data_6NCN # _entry.id 6NCN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.309 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6NCN WWPDB D_1000238503 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6NCN _pdbx_database_status.recvd_initial_deposition_date 2018-12-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jakob, C.G.' 1 0000-0002-7257-982X 'Qiu, W.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 62 _citation.language ? _citation.page_first 4120 _citation.page_last 4130 _citation.title 'Fragment-Based Discovery of an Apolipoprotein E4 (apoE4) Stabilizer.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.9b00178 _citation.pdbx_database_id_PubMed 30933499 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Petros, A.M.' 1 ? primary 'Korepanova, A.' 2 ? primary 'Jakob, C.G.' 3 ? primary 'Qiu, W.' 4 ? primary 'Panchal, S.C.' 5 ? primary 'Wang, J.' 6 ? primary 'Dietrich, J.D.' 7 ? primary 'Brewer, J.T.' 8 ? primary 'Pohlki, F.' 9 ? primary 'Kling, A.' 10 ? primary 'Wilcox, K.' 11 ? primary 'Lakics, V.' 12 ? primary 'Bahnassawy, L.' 13 ? primary 'Reinhardt, P.' 14 ? primary 'Partha, S.K.' 15 ? primary 'Bodelle, P.M.' 16 ? primary 'Lake, M.' 17 ? primary 'Charych, E.I.' 18 ? primary 'Stoll, V.S.' 19 ? primary 'Sun, C.' 20 ? primary 'Mohler, E.G.' 21 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6NCN _cell.details ? _cell.formula_units_Z ? _cell.length_a 41.070 _cell.length_a_esd ? _cell.length_b 52.790 _cell.length_b_esd ? _cell.length_c 84.540 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6NCN _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Apolipoprotein E' 21523.221 1 ? ? ? ? 2 non-polymer syn '1-(3-chlorophenyl)cyclobutane-1-carboximidamide' 208.687 1 ? ? ? ? 3 water nat water 18.015 129 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Apo-E # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSHHHHHHSSGLVPRGSHMKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQEL RALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASH LRKLRKRLLRDADDLQKRLAVYQAG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSHHHHHHSSGLVPRGSHMKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQEL RALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASH LRKLRKRLLRDADDLQKRLAVYQAG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 SER n 1 11 SER n 1 12 GLY n 1 13 LEU n 1 14 VAL n 1 15 PRO n 1 16 ARG n 1 17 GLY n 1 18 SER n 1 19 HIS n 1 20 MET n 1 21 LYS n 1 22 VAL n 1 23 GLU n 1 24 GLN n 1 25 ALA n 1 26 VAL n 1 27 GLU n 1 28 THR n 1 29 GLU n 1 30 PRO n 1 31 GLU n 1 32 PRO n 1 33 GLU n 1 34 LEU n 1 35 ARG n 1 36 GLN n 1 37 GLN n 1 38 THR n 1 39 GLU n 1 40 TRP n 1 41 GLN n 1 42 SER n 1 43 GLY n 1 44 GLN n 1 45 ARG n 1 46 TRP n 1 47 GLU n 1 48 LEU n 1 49 ALA n 1 50 LEU n 1 51 GLY n 1 52 ARG n 1 53 PHE n 1 54 TRP n 1 55 ASP n 1 56 TYR n 1 57 LEU n 1 58 ARG n 1 59 TRP n 1 60 VAL n 1 61 GLN n 1 62 THR n 1 63 LEU n 1 64 SER n 1 65 GLU n 1 66 GLN n 1 67 VAL n 