data_6O6W # _entry.id 6O6W # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6O6W pdb_00006o6w 10.2210/pdb6o6w/pdb WWPDB D_1000239248 ? ? BMRB 30584 ? 10.13018/BMR30584 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-11-13 2 'Structure model' 1 1 2019-12-18 3 'Structure model' 1 2 2019-12-25 4 'Structure model' 2 0 2020-07-15 5 'Structure model' 2 1 2023-06-14 6 'Structure model' 2 2 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Atomic model' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Source and taxonomy' 7 5 'Structure model' 'Database references' 8 5 'Structure model' Other 9 6 'Structure model' 'Data collection' 10 6 'Structure model' 'Database references' 11 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' atom_site 5 4 'Structure model' entity_src_gen 6 4 'Structure model' pdbx_nmr_ensemble 7 4 'Structure model' pdbx_struct_sheet_hbond 8 4 'Structure model' pdbx_validate_torsion 9 4 'Structure model' struct_conf 10 4 'Structure model' struct_conn 11 4 'Structure model' struct_sheet 12 4 'Structure model' struct_sheet_order 13 4 'Structure model' struct_sheet_range 14 5 'Structure model' database_2 15 5 'Structure model' pdbx_database_status 16 6 'Structure model' chem_comp_atom 17 6 'Structure model' chem_comp_bond 18 6 'Structure model' database_2 19 6 'Structure model' pdbx_entry_details 20 6 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_citation.journal_volume' 3 3 'Structure model' '_citation.page_first' 4 3 'Structure model' '_citation.page_last' 5 3 'Structure model' '_citation.pdbx_database_id_DOI' 6 3 'Structure model' '_citation.pdbx_database_id_PubMed' 7 3 'Structure model' '_citation.title' 8 3 'Structure model' '_citation_author.identifier_ORCID' 9 4 'Structure model' '_atom_site.Cartn_x' 10 4 'Structure model' '_atom_site.Cartn_y' 11 4 'Structure model' '_atom_site.Cartn_z' 12 4 'Structure model' '_entity_src_gen.pdbx_host_org_cell_line' 13 4 'Structure model' '_entity_src_gen.pdbx_host_org_variant' 14 4 'Structure model' '_pdbx_nmr_ensemble.conformer_selection_criteria' 15 4 'Structure model' '_struct_conn.pdbx_dist_value' 16 4 'Structure model' '_struct_sheet_range.beg_auth_comp_id' 17 4 'Structure model' '_struct_sheet_range.beg_auth_seq_id' 18 4 'Structure model' '_struct_sheet_range.beg_label_comp_id' 19 4 'Structure model' '_struct_sheet_range.beg_label_seq_id' 20 4 'Structure model' '_struct_sheet_range.end_auth_comp_id' 21 4 'Structure model' '_struct_sheet_range.end_auth_seq_id' 22 4 'Structure model' '_struct_sheet_range.end_label_comp_id' 23 4 'Structure model' '_struct_sheet_range.end_label_seq_id' 24 4 'Structure model' '_struct_sheet_range.id' 25 4 'Structure model' '_struct_sheet_range.sheet_id' 26 5 'Structure model' '_database_2.pdbx_DOI' 27 5 'Structure model' '_database_2.pdbx_database_accession' 28 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 29 6 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6O6W _pdbx_database_status.recvd_initial_deposition_date 2019-03-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of human myeloid-derived growth factor' _pdbx_database_related.db_id 30584 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bortnov, V.' 1 0000-0002-1159-7338 'Tonelli, M.' 2 0000-0002-7700-5745 'Lee, W.' 3 0000-0002-0964-203X 'Markley, J.L.' 4 0000-0003-1799-6134 'Mosher, D.F.' 5 0000-0002-1233-1005 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first 5612 _citation.page_last 5612 _citation.title 'Solution structure of human myeloid-derived growth factor suggests a conserved function in the endoplasmic reticulum.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-019-13577-5 _citation.pdbx_database_id_PubMed 31819058 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bortnov, V.' 1 0000-0002-1159-7338 primary 'Tonelli, M.' 2 ? primary 'Lee, W.' 3 0000-0002-0964-203X primary 'Lin, Z.' 4 0000-0003-0464-5263 primary 'Annis, D.S.' 5 0000-0002-4897-8759 primary 'Demerdash, O.N.' 6 ? primary 'Bateman, A.' 7 ? primary 'Mitchell, J.C.' 8 0000-0002-5031-7343 primary 'Ge, Y.' 9 0000-0001-5211-6812 primary 'Markley, J.L.' 10 ? primary 'Mosher, D.F.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Myeloid-derived growth factor' _entity.formula_weight 16286.207 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details 'Cloning residues: G1-T5 Mature human MYDGF: V6-L147' # _entity_name_com.entity_id 1 _entity_name_com.name MYDGF # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSKGTVSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFT QFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL ; _entity_poly.pdbx_seq_one_letter_code_can ;GSKGTVSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFT QFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 LYS n 1 4 GLY n 1 5 THR n 1 6 VAL n 1 7 SER n 1 8 GLU n 1 9 PRO n 1 10 THR n 1 11 THR n 1 12 VAL n 1 13 ALA n 1 14 PHE n 1 15 ASP n 1 16 VAL n 1 17 ARG n 1 18 PRO n 1 19 GLY n 1 20 GLY n 1 21 VAL n 1 22 VAL n 1 23 HIS n 1 24 SER n 1 25 PHE n 1 26 SER n 1 27 HIS n 1 28 ASN n 1 29 VAL n 1 30 GLY n 1 31 PRO n 1 32 GLY n 1 33 ASP n 1 34 LYS n 1 35 TYR n 1 36 THR n 1 37 CYS n 1 38 MET n 1 39 PHE n 1 40 THR n 1 41 TYR n 1 42 ALA n 1 43 SER n 1 44 GLN n 1 45 GLY n 1 46 GLY n 1 47 THR n 1 48 ASN n 1 49 GLU n 1 50 GLN n 1 51 TRP n 1 52 GLN n 1 53 MET n 1 54 SER n 1 55 LEU n 1 56 GLY n 1 57 THR n 1 58 SER n 1 59 GLU n 1 60 ASP n 1 61 HIS n 1 62 GLN n 1 63 HIS n 1 64 PHE n 1 65 THR n 1 66 CYS n 1 67 THR n 1 68 ILE n 1 69 TRP n 1 70 ARG n 1 71 PRO n 1 72 GLN n 1 73 GLY n 1 74 LYS n 1 75 SER n 1 76 TYR n 1 77 LEU n 1 78 TYR n 1 79 PHE n 1 80 THR n 1 81 GLN n 1 82 PHE n 1 83 LYS n 1 84 ALA n 1 85 GLU n 1 86 VAL n 1 87 ARG n 1 88 GLY n 1 89 ALA n 1 90 GLU n 1 91 ILE n 1 92 GLU n 1 93 TYR n 1 94 ALA n 1 95 MET n 1 96 ALA n 1 97 TYR n 1 98 SER n 1 99 LYS n 1 100 ALA n 1 101 ALA n 1 102 PHE n 1 103 GLU n 1 104 ARG n 1 105 GLU n 1 106 SER n 1 107 ASP n 1 108 VAL n 1 109 PRO n 1 110 LEU n 1 111 LYS n 1 112 THR n 1 113 GLU n 1 114 GLU n 1 115 PHE n 1 116 GLU n 1 117 VAL n 1 118 THR n 1 119 LYS n 1 120 THR n 1 121 ALA n 1 122 VAL n 1 123 ALA n 1 124 HIS n 1 125 ARG n 1 126 PRO n 1 127 GLY n 1 128 ALA n 1 129 PHE n 1 130 LYS n 1 131 ALA n 1 132 GLU n 1 133 LEU n 1 134 SER n 1 135 LYS n 1 136 LEU n 1 137 VAL n 1 138 ILE n 1 139 VAL n 1 140 ALA n 1 141 LYS n 1 142 ALA n 1 143 SER n 1 144 ARG n 1 145 THR n 1 146 GLU n 1 147 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 147 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MYDGF, C19orf10' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details 'Gene amplified from purified eosinophil RNA by RT-PCR.' _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell 'human blood eosinophils' _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Rosetta 2(DE3)' _entity_src_gen.pdbx_host_org_variant 'MilliporeSigma 71400' _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ;pET28c(+) derivative (kanamycin resistance). Expresses proteins with N-terminal polyhistidine-tag followed by a thrombin cleavage site. ; _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-ELMER _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 MET 38 38 38 MET MET A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 TRP 51 51 51 TRP TRP A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 MET 53 53 53 MET MET A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 TRP 69 69 69 TRP TRP A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 MET 95 95 95 MET MET A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 THR 112 112 112 THR THR A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 PHE 115 115 115 PHE PHE A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 HIS 124 124 124 HIS HIS A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 ILE 138 138 138 ILE ILE A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 ARG 144 144 144 ARG ARG A . n A 1 145 THR 145 145 145 THR THR A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 LEU 147 147 147 LEU LEU A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6O6W _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6O6W _struct.title 'Solution structure of human myeloid-derived growth factor' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6O6W _struct_keywords.text 'Endoplasmic Reticulum, UPF0556, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MYDGF_HUMAN _struct_ref.pdbx_db_accession Q969H8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAE VRGAEIEYAMAYSKAAFERESDVPLKTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL ; _struct_ref.pdbx_align_begin 32 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6O6W _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 147 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q969H8 _struct_ref_seq.db_align_beg 32 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 173 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 6 _struct_ref_seq.pdbx_auth_seq_align_end 147 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6O6W GLY A 1 ? UNP Q969H8 ? ? 'expression tag' 1 1 1 6O6W SER A 2 ? UNP Q969H8 ? ? 'expression tag' 2 2 1 6O6W LYS A 3 ? UNP Q969H8 ? ? 'expression tag' 3 3 1 6O6W GLY A 4 ? UNP Q969H8 ? ? 'expression tag' 4 4 1 6O6W THR A 5 ? UNP Q969H8 ? ? 'expression tag' 5 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 30 ? LYS A 34 ? GLY A 30 LYS A 34 5 ? 5 HELX_P HELX_P2 AA2 LYS A 111 ? GLU A 113 ? LYS A 111 GLU A 113 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 37 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 66 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 37 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 66 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.031 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 37 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 66 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 37 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 66 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 