data_6NJV # _entry.id 6NJV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6NJV pdb_00006njv 10.2210/pdb6njv/pdb WWPDB D_1000238850 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-08-07 2 'Structure model' 1 1 2019-08-21 3 'Structure model' 1 2 2019-10-09 4 'Structure model' 1 3 2024-03-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_DOI' 2 2 'Structure model' '_citation.pdbx_database_id_PubMed' 3 2 'Structure model' '_citation.title' 4 2 'Structure model' '_citation_author.identifier_ORCID' 5 3 'Structure model' '_citation.journal_volume' 6 3 'Structure model' '_citation.page_first' 7 3 'Structure model' '_citation.page_last' 8 4 'Structure model' '_database_2.pdbx_DOI' 9 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6NJV _pdbx_database_status.recvd_initial_deposition_date 2019-01-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Schiltz, C.J.' 1 0000-0003-3203-0784 'Lee, A.' 2 ? 'Partlow, E.A.' 3 ? 'Hosford, C.J.' 4 ? 'Chappie, J.S.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_id_ASTM NARHAD _citation.journal_id_CSD 0389 _citation.journal_id_ISSN 1362-4962 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 47 _citation.language ? _citation.page_first 9448 _citation.page_last 9463 _citation.title 'Structural characterization of Class 2 OLD family nucleases supports a two-metal catalysis mechanism for cleavage.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1093/nar/gkz703 _citation.pdbx_database_id_PubMed 31400118 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Schiltz, C.J.' 1 ? primary 'Lee, A.' 2 ? primary 'Partlow, E.A.' 3 ? primary 'Hosford, C.J.' 4 ? primary 'Chappie, J.S.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Xcc_CTR_I 26036.361 1 ? ? ? ? 2 non-polymer syn 'IODIDE ION' 126.904 3 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 4 water nat water 18.015 41 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;RDEEDLQRYIDVTRGEIFFSRGVILVEGDAERFIVPAFAEVLNIPLDMLGITVCSVGGTNFTPYVKLLGPEGLNIPHVIL TDRDPTNGNHPLVRRRLINVLDVIEGGVDHEELDADEVIKLAEQYGYFVNENTLEPELFAGGLAEDMQEVIREELPRLRR ETLNALQQWVDDPAQIDEDLLLRLIERIGKGRFAQALAPSVSEDVCPAYIRSALEHIRDAIALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;RDEEDLQRYIDVTRGEIFFSRGVILVEGDAERFIVPAFAEVLNIPLDMLGITVCSVGGTNFTPYVKLLGPEGLNIPHVIL TDRDPTNGNHPLVRRRLINVLDVIEGGVDHEELDADEVIKLAEQYGYFVNENTLEPELFAGGLAEDMQEVIREELPRLRR ETLNALQQWVDDPAQIDEDLLLRLIERIGKGRFAQALAPSVSEDVCPAYIRSALEHIRDAIALEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'IODIDE ION' IOD 3 'MAGNESIUM ION' MG 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ARG n 1 2 ASP n 1 3 GLU n 1 4 GLU n 1 5 ASP n 1 6 LEU n 1 7 GLN n 1 8 ARG n 1 9 TYR n 1 10 ILE n 1 11 ASP n 1 12 VAL n 1 13 THR n 1 14 ARG n 1 15 GLY n 1 16 GLU n 1 17 ILE n 1 18 PHE n 1 19 PHE n 1 20 SER n 1 21 ARG n 1 22 GLY n 1 23 VAL n 1 24 ILE n 1 25 LEU n 1 26 VAL n 1 27 GLU n 1 28 GLY n 1 29 ASP n 1 30 ALA n 1 31 GLU n 1 32 ARG n 1 33 PHE n 1 34 ILE n 1 35 VAL n 1 36 PRO n 1 37 ALA n 1 38 PHE n 1 39 ALA n 1 40 GLU n 1 41 VAL n 1 42 LEU n 1 43 ASN n 1 44 ILE n 1 45 PRO n 1 46 LEU n 1 47 ASP n 1 48 MET n 1 49 LEU n 1 50 GLY n 1 51 ILE n 1 52 THR n 1 53 VAL n 1 54 CYS n 1 55 SER n 1 56 VAL n 1 57 GLY n 1 58 GLY n 1 59 THR n 1 60 ASN n 1 61 PHE n 1 62 THR n 1 63 PRO n 1 64 TYR n 1 65 VAL n 1 66 LYS n 1 67 LEU n 1 68 LEU n 1 69 GLY n 1 70 PRO n 1 71 GLU n 1 72 GLY n 1 73 LEU n 1 74 ASN n 1 75 ILE n 1 76 PRO n 1 77 HIS n 1 78 VAL n 1 79 ILE n 1 80 LEU n 1 81 THR n 1 82 ASP n 1 83 ARG n 1 84 ASP n 1 85 PRO n 1 86 THR n 1 87 ASN n 1 88 GLY n 1 89 ASN n 1 90 HIS n 1 91 PRO n 1 92 LEU n 1 93 VAL n 1 94 ARG n 1 95 ARG n 1 96 ARG n 1 97 LEU n 1 98 ILE n 1 99 ASN n 1 100 VAL n 1 101 LEU n 1 102 ASP n 1 103 VAL n 1 104 ILE n 1 105 GLU n 1 106 GLY n 1 107 GLY n 1 108 VAL n 1 109 ASP n 1 110 HIS n 1 111 GLU n 1 112 GLU n 1 113 LEU n 1 114 ASP n 1 115 ALA n 1 116 ASP n 1 117 GLU n 1 118 VAL n 1 119 ILE n 1 120 LYS n 1 121 LEU n 1 122 ALA n 1 123 GLU n 1 124 GLN n 1 125 TYR n 1 126 GLY n 1 127 TYR n 1 128 PHE n 1 129 VAL n 1 130 ASN n 1 131 GLU n 1 132 ASN n 1 133 THR n 1 134 LEU n 1 135 GLU n 1 136 PRO n 1 137 GLU n 1 138 LEU n 1 139 PHE n 1 140 ALA n 1 141 GLY n 1 142 GLY n 1 143 LEU n 1 144 ALA n 1 145 GLU n 1 146 ASP n 1 147 MET n 1 148 GLN n 1 149 GLU n 1 150 VAL n 1 151 ILE n 1 152 ARG n 1 153 GLU n 1 154 GLU n 1 155 LEU n 1 156 PRO n 1 157 ARG n 1 158 LEU n 1 159 ARG n 1 160 ARG n 1 161 GLU n 1 162 THR n 1 163 LEU n 1 164 ASN n 1 165 ALA n 1 166 LEU n 1 167 GLN n 1 168 GLN n 1 169 TRP n 1 170 VAL n 1 171 ASP n 1 172 ASP n 1 173 PRO n 1 174 ALA n 1 175 GLN n 1 176 ILE n 1 177 ASP n 1 178 GLU n 1 179 ASP n 1 180 LEU n 1 181 LEU n 1 182 LEU n 1 183 ARG n 1 184 LEU n 1 185 ILE n 1 186 GLU n 1 187 ARG n 1 188 ILE n 1 189 GLY n 1 190 LYS n 1 191 GLY n 1 192 ARG n 1 193 PHE n 1 194 ALA n 1 195 GLN n 1 196 ALA n 1 197 LEU n 1 198 ALA n 1 199 PRO n 1 200 SER n 1 201 VAL n 1 202 SER n 1 203 GLU n 1 204 ASP n 1 205 VAL n 1 206 CYS n 1 207 PRO n 1 208 ALA n 1 209 TYR n 1 210 ILE n 1 211 ARG n 1 212 SER n 1 213 ALA n 1 214 LEU n 1 215 GLU n 1 216 HIS n 1 217 ILE n 1 218 ARG n 1 219 ASP n 1 220 ALA n 1 221 ILE n 1 222 ALA n 1 223 LEU n 1 224 GLU n 1 225 HIS n 1 226 HIS n 1 227 HIS n 1 228 HIS n 1 229 HIS n 1 230 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 230 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene XCCB100_2436 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain B100 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Xanthomonas campestris pv. campestris (strain B100)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 509169 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IOD non-polymer . 'IODIDE ION' ? 'I -1' 126.904 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ARG 1 374 ? ? ? A . n A 1 2 ASP 2 375 ? ? ? A . n A 1 3 GLU 3 376 ? ? ? A . n A 1 4 GLU 4 377 ? ? ? A . n A 1 5 ASP 5 378 ? ? ? A . n A 1 6 LEU 6 379 ? ? ? A . n A 1 7 GLN 7 380 ? ? ? A . n A 1 8 ARG 8 381 ? ? ? A . n A 1 9 TYR 9 382 ? ? ? A . n A 1 10 ILE 10 383 ? ? ? A . n A 1 11 ASP 11 384 ? ? ? A . n A 1 12 VAL 12 385 ? ? ? A . n A 1 13 THR 13 386 ? ? ? A . n A 1 14 ARG 14 387 ? ? ? A . n A 1 15 GLY 15 388 ? ? ? A . n A 1 16 GLU 16 389 ? ? ? A . n A 1 17 ILE 17 390 390 ILE ILE A . n A 1 18 PHE 18 391 391 PHE PHE A . n A 1 19 PHE 19 392 392 PHE PHE A . n A 1 20 SER 20 393 393 SER SER A . n A 1 21 ARG 21 394 394 ARG ARG A . n A 1 22 GLY 22 395 395 GLY GLY A . n A 1 23 VAL 23 396 396 VAL VAL A . n A 1 24 ILE 24 397 397 ILE ILE A . n A 1 25 LEU 25 398 398 LEU LEU A . n A 1 26 VAL 26 399 399 VAL VAL A . n A 1 27 GLU 27 400 400 GLU GLU A . n A 1 28 GLY 28 401 401 GLY GLY A . n A 1 29 ASP 29 402 402 ASP ASP A . n A 1 30 ALA 30 403 403 ALA ALA A . n A 1 31 GLU 31 404 404 GLU GLU A . n A 1 32 ARG 32 405 405 ARG ARG A . n A 1 33 PHE 33 406 406 PHE PHE A . n A 1 34 ILE 34 407 407 ILE ILE A . n A 1 35 VAL 35 408 408 VAL VAL A . n A 1 36 PRO 36 409 409 PRO PRO A . n A 1 37 ALA 37 410 410 ALA ALA A . n A 1 38 PHE 38 411 411 PHE PHE A . n A 1 39 ALA 39 412 412 ALA ALA A . n A 1 40 GLU 40 413 413 GLU GLU A . n A 1 41 VAL 41 414 414 VAL VAL A . n A 1 42 LEU 42 415 415 LEU LEU A . n A 1 43 ASN 43 416 416 ASN ASN A . n A 1 44 ILE 44 417 417 ILE ILE A . n A 1 45 PRO 45 418 418 PRO PRO A . n A 1 46 LEU 46 419 419 LEU LEU A . n A 1 47 ASP 47 420 420 ASP ASP A . n A 1 48 MET 48 421 421 MET MET A . n A 1 49 LEU 49 422 422 LEU LEU A . n A 1 50 GLY 50 423 423 GLY GLY A . n A 1 51 ILE 51 424 424 ILE ILE A . n A 1 52 THR 52 425 425 THR THR A . n A 1 53 VAL 53 426 426 VAL VAL A . n A 1 54 CYS 54 427 427 CYS CYS A . n A 1 55 SER 55 428 428 SER SER A . n A 1 56 VAL 56 429 429 VAL VAL A . n A 1 57 GLY 57 430 430 GLY GLY A . n A 1 58 GLY 58 431 431 GLY GLY A . n A 1 59 THR 59 432 432 THR THR A . n A 1 60 ASN 60 433 433 ASN ASN A . n A 1 61 PHE 61 434 434 PHE PHE A . n A 1 62 THR 62 435 435 THR THR A . n A 1 63 PRO 63 436 436 PRO PRO A . n A 1 64 TYR 64 437 437 TYR TYR A . n A 1 65 VAL 65 438 438 VAL VAL A . n A 1 66 LYS 66 439 439 LYS LYS A . n A 1 67 LEU 67 440 440 LEU LEU A . n A 1 68 LEU 68 441 441 LEU LEU A . n A 1 69 GLY 69 442 442 GLY GLY A . n A 1 70 PRO 70 443 443 PRO PRO A . n A 1 71 GLU 71 444 444 GLU GLU A . n A 1 72 GLY 72 445 445 GLY GLY A . n A 1 73 LEU 73 446 446 LEU LEU A . n A 1 74 ASN 74 447 447 ASN ASN A . n A 1 75 ILE 75 448 448 ILE ILE A . n A 1 76 PRO 76 449 449 PRO PRO A . n A 1 77 HIS 77 450 450 HIS HIS A . n A 1 78 VAL 78 451 451 VAL VAL A . n A 1 79 ILE 79 452 452 ILE ILE A . n A 1 80 LEU 80 453 453 LEU LEU A . n A 1 81 THR 81 454 454 THR THR A . n A 1 82 ASP 82 455 455 ASP ASP A . n A 1 83 ARG 83 456 456 ARG ARG A . n A 1 84 ASP 84 457 457 ASP ASP A . n A 1 85 PRO 85 458 458 PRO PRO A . n A 1 86 THR 86 459 ? ? ? A . n A 1 87 ASN 87 460 ? ? ? A . n A 1 88 GLY 88 461 ? ? ? A . n A 1 89 ASN 89 462 ? ? ? A . n A 1 90 HIS 90 463 ? ? ? A . n A 1 91 PRO 91 464 464 PRO PRO A . n A 1 92 LEU 92 465 465 LEU LEU A . n A 1 93 VAL 93 466 466 VAL VAL A . n A 1 94 ARG 94 467 467 ARG ARG A . n A 1 95 ARG 95 468 468 ARG ARG A . n A 1 96 ARG 96 469 469 ARG ARG A . n A 1 97 LEU 97 470 470 LEU LEU A . n A 1 98 ILE 98 471 471 ILE ILE A . n A 1 99 ASN 99 472 472 ASN ASN A . n A 1 100 VAL 100 473 473 VAL VAL A . n A 1 101 LEU 101 474 474 LEU LEU A . n A 1 102 ASP 102 475 475 ASP ASP A . n A 1 103 VAL 103 476 476 VAL VAL A . n A 1 104 ILE 104 477 477 ILE ILE A . n A 1 105 GLU 105 478 478 GLU GLU A . n A 1 106 GLY 106 479 479 GLY GLY A . n A 1 107 GLY 107 480 480 GLY GLY A . n A 1 108 VAL 108 481 481 VAL VAL A . n A 1 109 ASP 109 482 482 ASP ASP A . n A 1 110 HIS 110 483 483 HIS HIS A . n A 1 111 GLU 111 484 484 GLU GLU A . n A 1 112 GLU 112 485 485 GLU GLU A . n A 1 113 LEU 113 486 486 LEU LEU A . n A 1 114 ASP 114 487 487 ASP ASP A . n A 1 115 ALA 115 488 488 ALA ALA A . n A 1 116 ASP 116 489 489 ASP ASP A . n A 1 117 GLU 117 490 490 GLU GLU A . n A 1 118 VAL 118 491 491 VAL VAL A . n A 1 119 ILE 119 492 492 ILE ILE A . n A 1 120 LYS 120 493 493 LYS LYS A . n A 1 121 LEU 121 494 494 LEU LEU A . n A 1 122 ALA 122 495 495 ALA ALA A . n A 1 123 GLU 123 496 496 GLU GLU A . n A 1 124 GLN 124 497 497 GLN GLN A . n A 1 125 TYR 125 498 498 TYR TYR A . n A 1 126 GLY 126 499 499 GLY GLY A . n A 1 127 TYR 127 500 500 TYR TYR A . n A 1 128 PHE 128 501 501 PHE PHE A . n A 1 129 VAL 129 502 502 VAL VAL A . n A 1 130 ASN 130 503 503 ASN ASN A . n A 1 131 GLU 131 504 504 GLU GLU A . n A 1 132 ASN 132 505 505 ASN ASN A . n A 1 133 THR 133 506 506 THR THR A . n A 1 134 LEU 134 507 507 LEU LEU A . n A 1 135 GLU 135 508 508 GLU GLU A . n A 1 136 PRO 136 509 509 PRO PRO A . n A 1 137 GLU 137 510 510 GLU GLU A . n A 1 138 LEU 138 511 511 LEU LEU A . n A 1 139 PHE 139 512 512 PHE PHE A . n A 1 140 ALA 140 513 513 ALA ALA A . n A 1 141 GLY 141 514 514 GLY GLY A . n A 1 142 GLY 142 515 515 GLY GLY A . n A 1 143 LEU 143 516 516 LEU LEU A . n A 1 144 ALA 144 517 517 ALA ALA A . n A 1 145 GLU 145 518 518 GLU GLU A . n A 1 146 ASP 146 519 519 ASP ASP A . n A 1 147 MET 147 520 520 MET MET A . n A 1 148 GLN 148 521 521 GLN GLN A . n A 1 149 GLU 149 522 522 GLU GLU A . n A 1 150 VAL 150 523 523 VAL VAL A . n A 1 151 ILE 151 524 524 ILE ILE A . n A 1 152 ARG 152 525 525 ARG ARG A . n A 1 153 GLU 153 526 526 GLU GLU A . n A 1 154 GLU 154 527 527 GLU GLU A . n A 1 155 LEU 155 528 528 LEU LEU A . n A 1 156 PRO 156 529 529 PRO PRO A . n A 1 157 ARG 157 530 530 ARG ARG A . n A 1 158 LEU 158 531 531 LEU LEU A . n A 1 159 ARG 159 532 532 ARG ARG A . n A 1 160 ARG 160 533 533 ARG ARG A . n A 1 161 GLU 161 534 534 GLU GLU A . n A 1 162 THR 162 535 535 THR THR A . n A 1 163 LEU 163 536 536 LEU LEU A . n A 1 164 ASN 164 537 537 ASN ASN A . n A 1 165 ALA 165 538 538 ALA ALA A . n A 1 166 LEU 166 539 539 LEU LEU A . n A 1 167 GLN 167 540 540 GLN GLN A . n A 1 168 GLN 168 541 541 GLN GLN A . n A 1 169 TRP 169 542 542 TRP TRP A . n A 1 170 VAL 170 543 543 VAL VAL A . n A 1 171 ASP 171 544 544 ASP ASP A . n A 1 172 ASP 172 545 545 ASP ASP A . n A 1 173 PRO 173 546 546 PRO PRO A . n A 1 174 ALA 174 547 547 ALA ALA A . n A 1 175 GLN 175 548 548 GLN GLN A . n A 1 176 ILE 176 549 549 ILE ILE A . n A 1 177 ASP 177 550 550 ASP ASP A . n A 1 178 GLU 178 551 551 GLU GLU A . n A 1 179 ASP 179 552 552 ASP ASP A . n A 1 180 LEU 180 553 553 LEU LEU A . n A 1 181 LEU 181 554 554 LEU LEU A . n A 1 182 LEU 182 555 555 LEU LEU A . n A 1 183 ARG 183 556 556 ARG ARG A . n A 1 184 LEU 184 557 557 LEU LEU A . n A 1 185 ILE 185 558 558 ILE ILE A . n A 1 186 GLU 186 559 559 GLU GLU A . n A 1 187 ARG 187 560 560 ARG ARG A . n A 1 188 ILE 188 561 561 ILE ILE A . n A 1 189 GLY 189 562 562 GLY GLY A . n A 1 190 LYS 190 563 563 LYS LYS A . n A 1 191 GLY 191 564 564 GLY GLY A . n A 1 192 ARG 192 565 565 ARG ARG A . n A 1 193 PHE 193 566 566 PHE PHE A . n A 1 194 ALA 194 567 567 ALA ALA A . n A 1 195 GLN 195 568 568 GLN GLN A . n A 1 196 ALA 196 569 569 ALA ALA A . n A 1 197 LEU 197 570 570 LEU LEU A . n A 1 198 ALA 198 571 571 ALA ALA A . n A 1 199 PRO 199 572 572 PRO PRO A . n A 1 200 SER 200 573 573 SER SER A . n A 1 201 VAL 201 574 574 VAL VAL A . n A 1 202 SER 202 575 575 SER SER A . n A 1 203 GLU 203 576 576 GLU GLU A . n A 1 204 ASP 204 577 577 ASP ASP A . n A 1 205 VAL 205 578 578 VAL VAL A . n A 1 206 CYS 206 579 579 CYS CYS A . n A 1 207 PRO 207 580 580 PRO PRO A . n A 1 208 ALA 208 581 581 ALA ALA A . n A 1 209 TYR 209 582 582 TYR TYR A . n A 1 210 ILE 210 583 583 ILE ILE A . n A 1 211 ARG 211 584 584 ARG ARG A . n A 1 212 SER 212 585 585 SER SER A . n A 1 213 ALA 213 586 586 ALA ALA A . n A 1 214 LEU 214 587 587 LEU LEU A . n A 1 215 GLU 215 588 588 GLU GLU A . n A 1 216 HIS 216 589 589 HIS HIS A . n A 1 217 ILE 217 590 590 ILE ILE A . n A 1 218 ARG 218 591 591 ARG ARG A . n A 1 219 ASP 219 592 592 ASP ASP A . n A 1 220 ALA 220 593 593 ALA ALA A . n A 1 221 ILE 221 594 594 ILE ILE A . n A 1 222 ALA 222 595 595 ALA ALA A . n A 1 223 LEU 223 596 596 LEU LEU A . n A 1 224 GLU 224 597 597 GLU GLU A . n A 1 225 HIS 225 598 598 HIS HIS A . n A 1 226 HIS 226 599 599 HIS HIS A . n A 1 227 HIS 227 600 600 HIS HIS A . n A 1 228 HIS 228 601 ? ? ? A . n A 1 229 HIS 229 602 ? ? ? A . n A 1 230 HIS 230 603 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 IOD 1 701 1 IOD IOD A . C 2 IOD 1 702 2 IOD IOD A . D 2 IOD 1 703 3 IOD IOD A . E 3 MG 1 704 4 MG MG A . F 4 HOH 1 801 12 HOH HOH A . F 4 HOH 2 802 19 HOH HOH A . F 4 HOH 3 803 28 HOH HOH A . F 4 HOH 4 804 27 HOH HOH A . F 4 HOH 5 805 6 HOH HOH A . F 4 HOH 6 806 35 HOH HOH A . F 4 HOH 7 807 9 HOH HOH A . F 4 HOH 8 808 7 HOH HOH A . F 4 HOH 9 809 1 HOH HOH A . F 4 HOH 10 810 5 HOH HOH A . F 4 HOH 11 811 10 HOH HOH A . F 4 HOH 12 812 34 HOH HOH A . F 4 HOH 13 813 15 HOH HOH A . F 4 HOH 14 814 38 HOH HOH A . F 4 HOH 15 815 32 HOH HOH A . F 4 HOH 16 816 22 HOH HOH A . F 4 HOH 17 817 3 HOH HOH A . F 4 HOH 18 818 11 HOH HOH A . F 4 HOH 19 819 4 HOH HOH A . F 4 HOH 20 820 37 HOH HOH A . F 4 HOH 21 821 16 HOH HOH A . F 4 HOH 22 822 25 HOH HOH A . F 4 HOH 23 823 2 HOH HOH A . F 4 HOH 24 824 31 HOH HOH A . F 4 HOH 25 825 33 HOH HOH A . F 4 HOH 26 826 20 HOH HOH A . F 4 HOH 27 827 26 HOH HOH A . F 4 HOH 28 828 17 HOH HOH A . F 4 HOH 29 829 24 HOH HOH A . F 4 HOH 30 830 18 HOH HOH A . F 4 HOH 31 831 8 HOH HOH A . F 4 HOH 32 832 36 HOH HOH A . F 4 HOH 33 833 29 HOH HOH A . F 4 HOH 34 834 13 HOH HOH A . F 4 HOH 35 835 14 HOH HOH A . F 4 HOH 36 836 21 HOH HOH A . F 4 HOH 37 837 23 HOH HOH A . F 4 HOH 38 838 40 HOH HOH A . F 4 HOH 39 839 39 HOH HOH A . F 4 HOH 40 840 41 HOH HOH A . F 4 HOH 41 841 30 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A PHE 392 ? CG ? A PHE 19 CG 2 1 Y 1 A PHE 392 ? CD1 ? A PHE 19 CD1 3 1 Y 1 A PHE 392 ? CD2 ? A PHE 19 CD2 4 1 Y 1 A PHE 392 ? CE1 ? A PHE 19 CE1 5 1 Y 1 A PHE 392 ? CE2 ? A PHE 19 CE2 6 1 Y 1 A PHE 392 ? CZ ? A PHE 19 CZ 7 1 Y 1 A GLU 485 ? CG ? A GLU 112 CG 8 1 Y 1 A GLU 485 ? CD ? A GLU 112 CD 9 1 Y 1 A GLU 485 ? OE1 ? A GLU 112 OE1 10 1 Y 1 A GLU 485 ? OE2 ? A GLU 112 OE2 11 1 Y 1 A GLU 510 ? CG ? A GLU 137 CG 12 1 Y 1 A GLU 510 ? CD ? A GLU 137 CD 13 1 Y 1 A GLU 510 ? OE1 ? A GLU 137 OE1 14 1 Y 1 A GLU 510 ? OE2 ? A GLU 137 OE2 15 1 Y 1 A GLU 526 ? CG ? A GLU 153 CG 16 1 Y 1 A GLU 526 ? CD ? A GLU 153 CD 17 1 Y 1 A GLU 526 ? OE1 ? A GLU 153 OE1 18 1 Y 1 A GLU 526 ? OE2 ? A GLU 153 OE2 19 1 Y 1 A GLU 534 ? CG ? A GLU 161 CG 20 1 Y 1 A GLU 534 ? CD ? A GLU 161 CD 21 1 Y 1 A GLU 534 ? OE1 ? A GLU 161 OE1 22 1 Y 1 A GLU 534 ? OE2 ? A GLU 161 OE2 23 1 Y 1 A GLN 548 ? CG ? A GLN 175 CG 24 1 Y 1 A GLN 548 ? CD ? A GLN 175 CD 25 1 Y 1 A GLN 548 ? OE1 ? A GLN 175 OE1 26 1 Y 1 A GLN 548 ? NE2 ? A GLN 175 NE2 27 1 Y 1 A HIS 599 ? CG ? A HIS 226 CG 28 1 Y 1 A HIS 599 ? ND1 ? A HIS 226 ND1 29 1 Y 1 A HIS 599 ? CD2 ? A HIS 226 CD2 30 1 Y 1 A HIS 599 ? CE1 ? A HIS 226 CE1 31 1 Y 1 A HIS 599 ? NE2 ? A HIS 226 NE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.13_2998 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? AutoSol ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6NJV _cell.details ? _cell.formula_units_Z ? _cell.length_a 64.392 _cell.length_a_esd ? _cell.length_b 64.392 _cell.length_b_esd ? _cell.length_c 63.388 _cell.length_c_esd ? _cell.volume 262827.545 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6NJV _symmetry.cell_setting ? _symmetry.Int_Tables_number 78 _symmetry.space_group_name_Hall 'P 4cw' _symmetry.space_group_name_H-M 'P 43' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6NJV _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.52 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.26 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Bis Tris Propane pH 7.0-8.0, 11-26% PEG 3350, 0.15-0.2 M sodium iodide, and 0.25 M NDSB-195' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-12-03 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.6531 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.6531 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 50.89 _reflns.entry_id 6NJV _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.99 _reflns.d_resolution_low 64.39 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 29501 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.39 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.99 _reflns_shell.d_res_low 2.04 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 56.47 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6NJV _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.30 _refine.ls_d_res_low 64.39 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 22484 _refine.ls_number_reflns_R_free 1157 _refine.ls_number_reflns_R_work 21327 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.29 _refine.ls_percent_reflns_R_free 5.15 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2181 _refine.ls_R_factor_R_free 0.2744 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2151 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.84 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.7308 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3121 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1597 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 4 _refine_hist.number_atoms_solvent 41 _refine_hist.number_atoms_total 1642 _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 64.39 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0084 ? 1625 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.0442 ? 2211 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0535 ? 260 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0057 ? 292 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 3.0902 ? 987 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.30 2.40 . . 147 2680 99.12 . . . 0.3503 . 0.3195 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.40 2.53 . . 153 2661 99.08 . . . 0.3729 . 0.3071 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.53 2.69 . . 140 2613 98.64 . . . 0.3202 . 0.2850 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.69 2.90 . . 152 2691 99.68 . . . 0.3856 . 0.2659 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.90 3.19 . . 180 2636 99.54 . . . 0.3044 . 0.2513 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.19 3.65 . . 137 2667 99.47 . . . 0.2887 . 0.2191 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.65 4.60 . . 102 2723 99.51 . . . 0.2269 . 0.1767 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.60 64.42 . . 146 2656 99.36 . . . 0.2172 . 0.1813 . . . . . . . . . . # _struct.entry_id 6NJV _struct.title 'C-terminal region of the Xanthomonas campestris pv. campestris OLD protein phased with iodine' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6NJV _struct_keywords.text 'Nuclease, Toprim, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B0RTN2_XANCB _struct_ref.pdbx_db_accession B0RTN2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;RDEEDLQRYIDVTRGEIFFSRGVILVEGDAERFIVPAFAEVLNIPLDMLGITVCSVGGTNFTPYVKLLGPEGLNIPHVIL TDRDPTNGNHPLVRRRLINVLDVIEGGVDHEELDADEVIKLAEQYGYFVNENTLEPELFAGGLAEDMQEVIREELPRLRR ETLNALQQWVDDPAQIDEDLLLRLIERIGKGRFAQALAPSVSEDVCPAYIRSALEHIRDAIA ; _struct_ref.pdbx_align_begin 374 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6NJV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 222 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B0RTN2 _struct_ref_seq.db_align_beg 374 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 595 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 374 _struct_ref_seq.pdbx_auth_seq_align_end 595 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6NJV LEU A 223 ? UNP B0RTN2 ? ? 'expression tag' 596 1 1 6NJV GLU A 224 ? UNP B0RTN2 ? ? 'expression tag' 597 2 1 6NJV HIS A 225 ? UNP B0RTN2 ? ? 'expression tag' 598 3 1 6NJV HIS A 226 ? UNP B0RTN2 ? ? 'expression tag' 599 4 1 6NJV HIS A 227 ? UNP B0RTN2 ? ? 'expression tag' 600 5 1 6NJV HIS A 228 ? UNP B0RTN2 ? ? 'expression tag' 601 6 1 6NJV HIS A 229 ? UNP B0RTN2 ? ? 'expression tag' 602 7 1 6NJV HIS A 230 ? UNP B0RTN2 ? ? 'expression tag' 603 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 28 ? LEU A 42 ? GLY A 401 LEU A 415 1 ? 15 HELX_P HELX_P2 AA2 PRO A 45 ? GLY A 50 ? PRO A 418 GLY A 423 1 ? 6 HELX_P HELX_P3 AA3 PHE A 61 ? GLY A 69 ? PHE A 434 GLY A 442 1 ? 9 HELX_P HELX_P4 AA4 LEU A 92 ? GLU A 105 ? LEU A 465 GLU A 478 1 ? 14 HELX_P HELX_P5 AA5 ASP A 114 ? GLN A 124 ? ASP A 487 GLN A 497 1 ? 11 HELX_P HELX_P6 AA6 THR A 133 ? GLY A 141 ? THR A 506 GLY A 514 1 ? 9 HELX_P HELX_P7 AA7 LEU A 143 ? LEU A 155 ? LEU A 516 LEU A 528 1 ? 13 HELX_P HELX_P8 AA8 ARG A 159 ? ASP A 172 ? ARG A 532 ASP A 545 1 ? 14 HELX_P HELX_P9 AA9 ASP A 177 ? GLY A 189 ? ASP A 550 GLY A 562 1 ? 13 HELX_P HELX_P10 AB1 GLY A 189 ? ALA A 198 ? GLY A 562 ALA A 571 1 ? 10 HELX_P HELX_P11 AB2 PRO A 199 ? VAL A 201 ? PRO A 572 VAL A 574 5 ? 3 HELX_P HELX_P12 AB3 SER A 202 ? CYS A 206 ? SER A 575 CYS A 579 5 ? 5 HELX_P HELX_P13 AB4 PRO A 207 ? HIS A 226 ? PRO A 580 HIS A 599 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 27 OE1 ? ? ? 1_555 E MG . MG L ? A GLU 400 A MG 704 1_555 ? ? ? ? ? ? ? 2.865 ? ? metalc2 metalc ? ? A GLU 27 OE2 ? ? ? 1_555 E MG . MG L ? A GLU 400 A MG 704 1_555 ? ? ? ? ? ? ? 2.231 ? ? metalc3 metalc ? ? A ASP 82 OD2 ? ? ? 1_555 E MG . MG L ? A ASP 455 A MG 704 1_555 ? ? ? ? ? ? ? 2.429 ? ? metalc4 metalc ? ? E MG . MG L ? ? 1_555 F HOH . O ? ? A MG 704 A HOH 808 1_555 ? ? ? ? ? ? ? 2.171 ? ? metalc5 metalc ? ? E MG . MG L ? ? 1_555 F HOH . O ? ? A MG 704 A HOH 825 1_555 ? ? ? ? ? ? ? 2.198 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 27 ? A GLU 400 ? 1_555 MG L E MG . ? A MG 704 ? 1_555 OE2 ? A GLU 27 ? A GLU 400 ? 1_555 49.2 ? 2 OE1 ? A GLU 27 ? A GLU 400 ? 1_555 MG L E MG . ? A MG 704 ? 1_555 OD2 ? A ASP 82 ? A ASP 455 ? 1_555 80.3 ? 3 OE2 ? A GLU 27 ? A GLU 400 ? 1_555 MG L E MG . ? A MG 704 ? 1_555 OD2 ? A ASP 82 ? A ASP 455 ? 1_555 76.6 ? 4 OE1 ? A GLU 27 ? A GLU 400 ? 1_555 MG L E MG . ? A MG 704 ? 1_555 O ? F HOH . ? A HOH 808 ? 1_555 116.3 ? 5 OE2 ? A GLU 27 ? A GLU 400 ? 1_555 MG L E MG . ? A MG 704 ? 1_555 O ? F HOH . ? A HOH 808 ? 1_555 69.4 ? 6 OD2 ? A ASP 82 ? A ASP 455 ? 1_555 MG L E MG . ? A MG 704 ? 1_555 O ? F HOH . ? A HOH 808 ? 1_555 69.7 ? 7 OE1 ? A GLU 27 ? A GLU 400 ? 1_555 MG L E MG . ? A MG 704 ? 1_555 O ? F HOH . ? A HOH 825 ? 1_555 157.9 ? 8 OE2 ? A GLU 27 ? A GLU 400 ? 1_555 MG L E MG . ? A MG 704 ? 1_555 O ? F HOH . ? A HOH 825 ? 1_555 130.4 ? 9 OD2 ? A ASP 82 ? A ASP 455 ? 1_555 MG L E MG . ? A MG 704 ? 1_555 O ? F HOH . ? A HOH 825 ? 1_555 78.7 ? 10 O ? F HOH . ? A HOH 808 ? 1_555 MG L E MG . ? A MG 704 ? 1_555 O ? F HOH . ? A HOH 825 ? 1_555 61.8 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 51 ? SER A 55 ? ILE A 424 SER A 428 AA1 2 GLY A 22 ? VAL A 26 ? GLY A 395 VAL A 399 AA1 3 HIS A 77 ? ASP A 82 ? HIS A 450 ASP A 455 AA1 4 TYR A 127 ? ASN A 130 ? TYR A 500 ASN A 503 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O THR A 52 ? O THR A 425 N ILE A 24 ? N ILE A 397 AA1 2 3 N LEU A 25 ? N LEU A 398 O VAL A 78 ? O VAL A 451 AA1 3 4 N ILE A 79 ? N ILE A 452 O PHE A 128 ? O PHE A 501 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A IOD 701 ? 1 'binding site for residue IOD A 701' AC2 Software A IOD 702 ? 1 'binding site for residue IOD A 702' AC3 Software A IOD 703 ? 2 'binding site for residue IOD A 703' AC4 Software A MG 704 ? 5 'binding site for residue MG A 704' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 1 ARG A 157 ? ARG A 530 . ? 1_555 ? 2 AC2 1 ARG A 187 ? ARG A 560 . ? 1_555 ? 3 AC3 2 ARG A 83 ? ARG A 456 . ? 4_475 ? 4 AC3 2 PRO A 85 ? PRO A 458 . ? 4_475 ? 5 AC4 5 GLU A 27 ? GLU A 400 . ? 1_555 ? 6 AC4 5 ASP A 82 ? ASP A 455 . ? 1_555 ? 7 AC4 5 ASP A 84 ? ASP A 457 . ? 1_555 ? 8 AC4 5 HOH F . ? HOH A 808 . ? 1_555 ? 9 AC4 5 HOH F . ? HOH A 825 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 832 ? ? O A HOH 840 ? ? 2.10 2 1 O A HOH 833 ? ? O A HOH 841 ? ? 2.13 3 1 O A ASP 455 ? ? NH2 A ARG 469 ? ? 2.18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 392 ? ? -67.60 54.75 2 1 ASP A 457 ? ? 63.13 81.81 3 1 GLU A 478 ? ? -113.85 70.29 4 1 ASN A 505 ? ? 58.39 -155.71 5 1 ASP A 545 ? ? -152.73 88.60 6 1 PRO A 546 ? ? -62.48 61.11 7 1 ALA A 547 ? ? -151.16 -22.44 8 1 GLN A 548 ? ? -69.74 5.60 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x,z+3/4 3 y,-x,z+1/4 4 -x,-y,z+1/2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ARG 374 ? A ARG 1 2 1 Y 1 A ASP 375 ? A ASP 2 3 1 Y 1 A GLU 376 ? A GLU 3 4 1 Y 1 A GLU 377 ? A GLU 4 5 1 Y 1 A ASP 378 ? A ASP 5 6 1 Y 1 A LEU 379 ? A LEU 6 7 1 Y 1 A GLN 380 ? A GLN 7 8 1 Y 1 A ARG 381 ? A ARG 8 9 1 Y 1 A TYR 382 ? A TYR 9 10 1 Y 1 A ILE 383 ? A ILE 10 11 1 Y 1 A ASP 384 ? A ASP 11 12 1 Y 1 A VAL 385 ? A VAL 12 13 1 Y 1 A THR 386 ? A THR 13 14 1 Y 1 A ARG 387 ? A ARG 14 15 1 Y 1 A GLY 388 ? A GLY 15 16 1 Y 1 A GLU 389 ? A GLU 16 17 1 Y 1 A THR 459 ? A THR 86 18 1 Y 1 A ASN 460 ? A ASN 87 19 1 Y 1 A GLY 461 ? A GLY 88 20 1 Y 1 A ASN 462 ? A ASN 89 21 1 Y 1 A HIS 463 ? A HIS 90 22 1 Y 1 A HIS 601 ? A HIS 228 23 1 Y 1 A HIS 602 ? A HIS 229 24 1 Y 1 A HIS 603 ? A HIS 230 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 IOD I I N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 MG MG MG N N 251 PHE N N N N 252 PHE CA C N S 253 PHE C C N N 254 PHE O O N N 255 PHE CB C N N 256 PHE CG C Y N 257 PHE CD1 C Y N 258 PHE CD2 C Y N 259 PHE CE1 C Y N 260 PHE CE2 C Y N 261 PHE CZ C Y N 262 PHE OXT O N N 263 PHE H H N N 264 PHE H2 H N N 265 PHE HA H N N 266 PHE HB2 H N N 267 PHE HB3 H N N 268 PHE HD1 H N N 269 PHE HD2 H N N 270 PHE HE1 H N N 271 PHE HE2 H N N 272 PHE HZ H N N 273 PHE HXT H N N 274 PRO N N N N 275 PRO CA C N S 276 PRO C C N N 277 PRO O O N N 278 PRO CB C N N 279 PRO CG C N N 280 PRO CD C N N 281 PRO OXT O N N 282 PRO H H N N 283 PRO HA H N N 284 PRO HB2 H N N 285 PRO HB3 H N N 286 PRO HG2 H N N 287 PRO HG3 H N N 288 PRO HD2 H N N 289 PRO HD3 H N N 290 PRO HXT H N N 291 SER N N N N 292 SER CA C N S 293 SER C C N N 294 SER O O N N 295 SER CB C N N 296 SER OG O N N 297 SER OXT O N N 298 SER H H N N 299 SER H2 H N N 300 SER HA H N N 301 SER HB2 H N N 302 SER HB3 H N N 303 SER HG H N N 304 SER HXT H N N 305 THR N N N N 306 THR CA C N S 307 THR C C N N 308 THR O O N N 309 THR CB C N R 310 THR OG1 O N N 311 THR CG2 C N N 312 THR OXT O N N 313 THR H H N N 314 THR H2 H N N 315 THR HA H N N 316 THR HB H N N 317 THR HG1 H N N 318 THR HG21 H N N 319 THR HG22 H N N 320 THR HG23 H N N 321 THR HXT H N N 322 TRP N N N N 323 TRP CA C N S 324 TRP C C N N 325 TRP O O N N 326 TRP CB C N N 327 TRP CG C Y N 328 TRP CD1 C Y N 329 TRP CD2 C Y N 330 TRP NE1 N Y N 331 TRP CE2 C Y N 332 TRP CE3 C Y N 333 TRP CZ2 C Y N 334 TRP CZ3 C Y N 335 TRP CH2 C Y N 336 TRP OXT O N N 337 TRP H H N N 338 TRP H2 H N N 339 TRP HA H N N 340 TRP HB2 H N N 341 TRP HB3 H N N 342 TRP HD1 H N N 343 TRP HE1 H N N 344 TRP HE3 H N N 345 TRP HZ2 H N N 346 TRP HZ3 H N N 347 TRP HH2 H N N 348 TRP HXT H N N 349 TYR N N N N 350 TYR CA C N S 351 TYR C C N N 352 TYR O O N N 353 TYR CB C N N 354 TYR CG C Y N 355 TYR CD1 C Y N 356 TYR CD2 C Y N 357 TYR CE1 C Y N 358 TYR CE2 C Y N 359 TYR CZ C Y N 360 TYR OH O N N 361 TYR OXT O N N 362 TYR H H N N 363 TYR H2 H N N 364 TYR HA H N N 365 TYR HB2 H N N 366 TYR HB3 H N N 367 TYR HD1 H N N 368 TYR HD2 H N N 369 TYR HE1 H N N 370 TYR HE2 H N N 371 TYR HH H N N 372 TYR HXT H N N 373 VAL N N N N 374 VAL CA C N S 375 VAL C C N N 376 VAL O O N N 377 VAL CB C N N 378 VAL CG1 C N N 379 VAL CG2 C N N 380 VAL OXT O N N 381 VAL H H N N 382 VAL H2 H N N 383 VAL HA H N N 384 VAL HB H N N 385 VAL HG11 H N N 386 VAL HG12 H N N 387 VAL HG13 H N N 388 VAL HG21 H N N 389 VAL HG22 H N N 390 VAL HG23 H N N 391 VAL HXT H N N 392 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _space_group.name_H-M_alt 'P 43' _space_group.name_Hall 'P 4cw' _space_group.IT_number 78 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 6NJV _atom_sites.fract_transf_matrix[1][1] 0.015530 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015530 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015776 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 25.62398 1.50364 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? I ? ? 40.26819 12.56501 1.42647 27.02115 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MG ? ? ? ? ? ? ? ? ? MG2+ ? ? 9.95820 ? 3.10187 ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 19.97189 1.75589 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 15.80542 1.70748 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O1- ? ? 5.12366 3.84317 3.49406 27.47979 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 1.23737 29.19336 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_