1 68 GLN n 1 69 GLU n 1 70 GLU n 1 71 LEU n 1 72 LEU n 1 73 SER n 1 74 SER n 1 75 GLN n 1 76 VAL n 1 77 THR n 1 78 GLN n 1 79 GLU n 1 80 LEU n 1 81 ARG n 1 82 ALA n 1 83 LEU n 1 84 MET n 1 85 ASP n 1 86 GLU n 1 87 THR n 1 88 MET n 1 89 LYS n 1 90 GLU n 1 91 LEU n 1 92 LYS n 1 93 ALA n 1 94 TYR n 1 95 LYS n 1 96 SER n 1 97 GLU n 1 98 LEU n 1 99 GLU n 1 100 GLU n 1 101 GLN n 1 102 LEU n 1 103 THR n 1 104 PRO n 1 105 VAL n 1 106 ALA n 1 107 GLU n 1 108 GLU n 1 109 THR n 1 110 ARG n 1 111 ALA n 1 112 ARG n 1 113 LEU n 1 114 SER n 1 115 LYS n 1 116 GLU n 1 117 LEU n 1 118 GLN n 1 119 ALA n 1 120 ALA n 1 121 GLN n 1 122 ALA n 1 123 ARG n 1 124 LEU n 1 125 GLY n 1 126 ALA n 1 127 ASP n 1 128 MET n 1 129 GLU n 1 130 ASP n 1 131 VAL n 1 132 ARG n 1 133 GLY n 1 134 ARG n 1 135 LEU n 1 136 VAL n 1 137 GLN n 1 138 TYR n 1 139 ARG n 1 140 GLY n 1 141 GLU n 1 142 VAL n 1 143 GLN n 1 144 ALA n 1 145 MET n 1 146 LEU n 1 147 GLY n 1 148 GLN n 1 149 SER n 1 150 THR n 1 151 GLU n 1 152 GLU n 1 153 LEU n 1 154 ARG n 1 155 VAL n 1 156 ARG n 1 157 LEU n 1 158 ALA n 1 159 SER n 1 160 HIS n 1 161 LEU n 1 162 ARG n 1 163 LYS n 1 164 LEU n 1 165 ARG n 1 166 LYS n 1 167 ARG n 1 168 LEU n 1 169 LEU n 1 170 ARG n 1 171 ASP n 1 172 ALA n 1 173 ASP n 1 174 ASP n 1 175 LEU n 1 176 GLN n 1 177 LYS n 1 178 ARG n 1 179 LEU n 1 180 ALA n 1 181 VAL n 1 182 TYR n 1 183 GLN n 1 184 ALA n 1 185 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 185 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene APOE _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code APOE_HUMAN _struct_ref.pdbx_db_accession P02649 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEE QLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLA VY ; _struct_ref.pdbx_align_begin 20 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6NCN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 21 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 182 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02649 _struct_ref_seq.db_align_beg 20 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 181 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 162 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6NCN GLY A 1 ? UNP P02649 ? ? 'expression tag' -19 1 1 6NCN SER A 2 ? UNP P02649 ? ? 'expression tag' -18 2 1 6NCN SER A 3 ? UNP P02649 ? ? 'expression tag' -17 3 1 6NCN HIS A 4 ? UNP P02649 ? ? 'expression tag' -16 4 1 6NCN HIS A 5 ? UNP P02649 ? ? 'expression tag' -15 5 1 6NCN HIS A 6 ? UNP P02649 ? ? 'expression tag' -14 6 1 6NCN HIS A 7 ? UNP P02649 ? ? 'expression tag' -13 7 1 6NCN HIS A 8 ? UNP P02649 ? ? 'expression tag' -12 8 1 6NCN HIS A 9 ? UNP P02649 ? ? 'expression tag' -11 9 1 6NCN SER A 10 ? UNP P02649 ? ? 'expression tag' -10 10 1 6NCN SER A 11 ? UNP P02649 ? ? 'expression tag' -9 11 1 6NCN GLY A 12 ? UNP P02649 ? ? 'expression tag' -8 12 1 6NCN LEU A 13 ? UNP P02649 ? ? 'expression tag' -7 13 1 6NCN VAL A 14 ? UNP P02649 ? ? 