding_organization 'Department of Energy (DOE, United States)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 308 ? ? 308 ? ? 'SUBJECT OF INVESTIGATION' ? 2 DOD ? ? DOD ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(3S,5S,7S)-tricyclo[3.3.1.1~3,7~]decan-1-amine' 308 3 'SODIUM ION' NA 4 water DOD # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6N9H _pdbx_initial_refinement_model.details 'PDB entry 6N9HPDB entry 6N9H' # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #