data_6NFW # _entry.id 6NFW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6NFW pdb_00006nfw 10.2210/pdb6nfw/pdb WWPDB D_1000238693 ? ? BMRB 27506 ? 10.13018/BMR27506 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-11-06 2 'Structure model' 1 1 2019-11-13 3 'Structure model' 1 2 2019-11-27 4 'Structure model' 1 3 2019-12-11 5 'Structure model' 1 4 2019-12-18 6 'Structure model' 1 5 2023-06-14 7 'Structure model' 1 6 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Author supporting evidence' 5 6 'Structure model' 'Database references' 6 6 'Structure model' Other 7 7 'Structure model' 'Data collection' 8 7 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' citation 6 5 'Structure model' pdbx_audit_support 7 6 'Structure model' database_2 8 6 'Structure model' pdbx_database_status 9 7 'Structure model' chem_comp_atom 10 7 'Structure model' chem_comp_bond 11 7 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_DOI' 2 2 'Structure model' '_citation.title' 3 3 'Structure model' '_citation.pdbx_database_id_PubMed' 4 3 'Structure model' '_citation.title' 5 3 'Structure model' '_citation_author.name' 6 4 'Structure model' '_citation.journal_volume' 7 4 'Structure model' '_citation.page_first' 8 4 'Structure model' '_citation.page_last' 9 5 'Structure model' '_pdbx_audit_support.funding_organization' 10 6 'Structure model' '_database_2.pdbx_DOI' 11 6 'Structure model' '_database_2.pdbx_database_accession' 12 6 'Structure model' '_pdbx_database_status.status_code_nmr_data' 13 7 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6NFW _pdbx_database_status.recvd_initial_deposition_date 2018-12-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 27506 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Borden, K.' 1 0000-0003-2188-5074 'Volpon, L.' 2 0000-0002-7895-8863 'Osborne, M.' 3 0000-0003-1028-4038 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 116 _citation.language ? _citation.page_first 24056 _citation.page_last 24065 _citation.title 'Structural studies of the eIF4E-VPg complex reveal a direct competition for capped RNA: Implications for translation.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1904752116 _citation.pdbx_database_id_PubMed 31712417 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Coutinho de Oliveira, L.' 1 ? primary 'Volpon, L.' 2 ? primary 'Rahardjo, A.K.' 3 ? primary 'Osborne, M.J.' 4 ? primary 'Culjkovic-Kraljacic, B.' 5 ? primary 'Trahan, C.' 6 ? primary 'Oeffinger, M.' 7 ? primary 'Kwok, B.H.' 8 ? primary 'Borden, K.L.B.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description VPg _entity.formula_weight 21657.426 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GKNKSKRIQALKFRHARDKRAGFEIDNNDDTIEEFFGSAYRKKGKGKGTTVGMGKSSRRFINMYGFDPTEYSFIQFVDPL TGAQIEENVYADIRDIQERFSEVRKKMVENDDIEMQALGSNTTIHAYFRKDWSDKALKIDLMPHNPLKVCDKTNGIAKFP ERELELRQTGPAVEVDVKDIPAQEVEHE ; _entity_poly.pdbx_seq_one_letter_code_can ;GKNKSKRIQALKFRHARDKRAGFEIDNNDDTIEEFFGSAYRKKGKGKGTTVGMGKSSRRFINMYGFDPTEYSFIQFVDPL TGAQIEENVYADIRDIQERFSEVRKKMVENDDIEMQALGSNTTIHAYFRKDWSDKALKIDLMPHNPLKVCDKTNGIAKFP ERELELRQTGPAVEVDVKDIPAQEVEHE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 LYS n 1 3 ASN n 1 4 LYS n 1 5 SER n 1 6 LYS n 1 7 ARG n 1 8 ILE n 1 9 GLN n 1 10 ALA n 1 11 LEU n 1 12 LYS n 1 13 PHE n 1 14 ARG n 1 15 HIS n 1 16 ALA n 1 17 ARG n 1 18 ASP n 1 19 LYS n 1 20 ARG n 1 21 ALA n 1 22 GLY n 1 23 PHE n 1 24 GLU n 1 25 ILE n 1 26 ASP n 1 27 ASN n 1 28 ASN n 1 29 ASP n 1 30 ASP n 1 31 THR n 1 32 ILE n 1 33 GLU n 1 34 GLU n 1 35 PHE n 1 36 PHE n 1 37 GLY n 1 38 SER n 1 39 ALA n 1 40 TYR n 1 41 ARG n 1 42 LYS n 1 43 LYS n 1 44 GLY n 1 45 LYS n 1 46 GLY n 1 47 LYS n 1 48 GLY n 1 49 THR n 1 50 THR n 1 51 VAL n 1 52 GLY n 1 53 MET n 1 54 GLY n 1 55 LYS n 1 56 SER n 1 57 SER n 1 58 ARG n 1 59 ARG n 1 60 PHE n 1 61 ILE n 1 62 ASN n 1 63 MET n 1 64 TYR n 1 65 GLY n 1 66 PHE n 1 67 ASP n 1 68 PRO n 1 69 THR n 1 70 GLU n 1 71 TYR n 1 72 SER n 1 73 PHE n 1 74 ILE n 1 75 GLN n 1 76 PHE n 1 77 VAL n 1 78 ASP n 1 79 PRO n 1 80 LEU n 1 81 THR n 1 82 GLY n 1 83 ALA n 1 84 GLN n 1 85 ILE n 1 86 GLU n 1 87 GLU n 1 88 ASN n 1 89 VAL n 1 90 TYR n 1 91 ALA n 1 92 ASP n 1 93 ILE n 1 94 ARG n 1 95 ASP n 1 96 ILE n 1 97 GLN n 1 98 GLU n 1 99 ARG n 1 100 PHE n 1 101 SER n 1 102 GLU n 1 103 VAL n 1 104 ARG n 1 105 LYS n 1 106 LYS n 1 107 MET n 1 108 VAL n 1 109 GLU n 1 110 ASN n 1 111 ASP n 1 112 ASP n 1 113 ILE n 1 114 GLU n 1 115 MET n 1 116 GLN n 1 117 ALA n 1 118 LEU n 1 119 GLY n 1 120 SER n 1 121 ASN n 1 122 THR n 1 123 THR n 1 124 ILE n 1 125 HIS n 1 126 ALA n 1 127 TYR n 1 128 PHE n 1 129 ARG n 1 130 LYS n 1 131 ASP n 1 132 TRP n 1 133 SER n 1 134 ASP n 1 135 LYS n 1 136 ALA n 1 137 LEU n 1 138 LYS n 1 139 ILE n 1 140 ASP n 1 141 LEU n 1 142 MET n 1 143 PRO n 1 144 HIS n 1 145 ASN n 1 146 PRO n 1 147 LEU n 1 148 LYS n 1 149 VAL n 1 150 CYS n 1 151 ASP n 1 152 LYS n 1 153 THR n 1 154 ASN n 1 155 GLY n 1 156 ILE n 1 157 ALA n 1 158 LYS n 1 159 PHE n 1 160 PRO n 1 161 GLU n 1 162 ARG n 1 163 GLU n 1 164 LEU n 1 165 GLU n 1 166 LEU n 1 167 ARG n 1 168 GLN n 1 169 THR n 1 170 GLY n 1 171 PRO n 1 172 ALA n 1 173 VAL n 1 174 GLU n 1 175 VAL n 1 176 ASP n 1 177 VAL n 1 178 LYS n 1 179 ASP n 1 180 ILE n 1 181 PRO n 1 182 ALA n 1 183 GLN n 1 184 GLU n 1 185 VAL n 1 186 GLU n 1 187 HIS n 1 188 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 188 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Potato virus Y' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 12216 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 LYS 2 2 ? ? ? A . n A 1 3 ASN 3 3 ? ? ? A . n A 1 4 LYS 4 4 ? ? ? A . n A 1 5 SER 5 5 ? ? ? A . n A 1 6 LYS 6 6 ? ? ? A . n A 1 7 ARG 7 7 ? ? ? A . n A 1 8 ILE 8 8 ? ? ? A . n A 1 9 GLN 9 9 ? ? ? A . n A 1 10 ALA 10 10 ? ? ? A . n A 1 11 LEU 11 11 ? ? ? A . n A 1 12 LYS 12 12 ? ? ? A . n A 1 13 PHE 13 13 ? ? ? A . n A 1 14 ARG 14 14 ? ? ? A . n A 1 15 HIS 15 15 ? ? ? A . n A 1 16 ALA 16 16 ? ? ? A . n A 1 17 ARG 17 17 ? ? ? A . n A 1 18 ASP 18 18 ? ? ? A . n A 1 19 LYS 19 19 ? ? ? A . n A 1 20 ARG 20 20 ? ? ? A . n A 1 21 ALA 21 21 ? ? ? A . n A 1 22 GLY 22 22 ? ? ? A . n A 1 23 PHE 23 23 ? ? ? A . n A 1 24 GLU 24 24 ? ? ? A . n A 1 25 ILE 25 25 ? ? ? A . n A 1 26 ASP 26 26 ? ? ? A . n A 1 27 ASN 27 27 ? ? ? A . n A 1 28 ASN 28 28 ? ? ? A . n A 1 29 ASP 29 29 ? ? ? A . n A 1 30 ASP 30 30 ? ? ? A . n A 1 31 THR 31 31 ? ? ? A . n A 1 32 ILE 32 32 ? ? ? A . n A 1 33 GLU 33 33 ? ? ? A . n A 1 34 GLU 34 34 ? ? ? A . n A 1 35 PHE 35 35 ? ? ? A . n A 1 36 PHE 36 36 ? ? ? A . n A 1 37 GLY 37 37 ? ? ? A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 MET 53 53 53 MET MET A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 MET 63 63 63 MET MET A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 MET 107 107 107 MET MET A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 ASN 110 110 110 ASN ASN A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 MET 115 115 115 MET MET A . n A 1 116 GLN 116 116 116 GLN GLN A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 ASN 121 121 121 ASN ASN A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 HIS 125 125 125 HIS HIS A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 TYR 127 127 127 TYR TYR A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 ARG 129 129 129 ARG ARG A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 TRP 132 132 132 TRP TRP A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 MET 142 142 142 MET MET A . n A 1 143 PRO 143 143 143 PRO PRO A . n A 1 144 HIS 144 144 144 HIS HIS A . n A 1 145 