'expression tag' -6 14 1 6NCN PRO A 15 ? UNP P02649 ? ? 'expression tag' -5 15 1 6NCN ARG A 16 ? UNP P02649 ? ? 'expression tag' -4 16 1 6NCN GLY A 17 ? UNP P02649 ? ? 'expression tag' -3 17 1 6NCN SER A 18 ? UNP P02649 ? ? 'expression tag' -2 18 1 6NCN HIS A 19 ? UNP P02649 ? ? 'expression tag' -1 19 1 6NCN MET A 20 ? UNP P02649 ? ? 'expression tag' 0 20 1 6NCN ARG A 132 ? UNP P02649 CYS 131 variant 112 21 1 6NCN GLN A 183 ? UNP P02649 ? ? 'expression tag' 163 22 1 6NCN ALA A 184 ? UNP P02649 ? ? 'expression tag' 164 23 1 6NCN GLY A 185 ? UNP P02649 ? ? 'expression tag' 165 24 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 KJM non-polymer . '1-(3-chlorophenyl)cyclobutane-1-carboximidamide' ? 'C11 H13 Cl N2' 208.687 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6NCN _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.13 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.23 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 296 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% w/v Polyethylene glycol monomethyl ether mesylate 5,000; 0.1M Bis-Tris buffer at pH6.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-11-07 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 17-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6NCN _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.82 _reflns.d_resolution_low 36.94 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14586 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 84.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.0 _reflns.pdbx_Rmerge_I_obs 0.043 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 22.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.82 _reflns_shell.d_res_low 1.85 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 848 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.785 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6NCN _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.82 _refine.ls_d_res_low 36.94 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14584 _refine.ls_number_reflns_R_free 686 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 84.86 _refine.ls_percent_reflns_R_free 4.70 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1852 _refine.ls_R_factor_R_free 0.2192 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1836 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1GS9 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.41 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.20 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1164 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 14 _refine_hist.number_atoms_solvent 129 _refine_hist.number_atoms_total 1307 _refine_hist.d_res_high 1.82 _refine_hist.d_res_low 36.94 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 1216 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.864 ? 1637 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 11.147 ? 