10 ? VAL A 16 ? THR A 10 VAL A 16 AA1 2 GLU A 49 ? THR A 57 ? GLU A 49 THR A 57 AA1 3 HIS A 63 ? TRP A 69 ? HIS A 63 TRP A 69 AA1 4 LYS A 135 ? ALA A 142 ? LYS A 135 ALA A 142 AA1 5 ALA A 89 ? LYS A 99 ? ALA A 89 LYS A 99 AA1 6 VAL A 108 ? PRO A 109 ? VAL A 108 PRO A 109 AA2 1 VAL A 22 ? VAL A 29 ? VAL A 22 VAL A 29 AA2 2 TYR A 35 ? GLN A 44 ? TYR A 35 GLN A 44 AA2 3 TYR A 78 ? ARG A 87 ? TYR A 78 ARG A 87 AA2 4 ALA A 121 ? HIS A 124 ? ALA A 121 HIS A 124 AA2 5 PHE A 115 ? VAL A 117 ? PHE A 115 VAL A 117 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 16 ? N VAL A 16 O GLU A 49 ? O GLU A 49 AA1 2 3 N SER A 54 ? N SER A 54 O THR A 67 ? O THR A 67 AA1 3 4 N ILE A 68 ? N ILE A 68 O LEU A 136 ? O LEU A 136 AA1 4 5 O VAL A 139 ? O VAL A 139 N TYR A 93 ? N TYR A 93 AA1 5 6 N LYS A 99 ? N LYS A 99 O VAL A 108 ? O VAL A 108 AA2 1 2 N PHE A 25 ? N PHE A 25 O PHE A 39 ? O PHE A 39 AA2 2 3 N ALA A 42 ? N ALA A 42 O GLN A 81 ? O GLN A 81 AA2 3 4 N ALA A 84 ? N ALA A 84 O VAL A 122 ? O VAL A 122 AA2 4 5 O ALA A 123 ? O ALA A 123 N GLU A 116 ? N GLU A 116 # _pdbx_entry_details.entry_id 6O6W _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 5 ? ? 49.90 97.85 2 1 GLU A 103 ? ? 50.07 -107.59 3 2 GLU A 103 ? ? 58.21 -108.76 4 2 SER A 134 ? ? -129.98 -55.63 5 2 ARG A 144 ? ? 49.26 -176.36 6 2 THR A 145 ? ? 53.60 85.73 7 3 GLU A 103 ? ? 56.96 -109.35 8 4 LYS A 3 ? ? 71.45 -68.75 9 4 GLU A 103 ? ? 51.21 -109.16 10 4 SER A 134 ? ? -127.99 -69.13 11 4 THR A 145 ? ? 58.64 100.04 12 5 GLU A 103 ? ? 55.97 -109.52 13 5 ALA A 131 ? ? 71.28 32.70 14 5 SER A 134 ? ? -140.25 -54.35 15 6 THR A 5 ? ? 55.14 100.27 16 6 SER A 7 ? ? -95.10 34.29 17 6 GLU A 103 ? ? 52.09 -108.12 18 6 SER A 134 ? ? -135.21 -50.46 19 6 GLU A 146 ? ? 65.58 156.01 20 7 SER A 7 ? ? -162.82 82.64 21 7 GLU A 103 ? ? 56.34 -108.91 22 7 ALA A 131 ? ? 72.41 30.38 23 7 SER A 134 ? ? -133.70 -54.68 24 7 SER A 143 ? ? 49.98 -176.57 25 7 THR A 145 ? ? 56.84 88.37 26 8 SER A 7 ? ? -167.59 -31.08 27 8 GLU A 103 ? ? 54.63 -108.93 28 9 SER A 2 ? ? 54.36 177.84 29 9 LYS A 3 ? ? 62.92 125.19 30 9 TYR A 76 ? ? -108.07 57.25 31 9 GLU A 103 ? ? 54.47 -108.17 32 9 ALA A 128 ? ? -122.52 -53.97 33 10 LYS A 3 ? ? 65.29 -78.48 34 10 GLU A 103 ? ? 55.27 -108.52 35 10 THR A 120 ? ? -150.87 21.96 36 10 ALA A 131 ? ? 72.16 37.95 37 10 SER A 134 ? ? -133.27 -46.35 38 10 ARG A 144 ? ? 72.77 -47.28 39 10 THR A 145 ? ? 47.96 94.17 40 11 THR A 5 ? ? 58.81 147.03 41 11 GLU A 103 ? ? 50.17 -107.77 42 11 SER A 134 ? ? -135.56 -34.59 43 11 SER A 143 ? ? 52.36 -171.70 44 12 GLU A 103 ? ? 55.87 -108.39 45 12 LYS A 130 ? ? -91.47 -85.06 46 12 ALA A 131 ? ? -159.75 -14.30 47 12 SER A 134 ? ? -132.98 -44.07 48 12 THR A 145 ? ? 72.29 -49.04 49 12 GLU A 146 ? ? 60.81 90.57 50 13 SER A 2 ? ? 67.14 -70.56 51 13 GLU A 103 ? ? 59.28 -109.05 52 13 ALA A 131 ? ? 81.88 26.45 53 13 SER A 134 ? ? -133.52 -36.33 54 13 SER A 143 ? ? 54.40 173.69 55 14 SER A 2 ? ? 56.03 84.30 56 14 GLU A 103 ? ? 55.26 -108.54 57 14 SER A 134 ? ? -136.82 -59.91 58 15 LYS A 3 ? ? 63.09 129.17 59 15 GLU A 103 ? ? 61.75 -108.97 60 15 SER A 134 ? ? -131.25 -44.20 61 15 ARG A 144 ? ? 64.23 79.63 62 16 LYS A 3 ? ? -155.83 -57.32 63 16 GLU A 103 ? ? 50.45 -108.74 64 16 ALA A 128 ? ? -131.92 -31.17 65 17 GLU A 103 ? ? 54.98 -108.29 66 17 SER A 134 ? ? -126.02 -61.91 67 18 LYS A 3 ? ? 