ASN 145 145 145 ASN ASN A . n A 1 146 PRO 146 146 146 PRO PRO A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 LYS 148 148 148 LYS LYS A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 CYS 150 150 150 CYS CYS A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 THR 153 153 153 THR THR A . n A 1 154 ASN 154 154 154 ASN ASN A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 PHE 159 159 159 PHE PHE A . n A 1 160 PRO 160 160 160 PRO PRO A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 ARG 162 162 162 ARG ARG A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 GLU 165 165 165 GLU GLU A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 ARG 167 167 167 ARG ARG A . n A 1 168 GLN 168 168 168 GLN GLN A . n A 1 169 THR 169 169 169 THR THR A . n A 1 170 GLY 170 170 170 GLY GLY A . n A 1 171 PRO 171 171 171 PRO PRO A . n A 1 172 ALA 172 172 172 ALA ALA A . n A 1 173 VAL 173 173 173 VAL VAL A . n A 1 174 GLU 174 174 174 GLU GLU A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 ASP 176 176 176 ASP ASP A . n A 1 177 VAL 177 177 177 VAL VAL A . n A 1 178 LYS 178 178 178 LYS LYS A . n A 1 179 ASP 179 179 179 ASP ASP A . n A 1 180 ILE 180 180 180 ILE ILE A . n A 1 181 PRO 181 181 181 PRO PRO A . n A 1 182 ALA 182 182 182 ALA ALA A . n A 1 183 GLN 183 183 183 GLN GLN A . n A 1 184 GLU 184 184 184 GLU GLU A . n A 1 185 VAL 185 185 185 VAL VAL A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 HIS 187 187 187 HIS HIS A . n A 1 188 GLU 188 188 188 GLU GLU A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6NFW _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6NFW _struct.title 'Potyvirus viral protein genome linked (VPg) emulates the m7G cap to recruit the eukaryotic translation initiation factor eIF4E' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6NFW _struct_keywords.text 'Potyvirus, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A6YPB3_9POTV _struct_ref.pdbx_db_accession A6YPB3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GKNKSKRIQALKFRHARDKRAGFEIDNNDDTIEEFFGSAYRKKGKGKGTTVGMGKSSRRFINMYGFDPTEYSFIQFVDPL TGAQIEENVYADIRDIQERFSEVRKKMVENDDIEMQALGSNTTIHAYFRKDWSDKALKIDLMPHNPLKICDKTNGIAKFP ERELELRQTGPAVEVDVKDIPAQEV ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6NFW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 185 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A6YPB3 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 185 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 185 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6NFW VAL A 149 ? UNP A6YPB3 ILE 149 conflict 149 1 1 6NFW GLU A 186 ? UNP A6YPB3 ? ? 'expression tag' 186 2 1 6NFW HIS A 187 ? UNP A6YPB3 ? ? 'expression tag' 187 3 1 6NFW GLU A 188 ? UNP A6YPB3 ? ? 'expression tag' 188 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 15800 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 92 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASP _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 111 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 92 _struct_conf.end_auth_comp_id ASP _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 111 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 85 ? GLU A 87 ? ILE A 85 GLU A 87 AA1 2 ILE A 74 ? VAL A 77 ? ILE A 74 VAL A 77 AA1 3 ILE A 124 ? ARG A 129 ? ILE A 124 ARG A 129 AA1 4 LYS A 135 ? LEU A 141 ? LYS A 135 LEU A 141 AA1 5 VAL A 173 ? ASP A 176 ? VAL A 173 ASP A 176 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 85 ? O ILE A 85 N PHE A 76 ? N PHE A 76 AA1 2 3 N GLN A 75 ? N GLN A 75 O TYR A 127 ? O TYR A 127 AA1 3 4 N ILE A 124 ? N ILE A 124 O LEU A 141 ? O LEU A 141 AA1 4 5 N ALA A 136 ? N ALA A 136 O VAL A 175 ? O VAL A 175 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 42 ? ? -116.18 77.86 2 1 LYS A 45 ? ? 