1071 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.037 ? 178 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 220 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.8166 1.9569 . . 91 1824 56.00 . . . 0.3306 . 0.2591 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9569 2.1538 . . 126 2645 83.00 . . . 0.2654 . 0.2139 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1538 2.4654 . . 142 3107 96.00 . . . 0.2412 . 0.1954 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4654 3.1059 . . 158 2968 91.00 . . . 0.2465 . 0.1939 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1059 36.9491 . . 169 3354 98.00 . . . 0.1913 . 0.1681 . . . . . . . . . . # _struct.entry_id 6NCN _struct.title 'Fragment-based Discovery of an apoE4 Stabilizer' _struct.pdbx_descriptor 'Apolipoprotein E' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6NCN _struct_keywords.text 'Lipid Binding Lipid Transport, LIPID TRANSPORT' _struct_keywords.pdbx_keywords 'LIPID TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 44 ? LEU A 63 ? GLN A 24 LEU A 43 1 ? 20 HELX_P HELX_P2 AA2 SER A 64 ? SER A 73 ? SER A 44 SER A 53 1 ? 10 HELX_P HELX_P3 AA3 SER A 74 ? GLU A 99 ? SER A 54 GLU A 79 1 ? 26 HELX_P HELX_P4 AA4 ALA A 106 ? MET A 145 ? ALA A 86 MET A 125 1 ? 40 HELX_P HELX_P5 AA5 THR A 150 ? GLN A 183 ? THR A 130 GLN A 163 1 ? 34 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id KJM _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'binding site for residue KJM A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 LEU A 50 ? LEU A 30 . ? 1_555 ? 2 AC1 5 TRP A 54 ? TRP A 34 . ? 1_555 ? 3 AC1 5 LEU A 169 ? LEU A 149 . ? 1_555 ? 4 AC1 5 ASP A 173 ? ASP A 153 . ? 1_555 ? 5 AC1 5 GLN A 176 ? GLN A 156 . ? 1_555 ? # _atom_sites.entry_id 6NCN _atom_sites.fract_transf_matrix[1][1] 0.024349 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018943 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011829 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -19 ? ? ? A . n A 1 2 SER 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 HIS 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 SER 10 -10 ? ? ? A . n A 1 11 SER 11 -9 ? ? ? A . n A 1 12 GLY 12 -8 ? ? ? A . n A 1 13 LEU 13 -7 ? ? ? A . n A 1 14 VAL 14 -6 ? ? ? A . n A 1 15 PRO 15 -5 ? ? ? A . n A 1 16 ARG 16 -4 ? ? ? A . n A 1 17 GLY 17 -3 ? ? ? A . n A 1 18 SER 18 -2 ? ? ? A . n A 1 19 HIS 19 -1 ? ? ? A . n A 1 20 MET 20 0 ? ? ? A . n A 1 21 LYS 21 1 ? ? ? A . n A 1 22 VAL 22 2 ? ? ? A . n A 1 23 GLU 23 3 ? ? ? A . n A 1 24 GLN 24 4 ? ? ? A . n A 1 25 ALA 25 5 ? ? ? A . n A 1 26 VAL 26 6 ? ? ? A . n A 1 27 GLU 27 7 ? ? ? A . n A 1 28 THR 28 8 ? ? ? A . n A 1 29 GLU 29 9 ? ? ? A . n A 1 30 PRO 30 10 ? ? ? A . n A 1 31 GLU 31 11 ? ? ? A . n A 1 32 PRO 32 12 ? ? ? A . n A 1 33 GLU 33 13 ? ? ? A . n A 1 34 LEU 34 14 ? ? ? A . n A 1 35 ARG 35 15 ? ? ? A . n A 1 36 GLN 36 16 ? ? ? A . n A 1 37 GLN 37 17 ? ? ? A . n A 1 38 THR 38 18 ? ? ? A . n A 1 39 GLU 