data_6NTY # _entry.id 6NTY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.325 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6NTY WWPDB D_1000239428 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6NTY _pdbx_database_status.recvd_initial_deposition_date 2019-01-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lovell, S.' 1 ? 'Kashipathy, M.M.' 2 ? 'Battaile, K.P.' 3 ? 'Lan, L.' 4 ? 'Xiaoqing, W.' 5 ? 'Cooper, A.' 6 ? 'Gao, F.P.' 7 ? 'Xu, L.' 8 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proteins _citation.journal_id_ASTM PSFGEY _citation.journal_id_CSD 0867 _citation.journal_id_ISSN 1097-0134 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 88 _citation.language ? _citation.page_first 573 _citation.page_last 583 _citation.title 'Crystal and solution structures of human oncoprotein Musashi-2 N-terminal RNA recognition motif 1.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/prot.25836 _citation.pdbx_database_id_PubMed 31603583 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lan, L.' 1 ? primary 'Xing, M.' 2 ? primary 'Kashipathy, M.' 3 ? primary 'Douglas, J.' 4 ? primary 'Gao, P.' 5 ? primary 'Battaile, K.' 6 ? primary 'Hanzlik, R.' 7 ? primary 'Lovell, S.' 8 ? primary 'Xu, L.' 9 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 101.320 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6NTY _cell.details ? _cell.formula_units_Z ? _cell.length_a 30.795 _cell.length_a_esd ? _cell.length_b 57.370 _cell.length_b_esd ? _cell.length_c 41.315 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6NTY _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'RNA-binding protein Musashi homolog 2' 10639.242 2 ? ? 'RNA recognition motif 1 (RRM1) Domain (UNP residues 21-111)' ? 2 non-polymer syn 'PHOSPHATE ION' 94.971 1 ? ? ? ? 3 water nat water 18.015 37 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Musashi-2 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SNAGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAF PRRAQPKMVTRTKK ; _entity_poly.pdbx_seq_one_letter_code_can ;SNAGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAF PRRAQPKMVTRTKK ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 GLY n 1 5 LYS n 1 6 MET n 1 7 PHE n 1 8 ILE n 1 9 GLY n 1 10 GLY n 1 11 LEU n 1 12 SER n 1 13 TRP n 1 14 GLN n 1 15 THR n 1 16 SER n 1 17 PRO n 1 18 ASP n 1 19 SER n 1 20 LEU n 1 21 ARG n 1 22 ASP n 1 23 TYR n 1 24 PHE n 1 25 SER n 1 26 LYS n 1 27 PHE n 1 28 GLY n 1 29 GLU n 1 30 ILE n 1 31 ARG n 1 32 GLU n 1 33 CYS n 1 34 MET n 1 35 VAL n 1 36 MET n 1 37 ARG n 1 38 ASP n 1 39 PRO n 1 40 THR n 1 41 THR n 1 42 LYS n 1 43 ARG n 1 44 SER n 1 45 ARG n 1 46 GLY n 1 47 PHE n 1 48 GLY n 1 49 PHE n 1 50 VAL n 1 51 THR n 1 52 PHE n 1 53 ALA n 1 54 ASP n 1 55 PRO n 1 56 ALA n 1 57 SER n 1 58 VAL n 1 59 ASP n 1 60 LYS n 1 61 VAL n 1 62 LEU n 1 63 GLY n 1 64 GLN n 1 65 PRO n 1 66 HIS n 1 67 HIS n 1 68 GLU n 1 69 LEU n 1 70 ASP n 1 71 SER n 1 72 LYS n 1 73 THR n 1 74 ILE n 1 75 ASP n 1 76 PRO n 1 77 LYS n 1 78 VAL n 1 79 ALA n 1 80 PHE n 1 81 PRO n 1 82 ARG n 1 83 ARG n 1 84 ALA n 1 85 GLN n 1 86 PRO n 1 87 LYS n 1 88 MET n 1 89 VAL n 1 90 THR n 1 91 ARG n 1 92 THR n 1 93 LYS n 1 94 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 94 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MSI2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pTBSG _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MSI2H_HUMAN _struct_ref.pdbx_db_accession Q96DH6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRR AQPKMVTRTKK ; _struct_ref.pdbx_align_begin 21 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6NTY A 4 ? 94 ? Q96DH6 21 ? 111 ? 21 111 2 1 6NTY B 4 ? 94 ? Q96DH6 21 ? 111 ? 21 111 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6NTY SER A 1 ? UNP Q96DH6 ? ? 'expression tag' 18 1 1 6NTY ASN A 2 ? UNP Q96DH6 ? ? 'expression tag' 19 2 1 6NTY ALA A 3 ? UNP Q96DH6 ? ? 'expression tag' 20 3 2 6NTY SER B 1 ? UNP Q96DH6 ? ? 'expression tag' 18 4 2 6NTY ASN B 2 ? UNP Q96DH6 ? ? 'expression tag' 19 5 2 6NTY ALA B 3 ? UNP Q96DH6 ? ? 'expression tag' 20 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6NTY _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.6 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 25 _exptl_crystal.description 'needle cluster' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.4 M ammonium phosphate dibasic, 0.1 M Tris' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-04-12 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 17-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6NTY _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.100 _reflns.d_resolution_low 40.510 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8271 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.400 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.300 _reflns.pdbx_Rmerge_I_obs 0.112 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.500 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 6 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 27686 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.993 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.100 2.160 ? ? ? ? ? ? 675 99.300 ? ? ? ? 0.801 ? ? ? ? ? ? ? ? 3.200 ? ? ? ? ? ? ? 1 1 0.559 ? 8.910 40.510 ? ? ? ? ? ? 121 98.600 ? ? ? ? 0.073 ? ? ? ? ? ? ? ? 3.200 ? ? ? ? ? ? ? 2 1 0.996 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 68.590 _refine.B_iso_mean 36.8584 _refine.B_iso_min 18.760 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6NTY _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1000 _refine.ls_d_res_low 33.0920 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8254 _refine.ls_number_reflns_R_free 440 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.3000 _refine.ls_percent_reflns_R_free 5.3300 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2096 _refine.ls_R_factor_R_free 0.2797 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2054 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.010 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB entry 5C8U' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 33.6800 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2300 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.1000 _refine_hist.d_res_low 33.0920 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 37 _refine_hist.number_atoms_total 1243 _refine_hist.pdbx_number_residues_total 162 _refine_hist.pdbx_B_iso_mean_ligand 60.59 _refine_hist.pdbx_B_iso_mean_solvent 37.50 _refine_hist.pdbx_number_atoms_protein 1201 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.1000 2.4038 2721 . 134 2587 99.0000 . . . 0.2845 0.0000 0.2195 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 2.4038 3.0282 2748 . 152 2596 100.0000 . . . 0.3189 0.0000 0.2520 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 3.0282 33.0962 2785 . 154 2631 99.0000 . . . 0.2640 0.0000 0.1843 . . . . . . 3 . . . # _struct.entry_id 6NTY _struct.title '2.1 A resolution structure of the Musashi-2 (Msi2) RNA recognition motif 1 (RRM1) domain' _struct.pdbx_descriptor 'RNA-binding protein Musashi homolog 2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6NTY _struct_keywords.text 'RNA binding, RRM1 domain, Musashi-2, RNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 16 ? SER A 25 ? SER A 33 SER A 42 1 ? 10 HELX_P HELX_P2 AA2 LYS A 26 ? GLY A 28 ? LYS A 43 GLY A 45 5 ? 3 HELX_P HELX_P3 AA3 PRO A 55 ? GLY A 63 ? PRO A 72 GLY A 80 1 ? 9 HELX_P HELX_P4 AA4 SER B 16 ? LYS B 26 ? SER B 33 LYS B 43 1 ? 11 HELX_P HELX_P5 AA5 PRO B 55 ? GLN B 64 ? PRO B 72 GLN B 81 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 5 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASP A 75 ? VAL A 78 ? ASP A 92 VAL A 95 AA1 2 LYS A 5 ? LEU A 11 ? LYS A 22 LEU A 28 AA1 3 GLY A 46 ? PHE A 52 ? GLY A 63 PHE A 69 AA1 4 ILE A 30 ? MET A 36 ? ILE A 47 MET A 53 AA1 5 PRO B 81 ? ARG B 82 ? PRO B 98 ARG B 99 AA2 1 GLU A 68 ? LEU A 69 ? GLU A 85 LEU A 86 AA2 2 LYS A 72 ? THR A 73 ? LYS A 89 THR A 90 AA3 1 PRO A 81 ? ARG A 82 ? PRO A 98 ARG A 99 AA3 2 ILE B 30 ? MET B 36 ? ILE B 47 MET B 53 AA3 3 GLY B 46 ? PHE B 52 ? GLY B 63 PHE B 69 AA3 4 LYS B 5 ? LEU B 11 ? LYS B 22 LEU B 28 AA3 5 LYS B 77 ? VAL B 78 ? LYS B 94 VAL B 95 AA4 1 HIS B 67 ? LEU B 69 ? HIS B 84 LEU B 86 AA4 2 LYS B 72 ? ILE B 74 ? LYS B 89 ILE B 91 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LYS A 77 ? O LYS A 94 N PHE A 7 ? N PHE A 24 AA1 2 3 N ILE A 8 ? N ILE A 25 O GLY A 48 ? O GLY A 65 AA1 3 4 O THR A 51 ? O THR A 68 N ARG A 31 ? N ARG A 48 AA1 4 5 N VAL A 35 ? N VAL A 52 O ARG B 82 ? O ARG B 99 AA2 1 2 N LEU A 69 ? N LEU A 86 O LYS A 72 ? O LYS A 89 AA3 1 2 N ARG A 82 ? N ARG A 99 O VAL B 35 ? O VAL B 52 AA3 2 3 N MET B 36 ? N MET B 53 O PHE B 47 ? O PHE B 64 AA3 3 4 O GLY B 48 ? O GLY B 65 N ILE B 8 ? N ILE B 25 AA3 4 5 N PHE B 7 ? N PHE B 24 O LYS B 77 ? O LYS B 94 AA4 1 2 N LEU B 69 ? N LEU B 86 O LYS B 72 ? O LYS B 89 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id PO4 _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'binding site for residue PO4 A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 SER A 44 ? SER A 61 . ? 1_555 ? 2 AC1 3 ARG A 45 ? ARG A 62 . ? 1_555 ? 3 AC1 3 HOH D . ? HOH A 301 . ? 1_555 ? # _atom_sites.entry_id 6NTY _atom_sites.fract_transf_matrix[1][1] 0.032473 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.006503 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017431 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.024685 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 18 ? ? ? A . n A 1 2 ASN 2 19 19 ASN ASN A . n A 1 3 ALA 3 20 20 ALA ALA A . n A 1 4 GLY 4 21 21 GLY GLY A . n A 1 5 LYS 5 22 22 LYS LYS A . n A 1 6 MET 6 23 23 MET MET A . n A 1 7 PHE 7 24 24 PHE PHE A . n A 1 8 ILE 8 25 25 ILE ILE A . n A 1 9 GLY 9 26 26 GLY GLY A . n A 1 10 GLY 10 27 27 GLY GLY A . n A 1 11 LEU 11 28 28 LEU LEU A . n A 1 12 SER 12 29 29 SER SER A . n A 1 13 TRP 13 30 30 TRP TRP A . n A 1 14 GLN 14 31 31 GLN GLN A . n A 1 15 THR 15 32 32 THR THR A . n A 1 16 SER 16 33 33 SER SER A . n A 1 17 PRO 17 34 34 PRO PRO A . n A 1 18 ASP 18 35 35 ASP ASP A . n A 1 19 SER 19 36 36 SER SER A . n A 1 20 LEU 20 37 37 LEU LEU A . n A 1 21 ARG 21 38 38 ARG ARG A . n A 1 22 ASP 22 39 39 ASP ASP A . n A 1 23 TYR 23 40 40 TYR TYR A . n A 1 24 PHE 24 41 41 PHE PHE A . n A 1 25 SER 25 42 42 SER SER A . n A 1 26 LYS 26 43 43 LYS LYS A . n A 1 27 PHE 27 44 44 PHE PHE A . n A 1 28 GLY 28 45 45 GLY GLY A . n A 1 29 GLU 29 46 46 GLU GLU A . n A 1 30 ILE 30 47 47 ILE ILE A . n A 1 31 ARG 31 48 48 ARG ARG A . n A 1 32 GLU 32 49 49 GLU GLU A . n A 1 33 CYS 33 50 50 CYS CYS A . n A 1 34 MET 34 51 51 MET MET A . n A 1 35 VAL 35 52 52 VAL VAL A . n A 1 36 MET 36 53 53 MET MET A . n A 1 37 ARG 37 54 54 ARG ARG A . n A 1 38 ASP 38 55 55 ASP ASP A . n A 1 39 PRO 39 56 56 PRO PRO A . n A 1 40 THR 40 57 57 THR THR A . n A 1 41 THR 41 58 58 THR THR A . n A 1 42 LYS 42 59 59 LYS LYS A . n A 1 43 ARG 43 60 60 ARG ARG A . n A 1 44 SER 44 61 61 SER SER A . n A 1 45 ARG 45 62 62 ARG ARG A . n A 1 46 GLY 46 63 63 GLY GLY A . n A 1 47 PHE 47 64 64 PHE PHE A . n A 1 48 GLY 48 65 65 GLY GLY A . n A 1 49 PHE 49 66 66 PHE PHE A . n A 1 50 VAL 50 67 67 VAL VAL A . n A 1 51 THR 51 68 68 THR THR A . n A 1 52 PHE 52 69 69 PHE PHE A . n A 1 53 ALA 53 70 70 ALA ALA A . n A 1 54 ASP 54 71 71 ASP ASP A . n A 1 55 PRO 55 72 72 PRO PRO A . n A 1 56 ALA 56 73 73 ALA ALA A . n A 1 57 SER 57 74 74 SER SER A . n A 1 58 VAL 58 75 75 VAL VAL A . n A 1 59 ASP 59 76 76 ASP ASP A . n A 1 60 LYS 60 77 77 LYS LYS A . n A 1 61 VAL 61 78 78 VAL VAL A . n A 1 62 LEU 62 79 79 LEU LEU A . n A 1 63 GLY 63 80 80 GLY GLY A . n A 1 64 GLN 64 81 81 GLN GLN A . n A 1 65 PRO 65 82 82 PRO PRO A . n A 1 66 HIS 66 83 83 HIS HIS A . n A 1 67 HIS 67 84 84 HIS HIS A . n A 1 68 GLU 68 85 85 GLU GLU A . n A 1 69 LEU 69 86 86 LEU LEU A . n A 1 70 ASP 70 87 87 ASP ASP A . n A 1 71 SER 71 88 88 SER SER A . n A 1 72 LYS 72 89 89 LYS LYS A . n A 1 73 THR 73 90 90 THR THR A . n A 1 74 ILE 74 91 91 ILE ILE A . n A 1 75 ASP 75 92 92 ASP ASP A . n A 1 76 PRO 76 93 93 PRO PRO A . n A 1 77 LYS 77 94 94 LYS LYS A . n A 1 78 VAL 78 95 95 VAL VAL A . n A 1 79 ALA 79 96 96 ALA ALA A . n A 1 80 PHE 80 97 97 PHE PHE A . n A 1 81 PRO 81 98 98 PRO PRO A . n A 1 82 ARG 82 99 99 ARG ARG A . n A 1 83 ARG 83 100 100 ARG ARG A . n A 1 84 ALA 84 101 ? ? ? A . n A 1 85 GLN 85 102 ? ? ? A . n A 1 86 PRO 86 103 ? ? ? A . n A 1 87 LYS 87 104 ? ? ? A . n A 1 88 MET 88 105 ? ? ? A . n A 1 89 VAL 89 106 ? ? ? A . n A 1 90 THR 90 107 ? ? ? A . n A 1 91 ARG 91 108 ? ? ? A . n A 1 92 THR 92 109 ? ? ? A . n A 1 93 LYS 93 110 ? ? ? A . n A 1 94 LYS 94 111 ? ? ? A . n B 1 1 SER 1 18 ? ? ? B . n B 1 2 ASN 2 19 19 ASN ASN B . n B 1 3 ALA 3 20 20 ALA ALA B . n B 1 4 GLY 4 21 21 GLY GLY B . n B 1 5 LYS 5 22 22 LYS LYS B . n B 1 6 MET 6 23 23 MET MET B . n B 1 7 PHE 7 24 24 PHE PHE B . n B 1 8 ILE 8 25 25 ILE ILE B . n B 1 9 GLY 9 26 26 GLY GLY B . n B 1 10 GLY 10 27 27 GLY GLY B . n B 1 11 LEU 11 28 28 LEU LEU B . n B 1 12 SER 12 29 29 SER SER B . n B 1 13 TRP 13 30 30 TRP TRP B . n B 1 14 GLN 14 31 31 GLN GLN B . n B 1 15 THR 15 32 32 THR THR B . n B 1 16 SER 16 33 33 SER SER B . n B 1 17 PRO 17 34 34 PRO PRO B . n B 1 18 ASP 18 35 35 ASP ASP B . n B 1 19 SER 19 36 36 SER SER B . n B 1 20 LEU 20 37 37 LEU LEU B . n B 1 21 ARG 21 38 38 ARG ARG B . n B 1 22 ASP 22 39 39 ASP ASP B . n B 1 23 TYR 23 40 40 TYR TYR B . n B 1 24 PHE 24 41 41 PHE PHE B . n B 1 25 SER 25 42 42 SER SER B . n B 1 26 LYS 26 43 43 LYS LYS B . n B 1 27 PHE 27 44 44 PHE PHE B . n B 1 28 GLY 28 45 45 GLY GLY B . n B 1 29 GLU 29 46 46 GLU GLU B . n B 1 30 ILE 30 47 47 ILE ILE B . n B 1 31 ARG 31 48 48 ARG ARG B . n B 1 32 GLU 32 49 49 GLU GLU B . n B 1 33 CYS 33 50 50 CYS CYS B . n B 1 34 MET 34 51 51 MET MET B . n B 1 35 VAL 35 52 52 VAL VAL B . n B 1 36 MET 36 53 53 MET MET B . n B 1 37 ARG 37 54 54 ARG ARG B . n B 1 38 ASP 38 55 55 ASP ASP B . n B 1 39 PRO 39 56 56 PRO PRO B . n B 1 40 THR 40 57 ? ? ? B . n B 1 41 THR 41 58 ? ? ? B . n B 1 42 LYS 42 59 59 LYS LYS B . n B 1 43 ARG 43 60 60 ARG ARG B . n B 1 44 SER 44 61 61 SER SER B . n B 1 45 ARG 45 62 62 ARG ARG B . n B 1 46 GLY 46 63 63 GLY GLY B . n B 1 47 PHE 47 64 64 PHE PHE B . n B 1 48 GLY 48 65 65 GLY GLY B . n B 1 49 PHE 49 66 66 PHE PHE B . n B 1 50 VAL 50 67 67 VAL VAL B . n B 1 51 THR 51 68 68 THR THR B . n B 1 52 PHE 52 69 69 PHE PHE B . n B 1 53 ALA 53 70 70 ALA ALA B . n B 1 54 ASP 54 71 71 ASP ASP B . n B 1 55 PRO 55 72 72 PRO PRO B . n B 1 56 ALA 56 73 73 ALA ALA B . n B 1 57 SER 57 74 74 SER SER B . n B 1 58 VAL 58 75 75 VAL VAL B . n B 1 59 ASP 59 76 76 ASP ASP B . n B 1 60 LYS 60 77 77 LYS LYS B . n B 1 61 VAL 61 78 78 VAL VAL B . n B 1 62 LEU 62 79 79 LEU LEU B . n B 1 63 GLY 63 80 80 GLY GLY B . n B 1 64 GLN 64 81 81 GLN GLN B . n B 1 65 PRO 65 82 82 PRO PRO B . n B 1 66 HIS 66 83 83 HIS HIS B . n B 1 67 HIS 67 84 84 HIS HIS B . n B 1 68 GLU 68 85 85 GLU GLU B . n B 1 69 LEU 69 86 86 LEU LEU B . n B 1 70 ASP 70 87 87 ASP ASP B . n B 1 71 SER 71 88 88 SER SER B . n B 1 72 LYS 72 89 89 LYS LYS B . n B 1 73 THR 73 90 90 THR THR B . n B 1 74 ILE 74 91 91 ILE ILE B . n B 1 75 ASP 75 92 92 ASP ASP B . n B 1 76 PRO 76 93 93 PRO PRO B . n B 1 77 LYS 77 94 94 LYS LYS B . n B 1 78 VAL 78 95 95 VAL VAL B . n B 1 79 ALA 79 96 96 ALA ALA B . n B 1 80 PHE 80 97 97 PHE PHE B . n B 1 81 PRO 81 98 98 PRO PRO B . n B 1 82 ARG 82 99 99 ARG ARG B . n B 1 83 ARG 83 100 100 ARG ARG B . n B 1 84 ALA 84 101 ? ? ? B . n B 1 85 GLN 85 102 ? ? ? B . n B 1 86 PRO 86 103 ? ? ? B . n B 1 87 LYS 87 104 ? ? ? B . n B 1 88 MET 88 105 ? ? ? B . n B 1 89 VAL 89 106 ? ? ? B . n B 1 90 THR 90 107 ? ? ? B . n B 1 91 ARG 91 108 ? ? ? B . n B 1 92 THR 92 109 ? ? ? B . n B 1 93 LYS 93 110 ? ? ? B . n B 1 94 LYS 94 111 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 PO4 1 201 1 PO4 PO4 A . D 3 HOH 1 301 28 HOH HOH A . D 3 HOH 2 302 12 HOH HOH A . D 3 HOH 3 303 8 HOH HOH A . D 3 HOH 4 304 19 HOH HOH A . D 3 HOH 5 305 29 HOH HOH A . D 3 HOH 6 306 5 HOH HOH A . D 3 HOH 7 307 3 HOH HOH A . D 3 HOH 8 308 21 HOH HOH A . D 3 HOH 9 309 25 HOH HOH A . D 3 HOH 10 310 27 HOH HOH A . D 3 HOH 11 311 6 HOH HOH A . D 3 HOH 12 312 32 HOH HOH A . D 3 HOH 13 313 11 HOH HOH A . D 3 HOH 14 314 16 HOH HOH A . D 3 HOH 15 315 31 HOH HOH A . D 3 HOH 16 316 15 HOH HOH A . D 3 HOH 17 317 30 HOH HOH A . E 3 HOH 1 201 14 HOH HOH B . E 3 HOH 2 202 37 HOH HOH B . E 3 HOH 3 203 9 HOH HOH B . E 3 HOH 4 204 13 HOH HOH B . E 3 HOH 5 205 1 HOH HOH B . E 3 HOH 6 206 4 HOH HOH B . E 3 HOH 7 207 2 HOH HOH B . E 3 HOH 8 208 36 HOH HOH B . E 3 HOH 9 209 26 HOH HOH B . E 3 HOH 10 210 10 HOH HOH B . E 3 HOH 11 211 7 HOH HOH B . E 3 HOH 12 212 38 HOH HOH B . E 3 HOH 13 213 18 HOH HOH B . E 3 HOH 14 214 17 HOH HOH B . E 3 HOH 15 215 34 HOH HOH B . E 3 HOH 16 216 22 HOH HOH B . E 3 HOH 17 217 20 HOH HOH B . E 3 HOH 18 218 33 HOH HOH B . E 3 HOH 19 219 24 HOH HOH B . E 3 HOH 20 220 35 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1640 ? 1 MORE -21 ? 1 'SSA (A^2)' 8520 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-10-23 2 'Structure model' 1 1 2019-12-04 3 'Structure model' 1 2 2020-03-18 4 'Structure model' 1 3 2020-05-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' audit_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_citation.journal_volume' 3 3 'Structure model' '_citation.page_first' 4 3 'Structure model' '_citation.page_last' 5 3 'Structure model' '_citation.title' 6 3 'Structure model' '_citation.year' 7 3 'Structure model' '_citation_author.identifier_ORCID' 8 3 'Structure model' '_citation_author.name' 9 4 'Structure model' '_audit_author.name' # _pdbx_phasing_MR.entry_id 6NTY _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO' _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 2.150 _pdbx_phasing_MR.d_res_low_rotation 32.570 _pdbx_phasing_MR.d_res_high_translation 2.150 _pdbx_phasing_MR.d_res_low_translation 32.570 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? 'Wolfgang Kabsch' Wolfgang.Kabsch@mpimf-heidelberg.mpg.de ? ? ? ? ? http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/ ? XDS ? ? package . 1 ? 'data scaling' ? ? 'Phil Evans' ? 01/02/18 ? ? ? ? http://www.mrc-lmb.cam.ac.uk/harry/pre/aimless.html ? Aimless ? ? program 0.6.3 2 ? phasing ? ? 'Randy J. Read' cimr-phaser@lists.cam.ac.uk 'Mon Feb 5 14:02:29 2018 (svn exported)' ? ? ? ? http://www-structmed.cimr.cam.ac.uk/phaser/ ? PHASER ? ? program 2.8.2 3 ? refinement ? ? 'Paul D. Adams' PDAdams@lbl.gov ? ? ? ? C++ http://www.phenix-online.org/ ? PHENIX ? ? package . 4 ? 'data extraction' ? ? PDB deposit@deposit.rcsb.org 'Sep. 1, 2017' ? ? ? C++ http://sw-tools.pdb.org/apps/PDB_EXTRACT/ ? PDB_EXTRACT ? ? package 3.24 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OG A SER 61 ? ? O A HOH 301 ? ? 2.00 2 1 O A HOH 305 ? ? O A HOH 308 ? ? 2.07 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 B _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 215 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 B _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 220 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 1_655 _pdbx_validate_symm_contact.dist 2.17 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER B 61 ? ? -159.34 -44.70 2 1 SER B 88 ? ? 88.63 -11.37 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASN 19 ? CG ? A ASN 2 CG 2 1 Y 1 A ASN 19 ? OD1 ? A ASN 2 OD1 3 1 Y 1 A ASN 19 ? ND2 ? A ASN 2 ND2 4 1 Y 1 A ASP 35 ? CG ? A ASP 18 CG 5 1 Y 1 A ASP 35 ? OD1 ? A ASP 18 OD1 6 1 Y 1 A ASP 35 ? OD2 ? A ASP 18 OD2 7 1 Y 1 A LYS 43 ? CD ? A LYS 26 CD 8 1 Y 1 A LYS 43 ? CE ? A LYS 26 CE 9 1 Y 1 A LYS 43 ? NZ ? A LYS 26 NZ 10 1 Y 1 A GLU 49 ? CG ? A GLU 32 CG 11 1 Y 1 A GLU 49 ? CD ? A GLU 32 CD 12 1 Y 1 A GLU 49 ? OE1 ? A GLU 32 OE1 13 1 Y 1 A GLU 49 ? OE2 ? A GLU 32 OE2 14 1 Y 1 A MET 51 ? CG ? A MET 34 CG 15 1 Y 1 A MET 51 ? SD ? A MET 34 SD 16 1 Y 1 A MET 51 ? CE ? A MET 34 CE 17 1 Y 1 A ARG 54 ? NE ? A ARG 37 NE 18 1 Y 1 A ARG 54 ? CZ ? A ARG 37 CZ 19 1 Y 1 A ARG 54 ? NH1 ? A ARG 37 NH1 20 1 Y 1 A ARG 54 ? NH2 ? A ARG 37 NH2 21 1 Y 1 A LYS 59 ? CG ? A LYS 42 CG 22 1 Y 1 A LYS 59 ? CD ? A LYS 42 CD 23 1 Y 1 A LYS 59 ? CE ? A LYS 42 CE 24 1 Y 1 A LYS 59 ? NZ ? A LYS 42 NZ 25 1 Y 1 A ASP 76 ? CG ? A ASP 59 CG 26 1 Y 1 A ASP 76 ? OD1 ? A ASP 59 OD1 27 1 Y 1 A ASP 76 ? OD2 ? A ASP 59 OD2 28 1 Y 1 A LYS 77 ? CD ? A LYS 60 CD 29 1 Y 1 A LYS 77 ? CE ? A LYS 60 CE 30 1 Y 1 A LYS 77 ? NZ ? A LYS 60 NZ 31 1 Y 1 A LYS 94 ? CE ? A LYS 77 CE 32 1 Y 1 A LYS 94 ? NZ ? A LYS 77 NZ 33 1 Y 1 A ARG 100 ? CG ? A ARG 83 CG 34 1 Y 1 A ARG 100 ? CD ? A ARG 83 CD 35 1 Y 1 A ARG 100 ? NE ? A ARG 83 NE 36 1 Y 1 A ARG 100 ? CZ ? A ARG 83 CZ 37 1 Y 1 A ARG 100 ? NH1 ? A ARG 83 NH1 38 1 Y 1 A ARG 100 ? NH2 ? A ARG 83 NH2 39 1 Y 1 B ASN 19 ? CG ? B ASN 2 CG 40 1 Y 1 B ASN 19 ? OD1 ? B ASN 2 OD1 41 1 Y 1 B ASN 19 ? ND2 ? B ASN 2 ND2 42 1 Y 1 B GLU 46 ? CG ? B GLU 29 CG 43 1 Y 1 B GLU 46 ? CD ? B GLU 29 CD 44 1 Y 1 B GLU 46 ? OE1 ? B GLU 29 OE1 45 1 Y 1 B GLU 46 ? OE2 ? B GLU 29 OE2 46 1 Y 1 B ARG 48 ? CZ ? B ARG 31 CZ 47 1 Y 1 B ARG 48 ? NH1 ? B ARG 31 NH1 48 1 Y 1 B ARG 48 ? NH2 ? B ARG 31 NH2 49 1 Y 1 B GLU 49 ? CG ? B GLU 32 CG 50 1 Y 1 B GLU 49 ? CD ? B GLU 32 CD 51 1 Y 1 B GLU 49 ? OE1 ? B GLU 32 OE1 52 1 Y 1 B GLU 49 ? OE2 ? B GLU 32 OE2 53 1 Y 1 B ARG 54 ? CG ? B ARG 37 CG 54 1 Y 1 B ARG 54 ? CD ? B ARG 37 CD 55 1 Y 1 B ARG 54 ? NE ? B ARG 37 NE 56 1 Y 1 B ARG 54 ? CZ ? B ARG 37 CZ 57 1 Y 1 B ARG 54 ? NH1 ? B ARG 37 NH1 58 1 Y 1 B ARG 54 ? NH2 ? B ARG 37 NH2 59 1 Y 1 B LYS 59 ? CG ? B LYS 42 CG 60 1 Y 1 B LYS 59 ? CD ? B LYS 42 CD 61 1 Y 1 B LYS 59 ? CE ? B LYS 42 CE 62 1 Y 1 B LYS 59 ? NZ ? B LYS 42 NZ 63 1 Y 1 B ARG 60 ? CG ? B ARG 43 CG 64 1 Y 1 B ARG 60 ? CD ? B ARG 43 CD 65 1 Y 1 B ARG 60 ? NE ? B ARG 43 NE 66 1 Y 1 B ARG 60 ? CZ ? B ARG 43 CZ 67 1 Y 1 B ARG 60 ? NH1 ? B ARG 43 NH1 68 1 Y 1 B ARG 60 ? NH2 ? B ARG 43 NH2 69 1 Y 1 B ARG 62 ? CD ? B ARG 45 CD 70 1 Y 1 B ARG 62 ? NE ? B ARG 45 NE 71 1 Y 1 B ARG 62 ? CZ ? B ARG 45 CZ 72 1 Y 1 B ARG 62 ? NH1 ? B ARG 45 NH1 73 1 Y 1 B ARG 62 ? NH2 ? B ARG 45 NH2 74 1 Y 1 B LYS 89 ? CD ? B LYS 72 CD 75 1 Y 1 B LYS 89 ? CE ? B LYS 72 CE 76 1 Y 1 B LYS 89 ? NZ ? B LYS 72 NZ 77 1 Y 1 B ARG 99 ? CG ? B ARG 82 CG 78 1 Y 1 B ARG 99 ? CD ? B ARG 82 CD 79 1 Y 1 B ARG 99 ? NE ? B ARG 82 NE 80 1 Y 1 B ARG 99 ? CZ ? B ARG 82 CZ 81 1 Y 1 B ARG 99 ? NH1 ? B ARG 82 NH1 82 1 Y 1 B ARG 99 ? NH2 ? B ARG 82 NH2 83 1 Y 1 B ARG 100 ? CD ? B ARG 83 CD 84 1 Y 1 B ARG 100 ? NE ? B ARG 83 NE 85 1 Y 1 B ARG 100 ? CZ ? B ARG 83 CZ 86 1 Y 1 B ARG 100 ? NH1 ? B ARG 83 NH1 87 1 Y 1 B ARG 100 ? NH2 ? B ARG 83 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 18 ? A SER 1 2 1 Y 1 A ALA 101 ? A ALA 84 3 1 Y 1 A GLN 102 ? A GLN 85 4 1 Y 1 A PRO 103 ? A PRO 86 5 1 Y 1 A LYS 104 ? A LYS 87 6 1 Y 1 A MET 105 ? A MET 88 7 1 Y 1 A VAL 106 ? A VAL 89 8 1 Y 1 A THR 107 ? A THR 90 9 1 Y 1 A ARG 108 ? A ARG 91 10 1 Y 1 A THR 109 ? A THR 92 11 1 Y 1 A LYS 110 ? A LYS 93 12 1 Y 1 A LYS 111 ? A LYS 94 13 1 Y 1 B SER 18 ? B SER 1 14 1 Y 1 B THR 57 ? B THR 40 15 1 Y 1 B THR 58 ? B THR 41 16 1 Y 1 B ALA 101 ? B ALA 84 17 1 Y 1 B GLN 102 ? B GLN 85 18 1 Y 1 B PRO 103 ? B PRO 86 19 1 Y 1 B LYS 104 ? B LYS 87 20 1 Y 1 B MET 105 ? B MET 88 21 1 Y 1 B VAL 106 ? B VAL 89 22 1 Y 1 B THR 107 ? B THR 90 23 1 Y 1 B ARG 108 ? B ARG 91 24 1 Y 1 B THR 109 ? B THR 92 25 1 Y 1 B LYS 110 ? B LYS 93 26 1 Y 1 B LYS 111 ? B LYS 94 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' R01CA191785 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' P30GM110761 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PHOSPHATE ION' PO4 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'This protein construct is dimeric in solution but is a functional monomer' #