39.45 41.58 3 1 ASP A 67 ? ? -114.38 72.57 4 1 PRO A 68 ? ? -69.79 98.56 5 1 LEU A 80 ? ? -50.28 -75.99 6 1 THR A 81 ? ? -97.31 -68.97 7 1 ASP A 111 ? ? 64.45 80.47 8 1 MET A 115 ? ? -140.87 15.04 9 1 THR A 122 ? ? -152.03 -59.32 10 1 HIS A 144 ? ? -103.33 49.52 11 1 ASP A 151 ? ? -175.45 138.69 12 1 ALA A 157 ? ? -100.32 40.05 13 1 PRO A 160 ? ? -69.70 82.59 14 1 LEU A 164 ? ? -55.37 102.17 15 1 PRO A 181 ? ? -69.79 78.93 16 2 ASP A 67 ? ? -177.70 72.82 17 2 LEU A 80 ? ? -48.88 -70.25 18 2 ASP A 111 ? ? 65.04 68.78 19 2 SER A 120 ? ? -105.76 -169.69 20 2 LYS A 130 ? ? 58.05 81.86 21 2 TRP A 132 ? ? -135.04 -65.00 22 2 ASN A 145 ? ? -177.11 69.56 23 2 PHE A 159 ? ? -152.13 70.72 24 2 GLU A 165 ? ? -94.87 -74.36 25 2 THR A 169 ? ? -94.81 35.42 26 2 PRO A 171 ? ? -69.78 -171.60 27 2 PRO A 181 ? ? -69.71 78.49 28 3 LYS A 47 ? ? -54.98 107.68 29 3 LYS A 55 ? ? -96.25 49.96 30 3 ASN A 62 ? ? -175.06 115.38 31 3 ASP A 67 ? ? -179.11 72.73 32 3 THR A 69 ? ? -99.40 -73.63 33 3 SER A 72 ? ? -177.64 112.62 34 3 ASP A 111 ? ? 63.84 74.38 35 3 ASP A 112 ? ? -141.60 -42.21 36 3 GLU A 114 ? ? -133.74 -40.34 37 3 MET A 115 ? ? -151.20 25.23 38 3 SER A 120 ? ? -96.15 -68.29 39 3 THR A 122 ? ? -143.00 -42.04 40 3 ASP A 134 ? ? -105.25 76.53 41 3 PRO A 143 ? ? -69.74 92.07 42 3 ASN A 145 ? ? 179.74 -60.98 43 3 VAL A 149 ? ? -175.94 146.60 44 3 LYS A 152 ? ? -102.69 -72.86 45 3 PHE A 159 ? ? 62.43 73.22 46 3 PRO A 160 ? ? -69.70 -171.25 47 3 GLU A 165 ? ? -70.48 -73.53 48 3 THR A 169 ? ? -59.92 100.29 49 3 PRO A 181 ? ? -69.83 78.59 50 3 GLU A 184 ? ? -51.66 106.46 51 4 ALA A 39 ? ? -174.76 -177.26 52 4 THR A 69 ? ? -52.04 170.20 53 4 GLU A 70 ? ? -56.33 170.74 54 4 TYR A 71 ? ? -100.30 -63.88 55 4 LEU A 80 ? ? -50.44 -74.80 56 4 THR A 81 ? ? -97.62 -67.58 57 4 ASP A 111 ? ? 65.12 69.50 58 4 ASN A 121 ? ? -57.00 107.11 59 4 THR A 122 ? ? -144.15 -41.23 60 4 ASP A 131 ? ? -52.08 102.65 61 4 SER A 133 ? ? 66.18 87.28 62 4 ASP A 134 ? ? -167.88 -80.81 63 4 PRO A 146 ? ? -69.89 -174.97 64 4 ASP A 151 ? ? -59.24 109.81 65 4 PRO A 181 ? ? -69.71 81.83 66 5 ARG A 59 ? ? -175.29 111.46 67 5 MET A 63 ? ? -172.68 145.74 68 5 ASP A 111 ? ? 65.50 69.28 69 5 ASP A 112 ? ? -135.15 -42.11 70 5 GLU A 114 ? ? -125.84 -59.27 71 5 MET A 115 ? ? -140.81 28.56 72 5 SER A 120 ? ? -128.74 -169.80 73 5 LYS A 130 ? ? -36.47 108.61 74 5 PRO A 143 ? ? -69.80 78.73 75 5 ASN A 145 ? ? -174.03 68.30 76 5 PRO A 160 ? ? -69.80 87.83 77 5 PRO A 171 ? ? -69.69 -170.81 78 5 PRO A 181 ? ? -69.78 82.05 79 6 ALA A 39 ? ? -174.42 119.38 80 6 LYS A 43 ? ? -56.28 -71.85 81 6 LYS A 45 ? ? -172.88 145.63 82 6 TYR A 90 ? ? -94.51 37.18 83 6 ASP A 111 ? ? 60.15 62.24 84 6 GLU A 114 ? ? -141.04 -39.12 85 6 LYS A 130 ? ? -58.77 -173.23 86 6 SER A 133 ? ? -61.98 -162.37 87 6 PRO A 143 ? ? -69.70 -174.79 88 6 ASN A 145 ? ? -174.31 68.69 89 6 CYS A 150 ? ? -59.97 175.95 90 6 ALA A 157 ? ? -177.32 140.77 91 6 LYS A 158 ? ? -103.49 59.17 92 6 PHE A 159 ? ? 61.42 160.80 93 6 PRO A 181 ? ? -69.66 82.44 94 7 SER A 72 ? ? -178.44 109.97 95 7 LEU A 80 ? ? -48.53 -71.78 96 7 ASN A 88 ? ? -107.66 -168.59 97 7 TYR A 90 ? ? -95.13 34.03 98 7 ASP A 111 ? ? 66.88 75.43 99 7 GLU A 114 ? ? -128.02 -57.65 100 7 THR A 122 ? ? -156.25 -69.63 101 7 LYS A 130 ? ? 38.93 45.02 102 7 SER A 133 ? ? -112.42 -169.82 103 7 PRO A 143 ? ? -69.82 -172.89 104 7 ASN A 145 ? ? -165.55 68.97 105 7 ILE A 156 ? ? -50.91 170.91 106 7 LEU A 164 ? ? -174.64 146.74 107 7 GLU A 165 ? ? -131.21 -73.00 108 7 PRO A 181 ? ? -69.72 78.57 109 7 GLN A 183 ? ? -109.67 58.00 110 8 LYS A 55 ? ? -128.37 -74.12 111 8 SER A 57 ? ? -173.29 129.70 112 8 ARG A 58 ? ? -174.59 149.27 113 8 PRO A 68 ? ? -69.75 -179.11 114 8 SER A 72 ? ? -111.83 54.90 115 8 LEU A 80 ? ? -49.03 -71.43 116 8 ASP A 111 ? ? 