39 19 ? ? ? A . n A 1 40 TRP 40 20 ? ? ? A . n A 1 41 GLN 41 21 ? ? ? A . n A 1 42 SER 42 22 ? ? ? A . n A 1 43 GLY 43 23 ? ? ? A . n A 1 44 GLN 44 24 24 GLN GLN A . n A 1 45 ARG 45 25 25 ARG ARG A . n A 1 46 TRP 46 26 26 TRP TRP A . n A 1 47 GLU 47 27 27 GLU GLU A . n A 1 48 LEU 48 28 28 LEU LEU A . n A 1 49 ALA 49 29 29 ALA ALA A . n A 1 50 LEU 50 30 30 LEU LEU A . n A 1 51 GLY 51 31 31 GLY GLY A . n A 1 52 ARG 52 32 32 ARG ARG A . n A 1 53 PHE 53 33 33 PHE PHE A . n A 1 54 TRP 54 34 34 TRP TRP A . n A 1 55 ASP 55 35 35 ASP ASP A . n A 1 56 TYR 56 36 36 TYR TYR A . n A 1 57 LEU 57 37 37 LEU LEU A . n A 1 58 ARG 58 38 38 ARG ARG A . n A 1 59 TRP 59 39 39 TRP TRP A . n A 1 60 VAL 60 40 40 VAL VAL A . n A 1 61 GLN 61 41 41 GLN GLN A . n A 1 62 THR 62 42 42 THR THR A . n A 1 63 LEU 63 43 43 LEU LEU A . n A 1 64 SER 64 44 44 SER SER A . n A 1 65 GLU 65 45 45 GLU GLU A . n A 1 66 GLN 66 46 46 GLN GLN A . n A 1 67 VAL 67 47 47 VAL VAL A . n A 1 68 GLN 68 48 48 GLN GLN A . n A 1 69 GLU 69 49 49 GLU GLU A . n A 1 70 GLU 70 50 50 GLU GLU A . n A 1 71 LEU 71 51 51 LEU LEU A . n A 1 72 LEU 72 52 52 LEU LEU A . n A 1 73 SER 73 53 53 SER SER A . n A 1 74 SER 74 54 54 SER SER A . n A 1 75 GLN 75 55 55 GLN GLN A . n A 1 76 VAL 76 56 56 VAL VAL A . n A 1 77 THR 77 57 57 THR THR A . n A 1 78 GLN 78 58 58 GLN GLN A . n A 1 79 GLU 79 59 59 GLU GLU A . n A 1 80 LEU 80 60 60 LEU LEU A . n A 1 81 ARG 81 61 61 ARG ARG A . n A 1 82 ALA 82 62 62 ALA ALA A . n A 1 83 LEU 83 63 63 LEU LEU A . n A 1 84 MET 84 64 64 MET MET A . n A 1 85 ASP 85 65 65 ASP ASP A . n A 1 86 GLU 86 66 66 GLU GLU A . n A 1 87 THR 87 67 67 THR THR A . n A 1 88 MET 88 68 68 MET MET A . n A 1 89 LYS 89 69 69 LYS LYS A . n A 1 90 GLU 90 70 70 GLU GLU A . n A 1 91 LEU 91 71 71 LEU LEU A . n A 1 92 LYS 92 72 72 LYS LYS A . n A 1 93 ALA 93 73 73 ALA ALA A . n A 1 94 TYR 94 74 74 TYR TYR A . n A 1 95 LYS 95 75 75 LYS LYS A . n A 1 96 SER 96 76 76 SER SER A . n A 1 97 GLU 97 77 77 GLU GLU A . n A 1 98 LEU 98 78 78 LEU LEU A . n A 1 99 GLU 99 79 79 GLU GLU A . n A 1 100 GLU 100 80 80 GLU GLU A . n A 1 101 GLN 101 81 81 GLN GLN A . n A 1 102 LEU 102 82 82 LEU LEU A . n A 1 103 THR 103 83 83 THR THR A . n A 1 104 PRO 104 84 84 PRO PRO A . n A 1 105 VAL 105 85 85 VAL VAL A . n A 1 106 ALA 106 86 86 ALA ALA A . n A 1 107 GLU 107 87 87 GLU GLU A . n A 1 108 GLU 108 88 88 GLU GLU A . n A 1 109 THR 109 89 89 THR THR A . n A 1 110 ARG 110 90 90 ARG ARG A . n A 1 111 ALA 111 91 91 ALA ALA A . n A 1 112 ARG 112 92 92 ARG ARG A . n A 1 113 LEU 113 93 93 LEU LEU A . n A 1 114 SER 114 94 94 SER SER A . n A 1 115 LYS 115 95 95 LYS LYS A . n A 1 116 GLU 116 96 96 GLU GLU A . n A 1 117 LEU 117 97 97 LEU LEU A . n A 1 118 GLN 118 98 98 GLN GLN A . n A 1 119 ALA 119 99 99 ALA ALA A . n A 1 120 ALA 120 100 100 ALA ALA A . n A 1 121 GLN 121 101 101 GLN GLN A . n A 1 122 ALA 122 102 102 ALA ALA A . n A 1 123 ARG 123 103 103 ARG ARG A . n A 1 124 LEU 124 104 104 LEU LEU