76.95 -54.60 68 18 GLU A 103 ? ? 57.91 -108.47 69 19 LYS A 3 ? ? 60.43 -84.65 70 19 GLU A 103 ? ? 57.28 -108.91 71 19 SER A 143 ? ? 51.85 -162.78 72 20 HIS A 61 ? ? 70.85 -5.14 73 20 GLU A 103 ? ? 54.65 -108.76 74 20 ALA A 131 ? ? 75.73 36.60 75 20 SER A 143 ? ? 60.16 -170.06 # _pdbx_nmr_ensemble.entry_id 6O6W _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'all calculated structures submitted' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6O6W _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;8.25 mg/mL U-15N; U-13C; NA-H MYDGF, 9 mM NA sodium phosphate, 135 mM NA sodium chloride, 15 uM NA DSS, 0.02 % w/v NA sodium azide, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 15N_13C_MYDGF _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details 'DSS was used as an internal NMR standard and sodium azide was added to prevent contamination growth.' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 MYDGF 8.25 ? mg/mL 'U-15N; U-13C; NA-H' 1 'sodium phosphate' 9 ? mM NA 1 'sodium chloride' 135 ? mM NA 1 DSS 15 ? uM NA 1 'sodium azide' 0.02 ? '% w/v' NA # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6 _pdbx_nmr_exptl_sample_conditions.ionic_strength '135 (NaCl)' _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label Condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D 1H,15N-HSQC NOESY' 1 isotropic 2 1 1 '3D 1H,13C-HSQC NOESY aliphatic' 1 isotropic 3 1 1 '3D 1H,13C-HSQC NOESY aromatic' 1 isotropic 4 1 1 '2D 1H-15N HSQC' 2 isotropic 5 1 1 '2D 1H-13C HSQC aliphatic' 2 isotropic 6 1 1 '2D 1H-13C HSQC aromatic' 1 isotropic 7 1 1 '3D CBCA(CO)NH' 2 isotropic 8 1 1 '3D HNCACB' 2 isotropic 9 1 1 '3D HNCO' 2 isotropic 10 1 1 '3D C(CO)NH' 2 isotropic 11 1 1 '3D HBHA(CO)NH' 2 isotropic 12 1 1 '3D HCCH-TOCSY aliphatic' 2 isotropic 13 1 1 '3D H(CCO)NH' 2 isotropic 14 1 1 '2D (HB)CB(CGCD)HD aromatic' 1 isotropic 15 1 1 '2D (HB)CB(CGCDCE)HDHE aromatic' 1 isotropic 16 1 1 '3D HCCH-TOCSY aromatic' 4 isotropic 20 1 1 '3D 1H,15N-HSQC NOESY 1H,13C-HSQC' 3 isotropic # loop_ _pdbx_nmr_refine.entry_id _pdbx_nmr_refine.method _pdbx_nmr_refine.details _pdbx_nmr_refine.software_ordinal 6O6W 'molecular dynamics' 'explicit water refinement' 11 6O6W 'molecular dynamics' 'explicit water refinement' 12 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection VNMR 4.2 Varian 2 collection TopSpin 3.5 'Bruker Biospin' 3 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 4 'chemical shift assignment' NMRFAM-SPARKY ? 'W. Lee, M. Tonelli and J.L. Markley' 5 'chemical shift assignment' I-PINE ? 'W. Lee, A. Bahrami, H. Dashti, H.R. Eghbalnia, M. Tonelli, W.M. Westler, J.L. Markley' 6 'peak picking' NMRFAM-SPARKY ? 'W. Lee, M. Tonelli and J.L. Markley' 7 'structure calculation' PONDEROSA-C/S ? 'W. Lee, J.L. Stark, J.L. Markley' 8 'structure calculation' TALOS-N ? 'Shen and Bax' 9 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 10 refinement PyMOL ? 'Schroedinger, Inc.' 11 refinement PONDEROSA-C/S ? 'W. Lee, J.L. Stark, J.L. Markley' 12 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 5R01AI125390-03 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 VNS ? Varian 800 ? 2 'AVANCE III' ? Bruker 600 ? 3 'AVANCE III' ? Bruker 900 ? 4 VNS ? Varian 600 ? # _atom_sites.entry_id 6O6W _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_