63.58 63.56 117 8 GLU A 114 ? ? -125.16 -54.44 118 8 ASN A 121 ? ? -51.50 108.46 119 8 THR A 122 ? ? -140.73 -55.42 120 8 PRO A 143 ? ? -69.85 -172.83 121 8 ASN A 145 ? ? -43.16 104.17 122 8 CYS A 150 ? ? -117.71 -74.70 123 8 ASP A 151 ? ? -173.56 -177.59 124 8 LYS A 158 ? ? -96.09 36.15 125 8 PRO A 160 ? ? -69.71 81.91 126 8 GLU A 161 ? ? -173.62 120.68 127 8 GLU A 165 ? ? -124.81 -73.25 128 8 THR A 169 ? ? -104.50 -74.09 129 8 PRO A 181 ? ? -69.81 83.66 130 9 ARG A 59 ? ? -177.25 134.58 131 9 ASN A 62 ? ? -174.26 133.01 132 9 MET A 63 ? ? -175.08 119.45 133 9 ASP A 67 ? ? -174.31 73.46 134 9 GLU A 114 ? ? -140.71 -46.41 135 9 LYS A 130 ? ? -49.92 167.85 136 9 TRP A 132 ? ? -140.59 -40.88 137 9 ASP A 134 ? ? -114.03 78.68 138 9 ASN A 145 ? ? -170.18 72.73 139 9 PRO A 160 ? ? -69.78 -174.50 140 9 LEU A 164 ? ? -174.33 110.20 141 9 GLU A 165 ? ? -179.38 144.72 142 9 PRO A 171 ? ? -69.75 -170.95 143 9 ILE A 180 ? ? -50.17 108.47 144 9 PRO A 181 ? ? -69.64 87.05 145 10 LYS A 42 ? ? -171.83 145.39 146 10 LYS A 45 ? ? 53.79 83.02 147 10 SER A 57 ? ? -77.04 -70.78 148 10 ARG A 58 ? ? -172.14 119.08 149 10 PRO A 68 ? ? -69.82 -174.23 150 10 LEU A 80 ? ? -50.18 -70.92 151 10 ASN A 88 ? ? -124.90 -169.43 152 10 ASP A 111 ? ? 61.27 65.92 153 10 GLU A 114 ? ? -130.38 -39.77 154 10 MET A 115 ? ? -141.97 12.94 155 10 THR A 122 ? ? -138.41 -47.00 156 10 LYS A 130 ? ? -50.94 173.71 157 10 ASP A 134 ? ? -107.57 -84.31 158 10 ASN A 145 ? ? -173.20 67.96 159 10 LYS A 148 ? ? 52.14 88.44 160 10 VAL A 149 ? ? -136.56 -51.86 161 10 LYS A 158 ? ? -97.39 41.52 162 10 PRO A 171 ? ? -69.91 -171.15 163 10 PRO A 181 ? ? -69.80 84.65 164 10 VAL A 185 ? ? -56.58 109.87 # _pdbx_nmr_ensemble.entry_id 6NFW _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6NFW _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 ;450 uM [U-13C; U-15N] PVY-VPg, 50 mM sodium phosphate, 150 mM sodium chloride, 1 mM DTT, 0.02 % v/v sodium azide, 100 uM DSS, 93% H2O/7% D2O ; '93% H2O/7% D2O' '15N13C PVY-VPg - H2O' solution ? 2 ;450 uM [U-13C; U-15N] PVY-VPg, 50 mM sodium phosphate, 150 mM sodium chloride, 1 mM DTT, 0.02 % v/v sodium azide, 100 uM DSS, 100% D2O ; '100% D2O' '15N13C PVY-VPg - D2O' solution ? 3 ;450 uM ILV labeled PVY-VPg, 50 mM sodium phosphate, 150 mM sodium chloride, 1 mM DTT, 0.02 % v/v sodium azide, 100 uM DSS, 93% H2O/10% D2O ; '93% H2O/10% D2O' 'ILV PVY-VPg - H2O' solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 PVY-VPg 450 ? uM '[U-13C; U-15N]' 1 'sodium phosphate' 50 ? mM 'natural abundance' 1 'sodium chloride' 150 ? mM 'natural abundance' 1 DTT 1 ? mM 'natural abundance' 1 'sodium azide' 0.02 ? '% v/v' 'natural abundance' 1 DSS 100 ? uM 'natural abundance' 2 PVY-VPg 450 ? uM '[U-13C; U-15N]' 2 'sodium phosphate' 50 ? mM 'natural abundance' 2 'sodium chloride' 150 ? mM 'natural abundance' 2 DTT 1 ? mM 'natural abundance' 2 'sodium azide' 0.02 ? '% v/v' 'natural abundance' 2 DSS 100 ? uM 'natural abundance' 3 PVY-VPg 450 ? uM 'ILV labeled' 3 'sodium phosphate' 50 ? mM 'natural abundance' 3 'sodium chloride' 150 ? mM 'natural abundance' 3 DTT 1 ? mM 'natural abundance' 3 'sodium azide' 0.02 ? '% v/v' 'natural abundance' 3 DSS 100 ? uM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition-1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 7 1 1 '2D 1H-15N HSQC' 1 anisotropic 6 1 2 '2D 1H-13C HSQC' 1 anisotropic 8 1 3 '2D 1H-13C HSQC' 1 anisotropic 1 1 1 '3D 1H-15N NOESY' 2 anisotropic 2 1 1 '3D 1H-13C NOESY' 2 anisotropic 3 1 2 '3D 1H-13C NOESY' 2 anisotropic 4 1 3 '4D methyl-methyl 13C-resolved HMQC-NOESY-HMQC' 2 anisotropic 5 1 2 '3D 1H-13C NOESY aromatic' 2 anisotropic # _pdbx_nmr_refine.entry_id 6NFW _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CYANA 3.98 'Guntert, Mumenthaler and Wuthrich' 2 'structure calculation' CYANA 3.98 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' Sparky ? Goddard 4 'peak picking' Sparky ? Goddard # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A LYS 2 ? A LYS 2 3 1 Y 1 A ASN 3 ? A ASN 3 4 1 Y 1 A LYS 4 ? A LYS 4 5 1 Y 1 A SER 5 ? A SER 5 6 1 Y 1 A LYS 6 ? A LYS 6 7 1 Y 1 A ARG 7 ? A ARG 7 8 1 Y 1 A ILE 8 ? A ILE 8 9 1 Y 1 A GLN 9 ? A GLN 9 10 1 Y 1 A ALA 10 ? A ALA 10 11 1 Y 1 A LEU 11 ? A LEU 11 12 1 Y 1 A LYS 12 ? A LYS 12 13 1 Y 1 A PHE 13 ? A PHE 13 14 1 Y 1 A ARG 14 ? A ARG 14 15 1 Y 1 A HIS 15 ? A HIS 15 16 1 Y 1 A ALA 16 ? A ALA 16 17 1 Y 1 A ARG 17 ? A ARG 17 18 1 Y 1 A ASP 18 ? A ASP 18 19 1 Y 1 A LYS 19 ? A LYS 19 20 1 Y 1 A ARG 20 ? A ARG 20 21 1 Y 1 A ALA 21 ? A ALA 21 22 1 Y 1 A GLY 22 ? A GLY 22 23 1 Y 1 A PHE 23 ? A PHE 23 24 1 Y 1 A GLU 24 ? A GLU 24 25 1 Y 1 A ILE 25 ? A ILE 25 26 1 Y 1 A ASP 26 ? A ASP 26 27 1 Y 1 A ASN 27 ? A ASN 27 28 1 Y 1 A ASN 28 ? A ASN 28 29 1 Y 1 A ASP 29 ? A ASP 29 30 1 Y 1 A ASP 30 ? A ASP 30 31 1 Y 1 A THR 31 ? A THR 31 32 1 Y 1 A ILE 32 ? A ILE 32 33 1 Y 1 A GLU 33 ? A GLU 33 34 1 Y 1 A GLU 34 ? A GLU 34 35 1 Y 1 A PHE 35 ? A PHE 35 36 1 Y 1 A PHE 36 ? A PHE 36 37 1 Y 1 A GLY 37 ? A GLY 37 38 2 Y 1 A GLY 1 ? A GLY 1 39 2 Y 1 A LYS 2 ? A LYS 2 40 2 Y 1 A ASN 3 ? A ASN 3 41 2 Y 1 A LYS 4 ? A LYS 4 42 2 Y 1 A SER 5 ? A SER 5 43 2 Y 1 A LYS 6 ? A LYS 6 44 2 Y 1 A ARG 7 ? A ARG 7 45 2 Y 1 A ILE 8 ? A ILE 8 46 2 Y 1 A GLN 9 ? A GLN 9 47 2 Y 1 A ALA 10 ? A ALA 10 48 2 Y 1 A LEU 11 ? A LEU 11 49 2 Y 1 A LYS 12 ? A LYS 12 50 2 Y 1 A PHE 13 ? A PHE 13 51 2 Y 1 A ARG 14 ? A ARG 14 52 2 Y 1 A HIS 15 ? A HIS 15 53 2 Y 1 A ALA 16 ? A ALA 16 54 2 Y 1 A ARG 17 ? A ARG 17 55 2 Y 1 A ASP 18 ? A ASP 18 56 2 Y 1 A LYS 19 ? A LYS 19 57 2 Y 1 A ARG 20 ? A ARG 20 58 2 Y 1 A ALA 21 ? A ALA 21 59 2 Y 1 A GLY 22 ? A GLY 22 60 2 Y 1 A PHE 23 ? A PHE 23 61 2 Y 1 A GLU 24 ? A GLU 24 62 2 Y 1 A ILE 25 ? A ILE 25 63 2 Y 1 A ASP 26 ? A ASP 26 64 2 Y 1 A ASN 27 ? A ASN 27 65 2 Y 1 A ASN 28 ? A ASN 28 66 2 Y 1 A ASP 29 ? A ASP 29 67 2 Y 1 A ASP 30 ? A ASP 30 68 2 Y 1 A THR 31 ? A THR 31 69 2 Y 1 A ILE 32 ? A ILE 32 70 2 Y 1 A GLU 33 ? A GLU 33 71 2 Y 1 A GLU 34 ? A GLU 34 72 2 Y 1 A PHE 35 ? A PHE 35 73 2 Y 1 A PHE 36 ? A PHE 36 74 2 Y 1 A GLY 37 ? A GLY 37 75 3 Y 1 A GLY 1 ? A GLY 1 76 3 Y 1 A LYS 2 ? A LYS 2 77 3 Y 1 A ASN 3 ? A ASN 3 78 3 Y 1 A LYS 4 ? A LYS 4 79 3 Y 1 A SER 5 ? A SER 5 80 3 Y 1 A LYS 6 ? A LYS 6 81 3 Y 1 A ARG 7 ? A ARG 7 82 3 Y 1 A ILE 8 ? A ILE 8 83 3 Y 1 A GLN 9 ? A GLN 9 84 3 Y 1 A ALA 10 ? A ALA 10 85 3 Y 1 A LEU 11 ? A LEU 11 86 3 Y 1 A LYS 12 ? A LYS 12 87 3 Y 1 A PHE 13 ? A PHE 13 88 3 Y 1 A ARG 14 ? A ARG 14 89 3 Y 1 A HIS 15 ? A HIS 15 90 3 Y 1 A ALA 16 ? A ALA 16 91 3 Y 1 A ARG 17 ? A ARG 17 92 3 Y 1 A ASP 18 ? A ASP 18 93 3 Y 1 A LYS 19 ? A LYS 19 94 3 Y 1 A ARG 20 ? A ARG 20 95 3 Y 1 A ALA 21 ? A ALA 21 96 3 Y 1 A GLY 22 ? A GLY 22 97 3 Y 1 A PHE 23 ? A PHE 23 98 3 Y 1 A GLU 24 ? A GLU 24 99 3 Y 1 A ILE 25 ? A ILE 25 100 3 Y 1 A ASP 26 ? A ASP 26 101 3 Y 1 A ASN 27 ? A ASN 27 102 3 Y 1 A ASN 28 ? A ASN 28 103 3 Y 1 A ASP 29 ? A ASP 29 104 3 Y 1 A ASP 30 ? A ASP 30 105 3 Y 1 A THR 31 ? A THR 31 106 3 Y 1 A ILE 32 ? A ILE 32 107 3 Y 1 A GLU 33 ? A GLU 33 108 3 Y 1 A GLU 34 ? A GLU 34 109 3 Y 1 A PHE 35 ? A PHE 35 110 3 Y 1 A PHE 36 ? A PHE 36 111 3 Y 1 A GLY 37 ? A GLY 37 112 4 Y 1 A GLY 1 ? A GLY 1 113 4 Y 1 A LYS 2 ? A LYS 2 114 4 Y 1 A ASN 3 ? A ASN 3 115 4 Y 1 A LYS 4 ? A LYS 4 116 4 Y 1 A SER 5 ? A SER 5 117 4 Y 1 A LYS 6 ? A LYS 6 118 4 Y 1 A ARG 7 ? A ARG 7 119 4 Y 1 A ILE 8 ? A ILE 8 120 4 Y 1 A GLN 9 ? A GLN 9 121 4 Y 1 A ALA 10 ? A ALA 10 122 4 Y 1 A LEU 11 ? A LEU 11 123 4 Y 1 A LYS 12 ? A LYS 12 124 4 Y 1 A PHE 13 ? A PHE 13 125 4 Y 1 A ARG 14 ? A ARG 14 126 4 Y 1 A HIS 15 ? A HIS 15 127 4 Y 1 A ALA 16 ? A ALA 16 128 4 Y 1 A ARG 17 ? A ARG 17 129 4 Y 1 A ASP 18 ? A ASP 18 130 4 Y 1 A LYS 19 ? A LYS 19 131 4 Y 1 A ARG 20 ? A ARG 20 132 4 Y 1 A ALA 21 ? A ALA 21 133 4 Y 1 A GLY 22 ? A GLY 22 134 4 Y 1 A PHE 23 ? A PHE 23 135 4 Y 1 A GLU 24 ? A GLU 24 136 4 Y 1 A ILE 25 ? A ILE 25 137 4 Y 1 A ASP 26 ? A ASP 26 138 4 Y 1 A ASN 27 ? A ASN 27 139 4 Y 1 A ASN 28 ? A ASN 28 140 4 Y 1 A ASP 29 ? A ASP 29 141 4 Y 1 A ASP 30 ? A ASP 30 142 4 Y 1 A THR 31 ? A THR 31 143 4 Y 1 A ILE 32 ? A ILE 32 144 4 Y 1 A GLU 33 ? A GLU 33 145 4 Y 1 A GLU 34 ? A GLU 34 146 4 Y 1 A PHE 35 ? A PHE 35 147 4 Y 1 A PHE 36 ? A PHE 36 148 4 Y 1 A GLY 37 ? A GLY 37 149 5 Y 1 A GLY 1 ? A GLY 1 150 5 Y 1 A LYS 2 ? A LYS 2 151 5 Y 1 A ASN 3 ? A ASN 3 152 5 Y 1 A LYS 4 ? A LYS 4 153 5 Y 1 A SER 5 ? A SER 5 154 5 Y 1 A LYS 6 ? A LYS 6 155 5 Y 1 A ARG 7 ? A ARG 7 156 5 Y 1 A ILE 8 ? A ILE 8 157 5 Y 1 A GLN 9 ? A GLN 9 158 5 Y 1 A ALA 10 ? A ALA 10 159 5 Y 1 A LEU 11 ? A LEU 11 160 5 Y 1 A LYS 12 ? A LYS 12 161 5 Y 1 A PHE 13 ? A PHE 13 162 5 Y 1 A ARG 14 ? A ARG 14 163 5 Y 1 A HIS 15 ? A HIS 15 164 5 Y 1 A ALA 16 ? A ALA 16 165 5 Y 1 A ARG 17 ? A ARG 17 166 5 Y 1 A ASP 18 ? A ASP 18 167 5 Y 1 A LYS 19 ? A LYS 19 168 5 Y 1 A ARG 20 ? A ARG 20 169 5 Y 1 A ALA 21 ? A ALA 21 170 5 Y 1 A GLY 22 ? A GLY 22 171 5 Y 1 A PHE 23 ? A PHE 23 172 5 Y 1 A GLU 24 ? A GLU 24 173 5 Y 1 A ILE 25 ? A ILE 25 174 5 Y 1 A ASP 26 ? A ASP 26 175 5 Y 1 A ASN 27 ? A ASN 27 176 5 Y 1 A ASN 28 ? A ASN 28 177 5 Y 1 A ASP 29 ? A ASP 29 178 5 Y 1 A ASP 30 ? A ASP 30 179 5 Y 1 A THR 31 ? A THR 31 180 5 Y 1 A ILE 32 ? A ILE 32 181 5 Y 1 A GLU 33 ? A GLU 33 182 5 Y 1 A GLU 34 ? A GLU 34 183 5 Y 1 A PHE 35 ? A PHE 35 184 5 Y 1 A PHE 36 ? A PHE 36 185 5 Y 1 A GLY 37 ? A GLY 37 186 6 Y 1 A GLY 1 ? A GLY 1 187 6 Y 1 A LYS 2 ? A LYS 2 188 6 Y 1 A ASN 3 ? A ASN 3 189 6 Y 1 A LYS 4 ? A LYS 4 190 6 Y 1 A SER 5 ? A SER 5 191 6 Y 1 A LYS 6 ? A LYS 6 192 6 Y 1 A ARG 7 ? A ARG 7 193 6 Y 1 A ILE 8 ? A ILE 8 194 6 Y 1 A GLN 9 ? A GLN 9 195 6 Y 1 A ALA 10 ? A ALA 10 196 6 Y 1 A LEU 11 ? A LEU 11 197 6 Y 1 A LYS 12 ? A LYS 12 198 6 Y 1 A PHE 13 ? A PHE 13 199 6 Y 1 A ARG 14 ? A ARG 14 200 6 Y 1 A HIS 15 ? A HIS 15 201 6 Y 1 A ALA 16 ? A ALA 16 202 6 Y 1 A ARG 17 ? A ARG 17 203 6 Y 1 A ASP 18 ? A ASP 18 204 6 Y 1 A LYS 19 ? A LYS 19 205 6 Y 1 A ARG 20 ? A ARG 20 206 6 Y 1 A ALA 21 ? A ALA 21 207 6 Y 1 A GLY 22 ? A GLY 22 208 6 Y 1 A PHE 23 ? A PHE 23 209 6 Y 1 A GLU 24 ? A GLU 24 210 6 Y 1 A ILE 25 ? A ILE 25 211 6 Y 1 A ASP 26 ? A ASP 26 212 6 Y 1 A ASN 27 ? A ASN 27 213 6 Y 1 A ASN 28 ? A ASN 28 214 6 Y 1 A ASP 29 ? A ASP 29 215 6 Y 1 A ASP 30 ? A ASP 30 216 6 Y 1 A THR 31 ? A THR 31 217 6 Y 1 A ILE 32 ? A ILE 32 218 6 Y 1 A GLU 33 ? A GLU 33 219 6 Y 1 A GLU 34 ? A GLU 34 220 6 Y 1 A PHE 35 ? A PHE 35 221 6 Y 1 A PHE 36 ? A PHE 36 222 6 Y 1 A GLY 37 ? A GLY 37 223 7 Y 1 A GLY 1 ? A GLY 1 224 7 Y 1 A LYS 2 ? A LYS 2 225 7 Y 1 A ASN 3 ? A ASN 3 226 7 Y 1 A LYS 4 ? A LYS 4 227 7 Y 1 A SER 5 ? A SER 5 228 7 Y 1 A LYS 6 ? A LYS 6 229 7 Y 1 A ARG 7 ? A ARG 7 230 7 Y 1 A ILE 8 ? A ILE 8 231 7 Y 1 A GLN 9 ? A GLN 9 232 7 Y 1 A ALA 10 ? A ALA 10 233 7 Y 1 A LEU 11 ? A LEU 11 234 7 Y 1 A LYS 12 ? A LYS 12 235 7 Y 1 A PHE 13 ? A PHE 13 236 7 Y 1 A ARG 14 ? A ARG 14 237 7 Y 1 A HIS 15 ? A HIS 15 238 7 Y 1 A ALA 16 ? A ALA 16 239 7 Y 1 A ARG 17 ? A ARG 17 240 7 Y 1 A ASP 18 ? A ASP 18 241 7 Y 1 A LYS 19 ? A LYS 19 242 7 Y 1 A ARG 20 ? A ARG 20 243 7 Y 1 A ALA 21 ? A ALA 21 244 7 Y 1 A GLY 22 ? A GLY 22 245 7 Y 1 A PHE 23 ? A PHE 23 246 7 Y 1 A GLU 24 ? A GLU 24 247 7 Y 1 A ILE 25 ? A ILE 25 248 7 Y 1 A ASP 26 ? A ASP 26 249 7 Y 1 A ASN 27 ? A ASN 27 250 7 Y 1 A ASN 28 ? A ASN 28 251 7 Y 1 A ASP 29 ? A ASP 29 252 7 Y 1 A ASP 30 ? A ASP 30 253 7 Y 1 A THR 31 ? A THR 31 254 7 Y 1 A ILE 32 ? A ILE 32 255 7 Y 1 A GLU 33 ? A GLU 33 256 7 Y 1 A GLU 34 ? A GLU 34 257 7 Y 1 A PHE 35 ? A PHE 35 258 7 Y 1 A PHE 36 ? A PHE 36 259 7 Y 1 A GLY 37 ? A GLY 37 260 8 Y 1 A GLY 1 ? A GLY 1 261 8 Y 1 A LYS 2 ? A LYS 2 262 8 Y 1 A ASN 3 ? A ASN 3 263 8 Y 1 A LYS 4 ? A LYS 4 264 8 Y 1 A SER 5 ? A SER 5 265 8 Y 1 A LYS 6 ? A LYS 6 266 8 Y 1 A ARG 7 ? A ARG 7 267 8 Y 1 A ILE 8 ? A ILE 8 268 8 Y 1 A GLN 9 ? A GLN 9 269 8 Y 1 A ALA 10 ? A ALA 10 270 8 Y 1 A LEU 11 ? A LEU 11 271 8 Y 1 A LYS 12 ? A LYS 12 272 8 Y 1 A PHE 13 ? A PHE 13 273 8 Y 1 A ARG 14 ? A ARG 14 274 8 Y 1 A HIS 15 ? A HIS 15 275 8 Y 1 A ALA 16 ? A ALA 16 276 8 Y 1 A ARG 17 ? A ARG 17 277 8 Y 1 A ASP 18 ? A ASP 18 278 8 Y 1 A LYS 19 ? A LYS 19 279 8 Y 1 A ARG 20 ? A ARG 20 280 8 Y 1 A ALA 21 ? A ALA 21 281 8 Y 1 A GLY 22 ? A GLY 22 282 8 Y 1 A PHE 23 ? A PHE 23 283 8 Y 1 A GLU 24 ? A GLU 24 284 8 Y 1 A ILE 25 ? A ILE 25 285 8 Y 1 A ASP 26 ? A ASP 26 286 8 Y 1 A ASN 27 ? A ASN 27 287 8 Y 1 A ASN 28 ? A ASN 28 288 8 Y 1 A ASP 29 ? A ASP 29 289 8 Y 1 A ASP 30 ? A ASP 30 290 8 Y 1 A THR 31 ? A THR 31 291 8 Y 1 A ILE 32 ? A ILE 32 292 8 Y 1 A GLU 33 ? A GLU 33 293 8 Y 1 A GLU 34 ? A GLU 34 294 8 Y 1 A PHE 35 ? A PHE 35 295 8 Y 1 A PHE 36 ? A PHE 36 296 8 Y 1 A GLY 37 ? A GLY 37 297 9 Y 1 A GLY 1 ? A GLY 1 298 9 Y 1 A LYS 2 ? A LYS 2 299 9 Y 1 A ASN 3 ? A ASN 3 300 9 Y 1 A LYS 4 ? A LYS 4 301 9 Y 1 A SER 5 ? A SER 5 302 9 Y 1 A LYS 6 ? A LYS 6 303 9 Y 1 A ARG 7 ? A ARG 7 304 9 Y 1 A ILE 8 ? A ILE 8 305 9 Y 1 A GLN 9 ? A GLN 9 306 9 Y 1 A ALA 10 ? A ALA 10 307 9 Y 1 A LEU 11 ? A LEU 11 308 9 Y 1 A LYS 12 ? A LYS 12 309 9 Y 1 A PHE 13 ? A PHE 13 310 9 Y 1 A ARG 14 ? A ARG 14 311 9 Y 1 A HIS 15 ? A HIS 15 312 9 Y 1 A ALA 16 ? A ALA 16 313 9 Y 1 A ARG 17 ? A ARG 17 314 9 Y 1 A ASP 18 ? A ASP 18 315 9 Y 1 A LYS 19 ? A LYS 19 316 9 Y 1 A ARG 20 ? A ARG 20 317 9 Y 1 A ALA 21 ? A ALA 21 318 9 Y 1 A GLY 22 ? A GLY 22 319 9 Y 1 A PHE 23 ? A PHE 23 320 9 Y 1 A GLU 24 ? A GLU 24 321 9 Y 1 A ILE 25 ? A ILE 25 322 9 Y 1 A ASP 26 ? A ASP 26 323 9 Y 1 A ASN 27 ? A ASN 27 324 9 Y 1 A ASN 28 ? A ASN 28 325 9 Y 1 A ASP 29 ? A ASP 29 326 9 Y 1 A ASP 30 ? A ASP 30 327 9 Y 1 A THR 31 ? A THR 31 328 9 Y 1 A ILE 32 ? A ILE 32 329 9 Y 1 A GLU 33 ? A GLU 33 330 9 Y 1 A GLU 34 ? A GLU 34 331 9 Y 1 A PHE 35 ? A PHE 35 332 9 Y 1 A PHE 36 ? A PHE 36 333 9 Y 1 A GLY 37 ? A GLY 37 334 10 Y 1 A GLY 1 ? A GLY 1 335 10 Y 1 A LYS 2 ? A LYS 2 336 10 Y 1 A ASN 3 ? A ASN 3 337 10 Y 1 A LYS 4 ? A LYS 4 338 10 Y 1 A SER 5 ? A SER 5 339 10 Y 1 A LYS 6 ? A LYS 6 340 10 Y 1 A ARG 7 ? A ARG 7 341 10 Y 1 A ILE 8 ? A ILE 8 342 10 Y 1 A GLN 9 ? A GLN 9 343 10 Y 1 A ALA 10 ? A ALA 10 344 10 Y 1 A LEU 11 ? A LEU 11 345 10 Y 1 A LYS 12 ? A LYS 12 346 10 Y 1 A PHE 13 ? A PHE 13 347 10 Y 1 A ARG 14 ? A ARG 14 348 10 Y 1 A HIS 15 ? A HIS 15 349 10 Y 1 A ALA 16 ? A ALA 16 350 10 Y 1 A ARG 17 ? A ARG 17 351 10 Y 1 A ASP 18 ? A ASP 18 352 10 Y 1 A LYS 19 ? A LYS 19 353 10 Y 1 A ARG 20 ? A ARG 20 354 10 Y 1 A ALA 21 ? A ALA 21 355 10 Y 1 A GLY 22 ? A GLY 22 356 10 Y 1 A PHE 23 ? A PHE 23 357 10 Y 1 A GLU 24 ? A GLU 24 358 10 Y 1 A ILE 25 ? A ILE 25 359 10 Y 1 A ASP 26 ? A ASP 26 360 10 Y 1 A ASN 27 ? A ASN 27 361 10 Y 1 A ASN 28 ? A ASN 28 362 10 Y 1 A ASP 29 ? A ASP 29 363 10 Y 1 A ASP 30 ? A ASP 30 364 10 Y 1 A THR 31 ? A THR 31 365 10 Y 1 A ILE 32 ? A ILE 32 366 10 Y 1 A GLU 33 ? A GLU 33 367 10 Y 1 A GLU 34 ? A GLU 34 368 10 Y 1 A PHE 35 ? A PHE 35 369 10 Y 1 A PHE 36 ? A PHE 36 370 10 Y 1 A GLY 37 ? A GLY 37 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Human Genome Research Institute (NIH/NHGRI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 600 cryoprobe 2 'AVANCE III' ? Bruker 800 cryoprobe # _atom_sites.entry_id 6NFW _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_