A . n A 1 125 GLY 125 105 105 GLY GLY A . n A 1 126 ALA 126 106 106 ALA ALA A . n A 1 127 ASP 127 107 107 ASP ASP A . n A 1 128 MET 128 108 108 MET MET A . n A 1 129 GLU 129 109 109 GLU GLU A . n A 1 130 ASP 130 110 110 ASP ASP A . n A 1 131 VAL 131 111 111 VAL VAL A . n A 1 132 ARG 132 112 112 ARG ARG A . n A 1 133 GLY 133 113 113 GLY GLY A . n A 1 134 ARG 134 114 114 ARG ARG A . n A 1 135 LEU 135 115 115 LEU LEU A . n A 1 136 VAL 136 116 116 VAL VAL A . n A 1 137 GLN 137 117 117 GLN GLN A . n A 1 138 TYR 138 118 118 TYR TYR A . n A 1 139 ARG 139 119 119 ARG ARG A . n A 1 140 GLY 140 120 120 GLY GLY A . n A 1 141 GLU 141 121 121 GLU GLU A . n A 1 142 VAL 142 122 122 VAL VAL A . n A 1 143 GLN 143 123 123 GLN GLN A . n A 1 144 ALA 144 124 124 ALA ALA A . n A 1 145 MET 145 125 125 MET MET A . n A 1 146 LEU 146 126 126 LEU LEU A . n A 1 147 GLY 147 127 127 GLY GLY A . n A 1 148 GLN 148 128 128 GLN GLN A . n A 1 149 SER 149 129 129 SER SER A . n A 1 150 THR 150 130 130 THR THR A . n A 1 151 GLU 151 131 131 GLU GLU A . n A 1 152 GLU 152 132 132 GLU GLU A . n A 1 153 LEU 153 133 133 LEU LEU A . n A 1 154 ARG 154 134 134 ARG ARG A . n A 1 155 VAL 155 135 135 VAL VAL A . n A 1 156 ARG 156 136 136 ARG ARG A . n A 1 157 LEU 157 137 137 LEU LEU A . n A 1 158 ALA 158 138 138 ALA ALA A . n A 1 159 SER 159 139 139 SER SER A . n A 1 160 HIS 160 140 140 HIS HIS A . n A 1 161 LEU 161 141 141 LEU LEU A . n A 1 162 ARG 162 142 142 ARG ARG A . n A 1 163 LYS 163 143 143 LYS LYS A . n A 1 164 LEU 164 144 144 LEU LEU A . n A 1 165 ARG 165 145 145 ARG ARG A . n A 1 166 LYS 166 146 146 LYS LYS A . n A 1 167 ARG 167 147 147 ARG ARG A . n A 1 168 LEU 168 148 148 LEU LEU A . n A 1 169 LEU 169 149 149 LEU LEU A . n A 1 170 ARG 170 150 150 ARG ARG A . n A 1 171 ASP 171 151 151 ASP ASP A . n A 1 172 ALA 172 152 152 ALA ALA A . n A 1 173 ASP 173 153 153 ASP ASP A . n A 1 174 ASP 174 154 154 ASP ASP A . n A 1 175 LEU 175 155 155 LEU LEU A . n A 1 176 GLN 176 156 156 GLN GLN A . n A 1 177 LYS 177 157 157 LYS LYS A . n A 1 178 ARG 178 158 158 ARG ARG A . n A 1 179 LEU 179 159 159 LEU LEU A . n A 1 180 ALA 180 160 160 ALA ALA A . n A 1 181 VAL 181 161 161 VAL VAL A . n A 1 182 TYR 182 162 162 TYR TYR A . n A 1 183 GLN 183 163 163 GLN GLN A . n A 1 184 ALA 184 164 164 ALA ALA A . n A 1 185 GLY 185 165 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 KJM 1 201 201 KJM LIG A . C 3 HOH 1 301 105 HOH HOH A . C 3 HOH 2 302 66 HOH HOH A . C 3 HOH 3 303 44 HOH HOH A . C 3 HOH 4 304 106 HOH HOH A . C 3 HOH 5 305 91 HOH HOH A . C 3 HOH 6 306 84 HOH HOH A . C 3 HOH 7 307 74 HOH HOH A . C 3 HOH 8 308 112 HOH HOH A . C 3 HOH 9 309 126 HOH HOH A . C 3 HOH 10 310 4 HOH HOH A . C 3 HOH 11 311 8 HOH HOH A . C 3 HOH 12 312 43 HOH HOH A . C 3 HOH 13 313 24 HOH HOH A . C 3 HOH 14 314 48 HOH HOH A . C 3 HOH 15 315 28 HOH HOH A . C 3 HOH 16 316 95 HOH HOH A . C 3 HOH 17 317 113 HOH HOH A . C 3 HOH 18 318 124 HOH HOH A . C 3 HOH 19 319 36 HOH HOH A . C 3 HOH 20 320 80 HOH HOH A . C 3 HOH 21 321 40 HOH HOH A . C 3 HOH 22 322 56 HOH HOH A . C 3 HOH 23 323 88 HOH HOH A . C 3 HOH 24 324 35 HOH HOH A . C 3 HOH 25 325 10 HOH HOH A . C 3 HOH 26 326 98 HOH HOH A . C 3 HOH 27 327 54 HOH HOH A . C 3 HOH 28 328 85 HOH HOH A . C 3 HOH 29 329 55 HOH HOH A . C 3 HOH 30 330 18 HOH HOH A . C 3 HOH 31 331 2 HOH HOH A . C 3 HOH 32 332 27 HOH HOH A . C 3 HOH 33 333 15 HOH HOH A . C 3 HOH 34 334 25 HOH HOH A . C 3 HOH 35 335 111 HOH HOH A . C 3 HOH 36 336 21 HOH HOH A . C 3 HOH 37 337 7 HOH HOH A . C 3 HOH 38 338 125 HOH HOH A . C 3 HOH 39 339 61 HOH HOH A . C 3 HOH 40 340 17 HOH HOH A . C 3 HOH 41 341 57 HOH HOH A . C 3 HOH 42 342 30 HOH HOH A . C 3 HOH 43 343 67 HOH HOH A . C 3 HOH 44 344 14 HOH HOH A . C 3 HOH 45 345 11 HOH HOH A . C 3 HOH 46 346 5 HOH HOH A . C 3 HOH 47 347 3 HOH HOH A . C 3 HOH 48 348 37 HOH HOH A . C 3 HOH 49 349 72 HOH HOH A . C 3 HOH 50 350 59 HOH HOH A . C 3 HOH 51 351 68 HOH HOH A . C 3 HOH 52 352 45 HOH HOH A . C 3 HOH 53 353 32 HOH HOH A . C 3 HOH 54 354 1 HOH HOH A . C 3 HOH 55 355 110 HOH HOH A . C 3 HOH 56 356 107 HOH HOH A . C 3 HOH 57 357 39 HOH HOH A . C 3 HOH 58 358 23 HOH HOH A . C 3 HOH 59 359 13 HOH HOH A . C 3 HOH 60 360 19 HOH HOH A . C 3 HOH 61 361 120 HOH HOH A . C 3 HOH 62 362 76 HOH HOH A . C 3 HOH 63 363 34 HOH HOH A . C 3 HOH 64 364 9 HOH HOH A . C 3 HOH 65 365 81 HOH HOH A . C 3 HOH 66 366 33 HOH HOH A . C 3 HOH 67 367 49 HOH HOH A . C 3 HOH 68 368 20 HOH HOH A . C 3 HOH 69 369 12 HOH HOH A . C 3 HOH 70 370 31 HOH HOH A . C 3 HOH 71 371 22 HOH HOH A . C 3 HOH 72 372 42 HOH HOH A . C 3 HOH 73 373 79 HOH HOH A . C 3 HOH 74 374 86 HOH HOH A . C 3 HOH 75 375 6 HOH HOH A . C 3 HOH 76 376 41 HOH HOH A . C 3 HOH 77 377 26 HOH HOH A . C 3 HOH 78 378 53 HOH HOH A . C 3 HOH 79 379 65 HOH HOH A . C 3 HOH 80 380 60 HOH HOH A . C 3 HOH 81 381 29 HOH HOH A . C 3 HOH 82 382 123 HOH HOH A . C 3 HOH 83 383 58 HOH HOH A . C 3 HOH 84 384 38 HOH HOH A . C 3 HOH 85 385 70 HOH HOH A . C 3 HOH 86 386 109 HOH HOH A . C 3 HOH 87 387 46 HOH HOH A . C 3 HOH 88 388 127 HOH HOH A . C 3 HOH 89 389 62 HOH HOH A . C 3 HOH 90 390 100 HOH HOH A . C 3 HOH 91 391 73 HOH HOH A . C 3 HOH 92 392 78 HOH HOH A . C 3 HOH 93 393 63 HOH HOH A . C 3 HOH 94 394 77 HOH HOH A . C 3 HOH 95 395 75 HOH HOH A . C 3 HOH 96 396 82 HOH HOH A . C 3 HOH 97 397 16 HOH HOH A . C 3 HOH 98 398 71 HOH HOH A . C 3 HOH 99 399 108 HOH HOH A . C 3 HOH 100 400 96 HOH HOH A . C 3 HOH 101 401 90 HOH HOH A . C 3 HOH 102 402 117 HOH HOH A . C 3 HOH 103 403 97 HOH HOH A . C 3 HOH 104 404 118 HOH HOH A . C 3 HOH 105 405 99 HOH HOH A . C 3 HOH 106 406 92 HOH HOH A . C 3 HOH 107 407 64 HOH HOH A . C 3 HOH 108 408 129 HOH HOH A . C 3 HOH 109 409 51 HOH HOH A . C 3 HOH 110 410 50 HOH HOH A . C 3 HOH 111 411 104 HOH HOH A . C 3 HOH 112 412 47 HOH HOH A . C 3 HOH 113 413 101 HOH HOH A . C 3 HOH 114 414 83 HOH HOH A . C 3 HOH 115 415 121 HOH HOH A . C 3 HOH 116 416 52 HOH HOH A . C 3 HOH 117 417 119 HOH HOH A . C 3 HOH 118 418 94 HOH HOH A . C 3 HOH 119 419 128 HOH HOH A . C 3 HOH 120 420 103 HOH HOH A . C 3 HOH 121 421 89 HOH HOH A . C 3 HOH 122 422 102 HOH HOH A . C 3 HOH 123 423 69 HOH HOH A . C 3 HOH 124 424 116 HOH HOH A . C 3 HOH 125 425 122 HOH HOH A . C 3 HOH 126 426 87 HOH HOH A . C 3 HOH 127 427 93 HOH HOH A . C 3 HOH 128 428 114 HOH HOH A . C 3 HOH 129 429 115 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-04-17 2 'Structure model' 1 1 2019-05-01 3 'Structure model' 1 2 2019-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_id_ISSN' 3 2 'Structure model' '_citation.title' 4 2 'Structure model' '_citation_author.identifier_ORCID' 5 2 'Structure model' '_citation_author.name' 6 3 'Structure model' '_citation.journal_volume' 7 3 'Structure model' '_citation.page_first' 8 3 'Structure model' '_citation.page_last' 9 3 'Structure model' '_citation_author.identifier_ORCID' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.14_3260: ???)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? AutoPROC ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 109 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 301 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.17 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id GLN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 81 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -140.82 _pdbx_validate_torsion.psi 51.40 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -19 ? A GLY 1 2 1 Y 1 A SER -18 ? A SER 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A HIS -16 ? A HIS 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A SER -10 ? A SER 10 11 1 Y 1 A SER -9 ? A SER 11 12 1 Y 1 A GLY -8 ? A GLY 12 13 1 Y 1 A LEU -7 ? A LEU 13 14 1 Y 1 A VAL -6 ? A VAL 14 15 1 Y 1 A PRO -5 ? A PRO 15 16 1 Y 1 A ARG -4 ? A ARG 16 17 1 Y 1 A GLY -3 ? A GLY 17 18 1 Y 1 A SER -2 ? A SER 18 19 1 Y 1 A HIS -1 ? A HIS 19 20 1 Y 1 A MET 0 ? A MET 20 21 1 Y 1 A LYS 1 ? A LYS 21 22 1 Y 1 A VAL 2 ? A VAL 22 23 1 Y 1 A GLU 3 ? A GLU 23 24 1 Y 1 A GLN 4 ? A GLN 24 25 1 Y 1 A ALA 5 ? A ALA 25 26 1 Y 1 A VAL 6 ? A VAL 26 27 1 Y 1 A GLU 7 ? A GLU 27 28 1 Y 1 A THR 8 ? A THR 28 29 1 Y 1 A GLU 9 ? A GLU 29 30 1 Y 1 A PRO 10 ? A PRO 30 31 1 Y 1 A GLU 11 ? A GLU 31 32 1 Y 1 A PRO 12 ? A PRO 32 33 1 Y 1 A GLU 13 ? A GLU 33 34 1 Y 1 A LEU 14 ? A LEU 34 35 1 Y 1 A ARG 15 ? A ARG 35 36 1 Y 1 A GLN 16 ? A GLN 36 37 1 Y 1 A GLN 17 ? A GLN 37 38 1 Y 1 A THR 18 ? A THR 38 39 1 Y 1 A GLU 19 ? A GLU 39 40 1 Y 1 A TRP 20 ? A TRP 40 41 1 Y 1 A GLN 21 ? A GLN 41 42 1 Y 1 A SER 22 ? A SER 42 43 1 Y 1 A GLY 23 ? A GLY 43 44 1 Y 1 A GLY 165 ? A GLY 185 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id KJM _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id KJM _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '1-(3-chlorophenyl)cyclobutane-1-carboximidamide' KJM 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #