data_6O9T
#
_entry.id 6O9T
#
_audit_conform.dict_name mmcif_pdbx.dic
_audit_conform.dict_version 5.399
_audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic
#
loop_
_database_2.database_id
_database_2.database_code
_database_2.pdbx_database_accession
_database_2.pdbx_DOI
PDB 6O9T pdb_00006o9t 10.2210/pdb6o9t/pdb
WWPDB D_1000240269 ? ?
#
loop_
_pdbx_audit_revision_history.ordinal
_pdbx_audit_revision_history.data_content_type
_pdbx_audit_revision_history.major_revision
_pdbx_audit_revision_history.minor_revision
_pdbx_audit_revision_history.revision_date
1 'Structure model' 1 0 2020-05-27
2 'Structure model' 1 1 2020-12-09
3 'Structure model' 1 2 2020-12-16
4 'Structure model' 1 3 2023-10-11
5 'Structure model' 1 4 2024-11-20
#
_pdbx_audit_revision_details.ordinal 1
_pdbx_audit_revision_details.revision_ordinal 1
_pdbx_audit_revision_details.data_content_type 'Structure model'
_pdbx_audit_revision_details.provider repository
_pdbx_audit_revision_details.type 'Initial release'
_pdbx_audit_revision_details.description ?
_pdbx_audit_revision_details.details ?
#
loop_
_pdbx_audit_revision_group.ordinal
_pdbx_audit_revision_group.revision_ordinal
_pdbx_audit_revision_group.data_content_type
_pdbx_audit_revision_group.group
1 2 'Structure model' 'Database references'
2 2 'Structure model' 'Derived calculations'
3 3 'Structure model' 'Database references'
4 4 'Structure model' 'Data collection'
5 4 'Structure model' 'Database references'
6 4 'Structure model' 'Refinement description'
7 5 'Structure model' 'Structure summary'
#
loop_
_pdbx_audit_revision_category.ordinal
_pdbx_audit_revision_category.revision_ordinal
_pdbx_audit_revision_category.data_content_type
_pdbx_audit_revision_category.category
1 2 'Structure model' citation
2 2 'Structure model' citation_author
3 2 'Structure model' pdbx_struct_conn_angle
4 2 'Structure model' struct_conn
5 2 'Structure model' struct_conn_type
6 3 'Structure model' citation
7 3 'Structure model' citation_author
8 4 'Structure model' chem_comp_atom
9 4 'Structure model' chem_comp_bond
10 4 'Structure model' database_2
11 4 'Structure model' pdbx_initial_refinement_model
12 5 'Structure model' pdbx_entry_details
13 5 'Structure model' pdbx_modification_feature
#
loop_
_pdbx_audit_revision_item.ordinal
_pdbx_audit_revision_item.revision_ordinal
_pdbx_audit_revision_item.data_content_type
_pdbx_audit_revision_item.item
1 2 'Structure model' '_citation.country'
2 2 'Structure model' '_citation.journal_abbrev'
3 2 'Structure model' '_citation.journal_id_CSD'
4 2 'Structure model' '_citation.journal_id_ISSN'
5 2 'Structure model' '_citation.pdbx_database_id_DOI'
6 2 'Structure model' '_citation.pdbx_database_id_PubMed'
7 2 'Structure model' '_citation.title'
8 2 'Structure model' '_citation.year'
9 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'
10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'
11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id'
12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'
13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'
14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'
15 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id'
16 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'
17 2 'Structure model' '_pdbx_struct_conn_angle.value'
18 2 'Structure model' '_struct_conn.conn_type_id'
19 2 'Structure model' '_struct_conn.id'
20 2 'Structure model' '_struct_conn.pdbx_dist_value'
21 2 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'
22 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id'
23 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id'
24 2 'Structure model' '_struct_conn.ptnr1_label_atom_id'
25 2 'Structure model' '_struct_conn.ptnr1_label_comp_id'
26 2 'Structure model' '_struct_conn.ptnr1_label_seq_id'
27 2 'Structure model' '_struct_conn.ptnr2_auth_comp_id'
28 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id'
29 2 'Structure model' '_struct_conn.ptnr2_label_asym_id'
30 2 'Structure model' '_struct_conn.ptnr2_label_atom_id'
31 2 'Structure model' '_struct_conn.ptnr2_label_comp_id'
32 2 'Structure model' '_struct_conn.ptnr2_symmetry'
33 2 'Structure model' '_struct_conn_type.id'
34 3 'Structure model' '_citation.journal_volume'
35 3 'Structure model' '_citation.page_first'
36 3 'Structure model' '_citation.page_last'
37 3 'Structure model' '_citation.title'
38 3 'Structure model' '_citation_author.identifier_ORCID'
39 4 'Structure model' '_database_2.pdbx_DOI'
40 4 'Structure model' '_database_2.pdbx_database_accession'
#
_pdbx_database_status.status_code REL
_pdbx_database_status.status_code_sf REL
_pdbx_database_status.status_code_mr ?
_pdbx_database_status.entry_id 6O9T
_pdbx_database_status.recvd_initial_deposition_date 2019-03-15
_pdbx_database_status.SG_entry N
_pdbx_database_status.deposit_site RCSB
_pdbx_database_status.process_site RCSB
_pdbx_database_status.status_code_cs ?
_pdbx_database_status.methods_development_category ?
_pdbx_database_status.pdb_format_compatible Y
_pdbx_database_status.status_code_nmr_data ?
#
loop_
_audit_author.name
_audit_author.pdbx_ordinal
_audit_author.identifier_ORCID
'Gulbis, J.M.' 1 0000-0003-2091-2237
'Black, K.A.' 2 0000-0002-4094-6170
'Miller, D.M.' 3 ?
#
_citation.abstract ?
_citation.abstract_id_CAS ?
_citation.book_id_ISBN ?
_citation.book_publisher ?
_citation.book_publisher_city ?
_citation.book_title ?
_citation.coordinate_linkage ?
_citation.country UK
_citation.database_id_Medline ?
_citation.details ?
_citation.id primary
_citation.journal_abbrev 'Nat Commun'
_citation.journal_id_ASTM ?
_citation.journal_id_CSD ?
_citation.journal_id_ISSN 2041-1723
_citation.journal_full ?
_citation.journal_issue ?
_citation.journal_volume 11
_citation.language ?
_citation.page_first 3024
_citation.page_last 3024
_citation.title 'A constricted opening in Kir channels does not impede potassium conduction.'
_citation.year 2020
_citation.database_id_CSD ?
_citation.pdbx_database_id_DOI 10.1038/s41467-020-16842-0
_citation.pdbx_database_id_PubMed 32541684
_citation.unpublished_flag ?
#
loop_
_citation_author.citation_id
_citation_author.name
_citation_author.ordinal
_citation_author.identifier_ORCID
primary 'Black, K.A.' 1 ?
primary 'He, S.' 2 ?
primary 'Jin, R.' 3 ?
primary 'Miller, D.M.' 4 ?
primary 'Bolla, J.R.' 5 ?
primary 'Clarke, O.B.' 6 ?
primary 'Johnson, P.' 7 ?
primary 'Windley, M.' 8 ?
primary 'Burns, C.J.' 9 ?
primary 'Hill, A.P.' 10 ?
primary 'Laver, D.' 11 ?
primary 'Robinson, C.V.' 12 ?
primary 'Smith, B.J.' 13 ?
primary 'Gulbis, J.M.' 14 ?
#
loop_
_entity.id
_entity.type
_entity.src_method
_entity.pdbx_description
_entity.formula_weight
_entity.pdbx_number_of_molecules
_entity.pdbx_ec
_entity.pdbx_mutation
_entity.pdbx_fragment
_entity.details
1 polymer man 'Inward rectifier potassium channel Kirbac3.1' 33792.785 1 ? 'C71V, C119V, C262S, A133C, T136C' ?
?
2 non-polymer syn 'POTASSIUM ION' 39.098 2 ? ? ?
?
3 non-polymer syn '2,3,5,6-tetramethyl-1H,7H-pyrazolo[1,2-a]pyrazole-1,7-dione' 192.214 1 ? ? ?
?
#
_entity_poly.entity_id 1
_entity_poly.type 'polypeptide(L)'
_entity_poly.nstd_linkage no
_entity_poly.nstd_monomer no
_entity_poly.pdbx_seq_one_letter_code
;MTGGMKPPARKPRILNSDGSSNITRLGLEKRGWLDDHYHDLLTVSWPVFITLITGLYLVTNALFALAYLAVGDVIENARP
GSFTDAFFFSVQTMATIGYGKLIPIGPLANTLVTLEALVGMLGLAVAASLIYCRFCRPTAGVLFSSRMVISDFEGKPTLM
MRLANLRIEQIIEADVHLVLVRSEISQEGMVFRRFHDLTLTRSRSPIFSLSWTVMHPIDHHSPIYGETDETLRNSHSEFL
VLFTGHHEAFAQNVHARHAYSSDEIIWGGHFVDVFTTLPDGRRALDLGKFHEIAQHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can
;MTGGMKPPARKPRILNSDGSSNITRLGLEKRGWLDDHYHDLLTVSWPVFITLITGLYLVTNALFALAYLAVGDVIENARP
GSFTDAFFFSVQTMATIGYGKLIPIGPLANTLVTLEALVGMLGLAVAASLIYCRFCRPTAGVLFSSRMVISDFEGKPTLM
MRLANLRIEQIIEADVHLVLVRSEISQEGMVFRRFHDLTLTRSRSPIFSLSWTVMHPIDHHSPIYGETDETLRNSHSEFL
VLFTGHHEAFAQNVHARHAYSSDEIIWGGHFVDVFTTLPDGRRALDLGKFHEIAQHHHHHH
;
_entity_poly.pdbx_strand_id A
_entity_poly.pdbx_target_identifier ?
#
loop_
_pdbx_entity_nonpoly.entity_id
_pdbx_entity_nonpoly.name
_pdbx_entity_nonpoly.comp_id
2 'POTASSIUM ION' K
3 '2,3,5,6-tetramethyl-1H,7H-pyrazolo[1,2-a]pyrazole-1,7-dione' 6E3
#
loop_
_entity_poly_seq.entity_id
_entity_poly_seq.num
_entity_poly_seq.mon_id
_entity_poly_seq.hetero
1 1 MET n
1 2 THR n
1 3 GLY n
1 4 GLY n
1 5 MET n
1 6 LYS n
1 7 PRO n
1 8 PRO n
1 9 ALA n
1 10 ARG n
1 11 LYS n
1 12 PRO n
1 13 ARG n
1 14 ILE n
1 15 LEU n
1 16 ASN n
1 17 SER n
1 18 ASP n
1 19 GLY n
1 20 SER n
1 21 SER n
1 22 ASN n
1 23 ILE n
1 24 THR n
1 25 ARG n
1 26 LEU n
1 27 GLY n
1 28 LEU n
1 29 GLU n
1 30 LYS n
1 31 ARG n
1 32 GLY n
1 33 TRP n
1 34 LEU n
1 35 ASP n
1 36 ASP n
1 37 HIS n
1 38 TYR n
1 39 HIS n
1 40 ASP n
1 41 LEU n
1 42 LEU n
1 43 THR n
1 44 VAL n
1 45 SER n
1 46 TRP n
1 47 PRO n
1 48 VAL n
1 49 PHE n
1 50 ILE n
1 51 THR n
1 52 LEU n
1 53 ILE n
1 54 THR n
1 55 GLY n
1 56 LEU n
1 57 TYR n
1 58 LEU n
1 59 VAL n
1 60 THR n
1 61 ASN n
1 62 ALA n
1 63 LEU n
1 64 PHE n
1 65 ALA n
1 66 LEU n
1 67 ALA n
1 68 TYR n
1 69 LEU n
1 70 ALA n
1 71 VAL n
1 72 GLY n
1 73 ASP n
1 74 VAL n
1 75 ILE n
1 76 GLU n
1 77 ASN n
1 78 ALA n
1 79 ARG n
1 80 PRO n
1 81 GLY n
1 82 SER n
1 83 PHE n
1 84 THR n
1 85 ASP n
1 86 ALA n
1 87 PHE n
1 88 PHE n
1 89 PHE n
1 90 SER n
1 91 VAL n
1 92 GLN n
1 93 THR n
1 94 MET n
1 95 ALA n
1 96 THR n
1 97 ILE n
1 98 GLY n
1 99 TYR n
1 100 GLY n
1 101 LYS n
1 102 LEU n
1 103 ILE n
1 104 PRO n
1 105 ILE n
1 106 GLY n
1 107 PRO n
1 108 LEU n
1 109 ALA n
1 110 ASN n
1 111 THR n
1 112 LEU n
1 113 VAL n
1 114 THR n
1 115 LEU n
1 116 GLU n
1 117 ALA n
1 118 LEU n
1 119 VAL n
1 120 GLY n
1 121 MET n
1 122 LEU n
1 123 GLY n
1 124 LEU n
1 125 ALA n
1 126 VAL n
1 127 ALA n
1 128 ALA n
1 129 SER n
1 130 LEU n
1 131 ILE n
1 132 TYR n
1 133 CYS n
1 134 ARG n
1 135 PHE n
1 136 CYS n
1 137 ARG n
1 138 PRO n
1 139 THR n
1 140 ALA n
1 141 GLY n
1 142 VAL n
1 143 LEU n
1 144 PHE n
1 145 SER n
1 146 SER n
1 147 ARG n
1 148 MET n
1 149 VAL n
1 150 ILE n
1 151 SER n
1 152 ASP n
1 153 PHE n
1 154 GLU n
1 155 GLY n
1 156 LYS n
1 157 PRO n
1 158 THR n
1 159 LEU n
1 160 MET n
1 161 MET n
1 162 ARG n
1 163 LEU n
1 164 ALA n
1 165 ASN n
1 166 LEU n
1 167 ARG n
1 168 ILE n
1 169 GLU n
1 170 GLN n
1 171 ILE n
1 172 ILE n
1 173 GLU n
1 174 ALA n
1 175 ASP n
1 176 VAL n
1 177 HIS n
1 178 LEU n
1 179 VAL n
1 180 LEU n
1 181 VAL n
1 182 ARG n
1 183 SER n
1 184 GLU n
1 185 ILE n
1 186 SER n
1 187 GLN n
1 188 GLU n
1 189 GLY n
1 190 MET n
1 191 VAL n
1 192 PHE n
1 193 ARG n
1 194 ARG n
1 195 PHE n
1 196 HIS n
1 197 ASP n
1 198 LEU n
1 199 THR n
1 200 LEU n
1 201 THR n
1 202 ARG n
1 203 SER n
1 204 ARG n
1 205 SER n
1 206 PRO n
1 207 ILE n
1 208 PHE n
1 209 SER n
1 210 LEU n
1 211 SER n
1 212 TRP n
1 213 THR n
1 214 VAL n
1 215 MET n
1 216 HIS n
1 217 PRO n
1 218 ILE n
1 219 ASP n
1 220 HIS n
1 221 HIS n
1 222 SER n
1 223 PRO n
1 224 ILE n
1 225 TYR n
1 226 GLY n
1 227 GLU n
1 228 THR n
1 229 ASP n
1 230 GLU n
1 231 THR n
1 232 LEU n
1 233 ARG n
1 234 ASN n
1 235 SER n
1 236 HIS n
1 237 SER n
1 238 GLU n
1 239 PHE n
1 240 LEU n
1 241 VAL n
1 242 LEU n
1 243 PHE n
1 244 THR n
1 245 GLY n
1 246 HIS n
1 247 HIS n
1 248 GLU n
1 249 ALA n
1 250 PHE n
1 251 ALA n
1 252 GLN n
1 253 ASN n
1 254 VAL n
1 255 HIS n
1 256 ALA n
1 257 ARG n
1 258 HIS n
1 259 ALA n
1 260 TYR n
1 261 SER n
1 262 SER n
1 263 ASP n
1 264 GLU n
1 265 ILE n
1 266 ILE n
1 267 TRP n
1 268 GLY n
1 269 GLY n
1 270 HIS n
1 271 PHE n
1 272 VAL n
1 273 ASP n
1 274 VAL n
1 275 PHE n
1 276 THR n
1 277 THR n
1 278 LEU n
1 279 PRO n
1 280 ASP n
1 281 GLY n
1 282 ARG n
1 283 ARG n
1 284 ALA n
1 285 LEU n
1 286 ASP n
1 287 LEU n
1 288 GLY n
1 289 LYS n
1 290 PHE n
1 291 HIS n
1 292 GLU n
1 293 ILE n
1 294 ALA n
1 295 GLN n
1 296 HIS n
1 297 HIS n
1 298 HIS n
1 299 HIS n
1 300 HIS n
1 301 HIS n
#
_entity_src_gen.entity_id 1
_entity_src_gen.pdbx_src_id 1
_entity_src_gen.pdbx_alt_source_flag sample
_entity_src_gen.pdbx_seq_type 'Biological sequence'
_entity_src_gen.pdbx_beg_seq_num 1
_entity_src_gen.pdbx_end_seq_num 301
_entity_src_gen.gene_src_common_name ?
_entity_src_gen.gene_src_genus ?
_entity_src_gen.pdbx_gene_src_gene ?
_entity_src_gen.gene_src_species ?
_entity_src_gen.gene_src_strain ?
_entity_src_gen.gene_src_tissue ?
_entity_src_gen.gene_src_tissue_fraction ?
_entity_src_gen.gene_src_details ?
_entity_src_gen.pdbx_gene_src_fragment ?
_entity_src_gen.pdbx_gene_src_scientific_name 'Magnetospirillum magnetotacticum'
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 188
_entity_src_gen.pdbx_gene_src_variant ?
_entity_src_gen.pdbx_gene_src_cell_line ?
_entity_src_gen.pdbx_gene_src_atcc ?
_entity_src_gen.pdbx_gene_src_organ ?
_entity_src_gen.pdbx_gene_src_organelle ?
_entity_src_gen.pdbx_gene_src_cell ?
_entity_src_gen.pdbx_gene_src_cellular_location ?
_entity_src_gen.host_org_common_name ?
_entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli'
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562
_entity_src_gen.host_org_genus ?
_entity_src_gen.pdbx_host_org_gene ?
_entity_src_gen.pdbx_host_org_organ ?
_entity_src_gen.host_org_species ?
_entity_src_gen.pdbx_host_org_tissue ?
_entity_src_gen.pdbx_host_org_tissue_fraction ?
_entity_src_gen.pdbx_host_org_strain ?
_entity_src_gen.pdbx_host_org_variant ?
_entity_src_gen.pdbx_host_org_cell_line ?
_entity_src_gen.pdbx_host_org_atcc ?
_entity_src_gen.pdbx_host_org_culture_collection ?
_entity_src_gen.pdbx_host_org_cell ?
_entity_src_gen.pdbx_host_org_organelle ?
_entity_src_gen.pdbx_host_org_cellular_location ?
_entity_src_gen.pdbx_host_org_vector_type ?
_entity_src_gen.pdbx_host_org_vector ?
_entity_src_gen.host_org_details ?
_entity_src_gen.expression_system_id ?
_entity_src_gen.plasmid_name ?
_entity_src_gen.plasmid_details ?
_entity_src_gen.pdbx_description ?
#
loop_
_chem_comp.id
_chem_comp.type
_chem_comp.mon_nstd_flag
_chem_comp.name
_chem_comp.pdbx_synonyms
_chem_comp.formula
_chem_comp.formula_weight
6E3 non-polymer . '2,3,5,6-tetramethyl-1H,7H-pyrazolo[1,2-a]pyrazole-1,7-dione' ? 'C10 H12 N2 O2' 192.214
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129
GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173
K non-polymer . 'POTASSIUM ION' ? 'K 1' 39.098
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146
#
loop_
_pdbx_poly_seq_scheme.asym_id
_pdbx_poly_seq_scheme.entity_id
_pdbx_poly_seq_scheme.seq_id
_pdbx_poly_seq_scheme.mon_id
_pdbx_poly_seq_scheme.ndb_seq_num
_pdbx_poly_seq_scheme.pdb_seq_num
_pdbx_poly_seq_scheme.auth_seq_num
_pdbx_poly_seq_scheme.pdb_mon_id
_pdbx_poly_seq_scheme.auth_mon_id
_pdbx_poly_seq_scheme.pdb_strand_id
_pdbx_poly_seq_scheme.pdb_ins_code
_pdbx_poly_seq_scheme.hetero
A 1 1 MET 1 1 ? ? ? A . n
A 1 2 THR 2 2 ? ? ? A . n
A 1 3 GLY 3 3 ? ? ? A . n
A 1 4 GLY 4 4 ? ? ? A . n
A 1 5 MET 5 5 ? ? ? A . n
A 1 6 LYS 6 6 ? ? ? A . n
A 1 7 PRO 7 7 ? ? ? A . n
A 1 8 PRO 8 8 ? ? ? A . n
A 1 9 ALA 9 9 ? ? ? A . n
A 1 10 ARG 10 10 ? ? ? A . n
A 1 11 LYS 11 11 ? ? ? A . n
A 1 12 PRO 12 12 12 PRO PRO A . n
A 1 13 ARG 13 13 13 ARG ARG A . n
A 1 14 ILE 14 14 14 ILE ILE A . n
A 1 15 LEU 15 15 15 LEU LEU A . n
A 1 16 ASN 16 16 16 ASN ASN A . n
A 1 17 SER 17 17 17 SER SER A . n
A 1 18 ASP 18 18 18 ASP ASP A . n
A 1 19 GLY 19 19 19 GLY GLY A . n
A 1 20 SER 20 20 20 SER SER A . n
A 1 21 SER 21 21 21 SER SER A . n
A 1 22 ASN 22 22 22 ASN ASN A . n
A 1 23 ILE 23 23 23 ILE ILE A . n
A 1 24 THR 24 24 24 THR THR A . n
A 1 25 ARG 25 25 25 ARG ARG A . n
A 1 26 LEU 26 26 26 LEU LEU A . n
A 1 27 GLY 27 27 ? ? ? A . n
A 1 28 LEU 28 28 ? ? ? A . n
A 1 29 GLU 29 29 ? ? ? A . n
A 1 30 LYS 30 30 ? ? ? A . n
A 1 31 ARG 31 31 ? ? ? A . n
A 1 32 GLY 32 32 ? ? ? A . n
A 1 33 TRP 33 33 ? ? ? A . n
A 1 34 LEU 34 34 ? ? ? A . n
A 1 35 ASP 35 35 35 ASP ASP A . n
A 1 36 ASP 36 36 36 ASP ASP A . n
A 1 37 HIS 37 37 37 HIS HIS A . n
A 1 38 TYR 38 38 38 TYR TYR A . n
A 1 39 HIS 39 39 39 HIS HIS A . n
A 1 40 ASP 40 40 40 ASP ASP A . n
A 1 41 LEU 41 41 41 LEU LEU A . n
A 1 42 LEU 42 42 42 LEU LEU A . n
A 1 43 THR 43 43 43 THR THR A . n
A 1 44 VAL 44 44 44 VAL VAL A . n
A 1 45 SER 45 45 45 SER SER A . n
A 1 46 TRP 46 46 46 TRP TRP A . n
A 1 47 PRO 47 47 47 PRO PRO A . n
A 1 48 VAL 48 48 48 VAL VAL A . n
A 1 49 PHE 49 49 49 PHE PHE A . n
A 1 50 ILE 50 50 50 ILE ILE A . n
A 1 51 THR 51 51 51 THR THR A . n
A 1 52 LEU 52 52 52 LEU LEU A . n
A 1 53 ILE 53 53 53 ILE ILE A . n
A 1 54 THR 54 54 54 THR THR A . n
A 1 55 GLY 55 55 55 GLY GLY A . n
A 1 56 LEU 56 56 56 LEU LEU A . n
A 1 57 TYR 57 57 57 TYR TYR A . n
A 1 58 LEU 58 58 58 LEU LEU A . n
A 1 59 VAL 59 59 59 VAL VAL A . n
A 1 60 THR 60 60 60 THR THR A . n
A 1 61 ASN 61 61 61 ASN ASN A . n
A 1 62 ALA 62 62 62 ALA ALA A . n
A 1 63 LEU 63 63 63 LEU LEU A . n
A 1 64 PHE 64 64 64 PHE PHE A . n
A 1 65 ALA 65 65 65 ALA ALA A . n
A 1 66 LEU 66 66 66 LEU LEU A . n
A 1 67 ALA 67 67 67 ALA ALA A . n
A 1 68 TYR 68 68 68 TYR TYR A . n
A 1 69 LEU 69 69 69 LEU LEU A . n
A 1 70 ALA 70 70 70 ALA ALA A . n
A 1 71 VAL 71 71 71 VAL VAL A . n
A 1 72 GLY 72 72 72 GLY GLY A . n
A 1 73 ASP 73 73 73 ASP ASP A . n
A 1 74 VAL 74 74 74 VAL VAL A . n
A 1 75 ILE 75 75 75 ILE ILE A . n
A 1 76 GLU 76 76 76 GLU GLU A . n
A 1 77 ASN 77 77 77 ASN ASN A . n
A 1 78 ALA 78 78 78 ALA ALA A . n
A 1 79 ARG 79 79 79 ARG ARG A . n
A 1 80 PRO 80 80 80 PRO PRO A . n
A 1 81 GLY 81 81 81 GLY GLY A . n
A 1 82 SER 82 82 82 SER SER A . n
A 1 83 PHE 83 83 83 PHE PHE A . n
A 1 84 THR 84 84 84 THR THR A . n
A 1 85 ASP 85 85 85 ASP ASP A . n
A 1 86 ALA 86 86 86 ALA ALA A . n
A 1 87 PHE 87 87 87 PHE PHE A . n
A 1 88 PHE 88 88 88 PHE PHE A . n
A 1 89 PHE 89 89 89 PHE PHE A . n
A 1 90 SER 90 90 90 SER SER A . n
A 1 91 VAL 91 91 91 VAL VAL A . n
A 1 92 GLN 92 92 92 GLN GLN A . n
A 1 93 THR 93 93 93 THR THR A . n
A 1 94 MET 94 94 94 MET MET A . n
A 1 95 ALA 95 95 95 ALA ALA A . n
A 1 96 THR 96 96 96 THR THR A . n
A 1 97 ILE 97 97 97 ILE ILE A . n
A 1 98 GLY 98 98 98 GLY GLY A . n
A 1 99 TYR 99 99 99 TYR TYR A . n
A 1 100 GLY 100 100 100 GLY GLY A . n
A 1 101 LYS 101 101 101 LYS LYS A . n
A 1 102 LEU 102 102 102 LEU LEU A . n
A 1 103 ILE 103 103 103 ILE ILE A . n
A 1 104 PRO 104 104 104 PRO PRO A . n
A 1 105 ILE 105 105 105 ILE ILE A . n
A 1 106 GLY 106 106 106 GLY GLY A . n
A 1 107 PRO 107 107 107 PRO PRO A . n
A 1 108 LEU 108 108 108 LEU LEU A . n
A 1 109 ALA 109 109 109 ALA ALA A . n
A 1 110 ASN 110 110 110 ASN ASN A . n
A 1 111 THR 111 111 111 THR THR A . n
A 1 112 LEU 112 112 112 LEU LEU A . n
A 1 113 VAL 113 113 113 VAL VAL A . n
A 1 114 THR 114 114 114 THR THR A . n
A 1 115 LEU 115 115 115 LEU LEU A . n
A 1 116 GLU 116 116 116 GLU GLU A . n
A 1 117 ALA 117 117 117 ALA ALA A . n
A 1 118 LEU 118 118 118 LEU LEU A . n
A 1 119 VAL 119 119 119 VAL VAL A . n
A 1 120 GLY 120 120 120 GLY GLY A . n
A 1 121 MET 121 121 121 MET MET A . n
A 1 122 LEU 122 122 122 LEU LEU A . n
A 1 123 GLY 123 123 123 GLY GLY A . n
A 1 124 LEU 124 124 124 LEU LEU A . n
A 1 125 ALA 125 125 125 ALA ALA A . n
A 1 126 VAL 126 126 126 VAL VAL A . n
A 1 127 ALA 127 127 127 ALA ALA A . n
A 1 128 ALA 128 128 128 ALA ALA A . n
A 1 129 SER 129 129 129 SER SER A . n
A 1 130 LEU 130 130 130 LEU LEU A . n
A 1 131 ILE 131 131 131 ILE ILE A . n
A 1 132 TYR 132 132 132 TYR TYR A . n
A 1 133 CYS 133 133 133 CYS CYS A . n
A 1 134 ARG 134 134 134 ARG ARG A . n
A 1 135 PHE 135 135 135 PHE PHE A . n
A 1 136 CYS 136 136 136 CYS CYS A . n
A 1 137 ARG 137 137 137 ARG ARG A . n
A 1 138 PRO 138 138 138 PRO PRO A . n
A 1 139 THR 139 139 139 THR THR A . n
A 1 140 ALA 140 140 140 ALA ALA A . n
A 1 141 GLY 141 141 141 GLY GLY A . n
A 1 142 VAL 142 142 142 VAL VAL A . n
A 1 143 LEU 143 143 143 LEU LEU A . n
A 1 144 PHE 144 144 144 PHE PHE A . n
A 1 145 SER 145 145 145 SER SER A . n
A 1 146 SER 146 146 146 SER SER A . n
A 1 147 ARG 147 147 147 ARG ARG A . n
A 1 148 MET 148 148 148 MET MET A . n
A 1 149 VAL 149 149 149 VAL VAL A . n
A 1 150 ILE 150 150 150 ILE ILE A . n
A 1 151 SER 151 151 151 SER SER A . n
A 1 152 ASP 152 152 152 ASP ASP A . n
A 1 153 PHE 153 153 153 PHE PHE A . n
A 1 154 GLU 154 154 154 GLU GLU A . n
A 1 155 GLY 155 155 155 GLY GLY A . n
A 1 156 LYS 156 156 156 LYS LYS A . n
A 1 157 PRO 157 157 157 PRO PRO A . n
A 1 158 THR 158 158 158 THR THR A . n
A 1 159 LEU 159 159 159 LEU LEU A . n
A 1 160 MET 160 160 160 MET MET A . n
A 1 161 MET 161 161 161 MET MET A . n
A 1 162 ARG 162 162 162 ARG ARG A . n
A 1 163 LEU 163 163 163 LEU LEU A . n
A 1 164 ALA 164 164 164 ALA ALA A . n
A 1 165 ASN 165 165 165 ASN ASN A . n
A 1 166 LEU 166 166 166 LEU LEU A . n
A 1 167 ARG 167 167 167 ARG ARG A . n
A 1 168 ILE 168 168 168 ILE ILE A . n
A 1 169 GLU 169 169 169 GLU GLU A . n
A 1 170 GLN 170 170 170 GLN GLN A . n
A 1 171 ILE 171 171 171 ILE ILE A . n
A 1 172 ILE 172 172 172 ILE ILE A . n
A 1 173 GLU 173 173 173 GLU GLU A . n
A 1 174 ALA 174 174 174 ALA ALA A . n
A 1 175 ASP 175 175 175 ASP ASP A . n
A 1 176 VAL 176 176 176 VAL VAL A . n
A 1 177 HIS 177 177 177 HIS HIS A . n
A 1 178 LEU 178 178 178 LEU LEU A . n
A 1 179 VAL 179 179 179 VAL VAL A . n
A 1 180 LEU 180 180 180 LEU LEU A . n
A 1 181 VAL 181 181 181 VAL VAL A . n
A 1 182 ARG 182 182 182 ARG ARG A . n
A 1 183 SER 183 183 183 SER SER A . n
A 1 184 GLU 184 184 184 GLU GLU A . n
A 1 185 ILE 185 185 185 ILE ILE A . n
A 1 186 SER 186 186 186 SER SER A . n
A 1 187 GLN 187 187 187 GLN GLN A . n
A 1 188 GLU 188 188 188 GLU GLU A . n
A 1 189 GLY 189 189 189 GLY GLY A . n
A 1 190 MET 190 190 190 MET MET A . n
A 1 191 VAL 191 191 191 VAL VAL A . n
A 1 192 PHE 192 192 192 PHE PHE A . n
A 1 193 ARG 193 193 193 ARG ARG A . n
A 1 194 ARG 194 194 194 ARG ARG A . n
A 1 195 PHE 195 195 195 PHE PHE A . n
A 1 196 HIS 196 196 196 HIS HIS A . n
A 1 197 ASP 197 197 197 ASP ASP A . n
A 1 198 LEU 198 198 198 LEU LEU A . n
A 1 199 THR 199 199 199 THR THR A . n
A 1 200 LEU 200 200 200 LEU LEU A . n
A 1 201 THR 201 201 201 THR THR A . n
A 1 202 ARG 202 202 202 ARG ARG A . n
A 1 203 SER 203 203 203 SER SER A . n
A 1 204 ARG 204 204 204 ARG ARG A . n
A 1 205 SER 205 205 205 SER SER A . n
A 1 206 PRO 206 206 206 PRO PRO A . n
A 1 207 ILE 207 207 207 ILE ILE A . n
A 1 208 PHE 208 208 208 PHE PHE A . n
A 1 209 SER 209 209 209 SER SER A . n
A 1 210 LEU 210 210 210 LEU LEU A . n
A 1 211 SER 211 211 211 SER SER A . n
A 1 212 TRP 212 212 212 TRP TRP A . n
A 1 213 THR 213 213 213 THR THR A . n
A 1 214 VAL 214 214 214 VAL VAL A . n
A 1 215 MET 215 215 215 MET MET A . n
A 1 216 HIS 216 216 216 HIS HIS A . n
A 1 217 PRO 217 217 217 PRO PRO A . n
A 1 218 ILE 218 218 218 ILE ILE A . n
A 1 219 ASP 219 219 219 ASP ASP A . n
A 1 220 HIS 220 220 220 HIS HIS A . n
A 1 221 HIS 221 221 221 HIS HIS A . n
A 1 222 SER 222 222 222 SER SER A . n
A 1 223 PRO 223 223 223 PRO PRO A . n
A 1 224 ILE 224 224 224 ILE ILE A . n
A 1 225 TYR 225 225 225 TYR TYR A . n
A 1 226 GLY 226 226 226 GLY GLY A . n
A 1 227 GLU 227 227 227 GLU GLU A . n
A 1 228 THR 228 228 228 THR THR A . n
A 1 229 ASP 229 229 229 ASP ASP A . n
A 1 230 GLU 230 230 230 GLU GLU A . n
A 1 231 THR 231 231 231 THR THR A . n
A 1 232 LEU 232 232 232 LEU LEU A . n
A 1 233 ARG 233 233 233 ARG ARG A . n
A 1 234 ASN 234 234 234 ASN ASN A . n
A 1 235 SER 235 235 235 SER SER A . n
A 1 236 HIS 236 236 236 HIS HIS A . n
A 1 237 SER 237 237 237 SER SER A . n
A 1 238 GLU 238 238 238 GLU GLU A . n
A 1 239 PHE 239 239 239 PHE PHE A . n
A 1 240 LEU 240 240 240 LEU LEU A . n
A 1 241 VAL 241 241 241 VAL VAL A . n
A 1 242 LEU 242 242 242 LEU LEU A . n
A 1 243 PHE 243 243 243 PHE PHE A . n
A 1 244 THR 244 244 244 THR THR A . n
A 1 245 GLY 245 245 245 GLY GLY A . n
A 1 246 HIS 246 246 246 HIS HIS A . n
A 1 247 HIS 247 247 247 HIS HIS A . n
A 1 248 GLU 248 248 248 GLU GLU A . n
A 1 249 ALA 249 249 249 ALA ALA A . n
A 1 250 PHE 250 250 250 PHE PHE A . n
A 1 251 ALA 251 251 251 ALA ALA A . n
A 1 252 GLN 252 252 252 GLN GLN A . n
A 1 253 ASN 253 253 253 ASN ASN A . n
A 1 254 VAL 254 254 254 VAL VAL A . n
A 1 255 HIS 255 255 255 HIS HIS A . n
A 1 256 ALA 256 256 256 ALA ALA A . n
A 1 257 ARG 257 257 257 ARG ARG A . n
A 1 258 HIS 258 258 258 HIS HIS A . n
A 1 259 ALA 259 259 259 ALA ALA A . n
A 1 260 TYR 260 260 260 TYR TYR A . n
A 1 261 SER 261 261 261 SER SER A . n
A 1 262 SER 262 262 262 SER SER A . n
A 1 263 ASP 263 263 263 ASP ASP A . n
A 1 264 GLU 264 264 264 GLU GLU A . n
A 1 265 ILE 265 265 265 ILE ILE A . n
A 1 266 ILE 266 266 266 ILE ILE A . n
A 1 267 TRP 267 267 267 TRP TRP A . n
A 1 268 GLY 268 268 268 GLY GLY A . n
A 1 269 GLY 269 269 269 GLY GLY A . n
A 1 270 HIS 270 270 270 HIS HIS A . n
A 1 271 PHE 271 271 271 PHE PHE A . n
A 1 272 VAL 272 272 272 VAL VAL A . n
A 1 273 ASP 273 273 273 ASP ASP A . n
A 1 274 VAL 274 274 274 VAL VAL A . n
A 1 275 PHE 275 275 275 PHE PHE A . n
A 1 276 THR 276 276 276 THR THR A . n
A 1 277 THR 277 277 277 THR THR A . n
A 1 278 LEU 278 278 278 LEU LEU A . n
A 1 279 PRO 279 279 279 PRO PRO A . n
A 1 280 ASP 280 280 280 ASP ASP A . n
A 1 281 GLY 281 281 281 GLY GLY A . n
A 1 282 ARG 282 282 282 ARG ARG A . n
A 1 283 ARG 283 283 283 ARG ARG A . n
A 1 284 ALA 284 284 284 ALA ALA A . n
A 1 285 LEU 285 285 285 LEU LEU A . n
A 1 286 ASP 286 286 286 ASP ASP A . n
A 1 287 LEU 287 287 287 LEU LEU A . n
A 1 288 GLY 288 288 288 GLY GLY A . n
A 1 289 LYS 289 289 289 LYS LYS A . n
A 1 290 PHE 290 290 290 PHE PHE A . n
A 1 291 HIS 291 291 291 HIS HIS A . n
A 1 292 GLU 292 292 292 GLU GLU A . n
A 1 293 ILE 293 293 293 ILE ILE A . n
A 1 294 ALA 294 294 ? ? ? A . n
A 1 295 GLN 295 295 ? ? ? A . n
A 1 296 HIS 296 296 ? ? ? A . n
A 1 297 HIS 297 297 ? ? ? A . n
A 1 298 HIS 298 298 ? ? ? A . n
A 1 299 HIS 299 299 ? ? ? A . n
A 1 300 HIS 300 300 ? ? ? A . n
A 1 301 HIS 301 301 ? ? ? A . n
#
_pdbx_entity_instance_feature.ordinal 1
_pdbx_entity_instance_feature.comp_id 6E3
_pdbx_entity_instance_feature.asym_id ?
_pdbx_entity_instance_feature.seq_num ?
_pdbx_entity_instance_feature.auth_comp_id 6E3
_pdbx_entity_instance_feature.auth_asym_id ?
_pdbx_entity_instance_feature.auth_seq_num ?
_pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION'
_pdbx_entity_instance_feature.details ?
#
loop_
_pdbx_nonpoly_scheme.asym_id
_pdbx_nonpoly_scheme.entity_id
_pdbx_nonpoly_scheme.mon_id
_pdbx_nonpoly_scheme.ndb_seq_num
_pdbx_nonpoly_scheme.pdb_seq_num
_pdbx_nonpoly_scheme.auth_seq_num
_pdbx_nonpoly_scheme.pdb_mon_id
_pdbx_nonpoly_scheme.auth_mon_id
_pdbx_nonpoly_scheme.pdb_strand_id
_pdbx_nonpoly_scheme.pdb_ins_code
B 2 K 1 401 1 K K A .
C 2 K 1 402 4 K K A .
D 3 6E3 1 403 500 6E3 6E3 A .
#
loop_
_pdbx_unobs_or_zero_occ_atoms.id
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num
_pdbx_unobs_or_zero_occ_atoms.polymer_flag
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id
_pdbx_unobs_or_zero_occ_atoms.label_alt_id
_pdbx_unobs_or_zero_occ_atoms.label_asym_id
_pdbx_unobs_or_zero_occ_atoms.label_comp_id
_pdbx_unobs_or_zero_occ_atoms.label_seq_id
_pdbx_unobs_or_zero_occ_atoms.label_atom_id
1 1 Y 1 A LEU 15 ? CG ? A LEU 15 CG
2 1 Y 1 A LEU 15 ? CD1 ? A LEU 15 CD1
3 1 Y 1 A LEU 15 ? CD2 ? A LEU 15 CD2
4 1 Y 1 A SER 20 ? OG ? A SER 20 OG
5 1 Y 1 A ASP 35 ? CG ? A ASP 35 CG
6 1 Y 1 A ASP 35 ? OD1 ? A ASP 35 OD1
7 1 Y 1 A ASP 35 ? OD2 ? A ASP 35 OD2
8 1 Y 1 A LEU 42 ? CG ? A LEU 42 CG
9 1 Y 1 A LEU 42 ? CD1 ? A LEU 42 CD1
10 1 Y 1 A LEU 42 ? CD2 ? A LEU 42 CD2
11 1 Y 1 A ILE 53 ? CG1 ? A ILE 53 CG1
12 1 Y 1 A ILE 53 ? CG2 ? A ILE 53 CG2
13 1 Y 1 A ILE 53 ? CD1 ? A ILE 53 CD1
14 1 Y 1 A VAL 71 ? CG1 ? A VAL 71 CG1
15 1 Y 1 A VAL 71 ? CG2 ? A VAL 71 CG2
16 1 Y 1 A ARG 79 ? CG ? A ARG 79 CG
17 1 Y 1 A ARG 79 ? CD ? A ARG 79 CD
18 1 Y 1 A ARG 79 ? NE ? A ARG 79 NE
19 1 Y 1 A ARG 79 ? CZ ? A ARG 79 CZ
20 1 Y 1 A ARG 79 ? NH1 ? A ARG 79 NH1
21 1 Y 1 A ARG 79 ? NH2 ? A ARG 79 NH2
22 1 Y 1 A LYS 101 ? CG ? A LYS 101 CG
23 1 Y 1 A LYS 101 ? CD ? A LYS 101 CD
24 1 Y 1 A LYS 101 ? CE ? A LYS 101 CE
25 1 Y 1 A LYS 101 ? NZ ? A LYS 101 NZ
26 1 Y 1 A LEU 108 ? CG ? A LEU 108 CG
27 1 Y 1 A LEU 108 ? CD1 ? A LEU 108 CD1
28 1 Y 1 A LEU 108 ? CD2 ? A LEU 108 CD2
29 1 Y 1 A ARG 147 ? CG ? A ARG 147 CG
30 1 Y 1 A ARG 147 ? CD ? A ARG 147 CD
31 1 Y 1 A ARG 147 ? NE ? A ARG 147 NE
32 1 Y 1 A ARG 147 ? CZ ? A ARG 147 CZ
33 1 Y 1 A ARG 147 ? NH1 ? A ARG 147 NH1
34 1 Y 1 A ARG 147 ? NH2 ? A ARG 147 NH2
35 1 Y 1 A ILE 150 ? CD1 ? A ILE 150 CD1
36 1 Y 1 A SER 151 ? OG ? A SER 151 OG
37 1 Y 1 A GLU 169 ? CG ? A GLU 169 CG
38 1 Y 1 A GLU 169 ? CD ? A GLU 169 CD
39 1 Y 1 A GLU 169 ? OE1 ? A GLU 169 OE1
40 1 Y 1 A GLU 169 ? OE2 ? A GLU 169 OE2
41 1 Y 1 A GLU 173 ? CG ? A GLU 173 CG
42 1 Y 1 A GLU 173 ? CD ? A GLU 173 CD
43 1 Y 1 A GLU 173 ? OE1 ? A GLU 173 OE1
44 1 Y 1 A GLU 173 ? OE2 ? A GLU 173 OE2
45 1 Y 1 A ASP 175 ? CG ? A ASP 175 CG
46 1 Y 1 A ASP 175 ? OD1 ? A ASP 175 OD1
47 1 Y 1 A ASP 175 ? OD2 ? A ASP 175 OD2
48 1 Y 1 A ILE 185 ? CG1 ? A ILE 185 CG1
49 1 Y 1 A ILE 185 ? CG2 ? A ILE 185 CG2
50 1 Y 1 A ILE 185 ? CD1 ? A ILE 185 CD1
51 1 Y 1 A GLU 188 ? CG ? A GLU 188 CG
52 1 Y 1 A GLU 188 ? CD ? A GLU 188 CD
53 1 Y 1 A GLU 188 ? OE1 ? A GLU 188 OE1
54 1 Y 1 A GLU 188 ? OE2 ? A GLU 188 OE2
55 1 Y 1 A MET 190 ? CG ? A MET 190 CG
56 1 Y 1 A MET 190 ? SD ? A MET 190 SD
57 1 Y 1 A MET 190 ? CE ? A MET 190 CE
58 1 Y 1 A ARG 193 ? CG ? A ARG 193 CG
59 1 Y 1 A ARG 193 ? CD ? A ARG 193 CD
60 1 Y 1 A ARG 193 ? NE ? A ARG 193 NE
61 1 Y 1 A ARG 193 ? CZ ? A ARG 193 CZ
62 1 Y 1 A ARG 193 ? NH1 ? A ARG 193 NH1
63 1 Y 1 A ARG 193 ? NH2 ? A ARG 193 NH2
64 1 Y 1 A ARG 194 ? CG ? A ARG 194 CG
65 1 Y 1 A ARG 194 ? CD ? A ARG 194 CD
66 1 Y 1 A ARG 194 ? NE ? A ARG 194 NE
67 1 Y 1 A ARG 194 ? CZ ? A ARG 194 CZ
68 1 Y 1 A ARG 194 ? NH1 ? A ARG 194 NH1
69 1 Y 1 A ARG 194 ? NH2 ? A ARG 194 NH2
70 1 Y 1 A LEU 210 ? CG ? A LEU 210 CG
71 1 Y 1 A LEU 210 ? CD1 ? A LEU 210 CD1
72 1 Y 1 A LEU 210 ? CD2 ? A LEU 210 CD2
73 1 Y 1 A HIS 270 ? CG ? A HIS 270 CG
74 1 Y 1 A HIS 270 ? ND1 ? A HIS 270 ND1
75 1 Y 1 A HIS 270 ? CD2 ? A HIS 270 CD2
76 1 Y 1 A HIS 270 ? CE1 ? A HIS 270 CE1
77 1 Y 1 A HIS 270 ? NE2 ? A HIS 270 NE2
78 1 Y 1 A VAL 274 ? CG1 ? A VAL 274 CG1
79 1 Y 1 A VAL 274 ? CG2 ? A VAL 274 CG2
80 1 Y 1 A PHE 275 ? CG ? A PHE 275 CG
81 1 Y 1 A PHE 275 ? CD1 ? A PHE 275 CD1
82 1 Y 1 A PHE 275 ? CD2 ? A PHE 275 CD2
83 1 Y 1 A PHE 275 ? CE1 ? A PHE 275 CE1
84 1 Y 1 A PHE 275 ? CE2 ? A PHE 275 CE2
85 1 Y 1 A PHE 275 ? CZ ? A PHE 275 CZ
86 1 Y 1 A ARG 282 ? CG ? A ARG 282 CG
87 1 Y 1 A ARG 282 ? CD ? A ARG 282 CD
88 1 Y 1 A ARG 282 ? NE ? A ARG 282 NE
89 1 Y 1 A ARG 282 ? CZ ? A ARG 282 CZ
90 1 Y 1 A ARG 282 ? NH1 ? A ARG 282 NH1
91 1 Y 1 A ARG 282 ? NH2 ? A ARG 282 NH2
92 1 Y 1 A ARG 283 ? CG ? A ARG 283 CG
93 1 Y 1 A ARG 283 ? CD ? A ARG 283 CD
94 1 Y 1 A ARG 283 ? NE ? A ARG 283 NE
95 1 Y 1 A ARG 283 ? CZ ? A ARG 283 CZ
96 1 Y 1 A ARG 283 ? NH1 ? A ARG 283 NH1
97 1 Y 1 A ARG 283 ? NH2 ? A ARG 283 NH2
98 1 Y 1 A LEU 285 ? CG ? A LEU 285 CG
99 1 Y 1 A LEU 285 ? CD1 ? A LEU 285 CD1
100 1 Y 1 A LEU 285 ? CD2 ? A LEU 285 CD2
101 1 Y 1 A LYS 289 ? CG ? A LYS 289 CG
102 1 Y 1 A LYS 289 ? CD ? A LYS 289 CD
103 1 Y 1 A LYS 289 ? CE ? A LYS 289 CE
104 1 Y 1 A LYS 289 ? NZ ? A LYS 289 NZ
105 1 Y 1 A ILE 293 ? CG1 ? A ILE 293 CG1
106 1 Y 1 A ILE 293 ? CG2 ? A ILE 293 CG2
107 1 Y 1 A ILE 293 ? CD1 ? A ILE 293 CD1
#
loop_
_software.citation_id
_software.classification
_software.compiler_name
_software.compiler_version
_software.contact_author
_software.contact_author_email
_software.date
_software.description
_software.dependencies
_software.hardware
_software.language
_software.location
_software.mods
_software.name
_software.os
_software.os_version
_software.type
_software.version
_software.pdbx_ordinal
? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.10.2 1
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 2
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3
? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? TRUNCATE ? ? ? . 4
? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5
#
_cell.angle_alpha 90.000
_cell.angle_alpha_esd ?
_cell.angle_beta 90.000
_cell.angle_beta_esd ?
_cell.angle_gamma 90.000
_cell.angle_gamma_esd ?
_cell.entry_id 6O9T
_cell.details ?
_cell.formula_units_Z ?
_cell.length_a 103.110
_cell.length_a_esd ?
_cell.length_b 103.110
_cell.length_b_esd ?
_cell.length_c 89.270
_cell.length_c_esd ?
_cell.volume ?
_cell.volume_esd ?
_cell.Z_PDB 8
_cell.reciprocal_angle_alpha ?
_cell.reciprocal_angle_beta ?
_cell.reciprocal_angle_gamma ?
_cell.reciprocal_angle_alpha_esd ?
_cell.reciprocal_angle_beta_esd ?
_cell.reciprocal_angle_gamma_esd ?
_cell.reciprocal_length_a ?
_cell.reciprocal_length_b ?
_cell.reciprocal_length_c ?
_cell.reciprocal_length_a_esd ?
_cell.reciprocal_length_b_esd ?
_cell.reciprocal_length_c_esd ?
_cell.pdbx_unique_axis ?
#
_symmetry.entry_id 6O9T
_symmetry.cell_setting ?
_symmetry.Int_Tables_number 90
_symmetry.space_group_name_Hall ?
_symmetry.space_group_name_H-M 'P 4 21 2'
_symmetry.pdbx_full_space_group_name_H-M ?
#
_exptl.absorpt_coefficient_mu ?
_exptl.absorpt_correction_T_max ?
_exptl.absorpt_correction_T_min ?
_exptl.absorpt_correction_type ?
_exptl.absorpt_process_details ?
_exptl.entry_id 6O9T
_exptl.crystals_number 1
_exptl.details ?
_exptl.method 'X-RAY DIFFRACTION'
_exptl.method_details ?
#
_exptl_crystal.colour ?
_exptl_crystal.density_diffrn ?
_exptl_crystal.density_Matthews 3.51
_exptl_crystal.density_method ?
_exptl_crystal.density_percent_sol 64.96
_exptl_crystal.description ?
_exptl_crystal.F_000 ?
_exptl_crystal.id 1
_exptl_crystal.preparation ?
_exptl_crystal.size_max ?
_exptl_crystal.size_mid ?
_exptl_crystal.size_min ?
_exptl_crystal.size_rad ?
_exptl_crystal.colour_lustre ?
_exptl_crystal.colour_modifier ?
_exptl_crystal.colour_primary ?
_exptl_crystal.density_meas ?
_exptl_crystal.density_meas_esd ?
_exptl_crystal.density_meas_gt ?
_exptl_crystal.density_meas_lt ?
_exptl_crystal.density_meas_temp ?
_exptl_crystal.density_meas_temp_esd ?
_exptl_crystal.density_meas_temp_gt ?
_exptl_crystal.density_meas_temp_lt ?
_exptl_crystal.pdbx_crystal_image_url ?
_exptl_crystal.pdbx_crystal_image_format ?
_exptl_crystal.pdbx_mosaicity ?
_exptl_crystal.pdbx_mosaicity_esd ?
#
_exptl_crystal_grow.apparatus ?
_exptl_crystal_grow.atmosphere ?
_exptl_crystal_grow.crystal_id 1
_exptl_crystal_grow.details ?
_exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP'
_exptl_crystal_grow.method_ref ?
_exptl_crystal_grow.pH 6.5
_exptl_crystal_grow.pressure ?
_exptl_crystal_grow.pressure_esd ?
_exptl_crystal_grow.seeding ?
_exptl_crystal_grow.seeding_ref ?
_exptl_crystal_grow.temp 292
_exptl_crystal_grow.temp_details ?
_exptl_crystal_grow.temp_esd ?
_exptl_crystal_grow.time ?
_exptl_crystal_grow.pdbx_details '33% (v/v) PEG 400, 0.1 M MES, pH 6.5; 4% (v/v) ethylene glycol, 0.1 M NaCl'
_exptl_crystal_grow.pdbx_pH_range ?
#
_diffrn.ambient_environment ?
_diffrn.ambient_temp 100
_diffrn.ambient_temp_details ?
_diffrn.ambient_temp_esd ?
_diffrn.crystal_id 1
_diffrn.crystal_support ?
_diffrn.crystal_treatment ?
_diffrn.details ?
_diffrn.id 1
_diffrn.ambient_pressure ?
_diffrn.ambient_pressure_esd ?
_diffrn.ambient_pressure_gt ?
_diffrn.ambient_pressure_lt ?
_diffrn.ambient_temp_gt ?
_diffrn.ambient_temp_lt ?
_diffrn.pdbx_serial_crystal_experiment N
#
_diffrn_detector.details ?
_diffrn_detector.detector CCD
_diffrn_detector.diffrn_id 1
_diffrn_detector.type 'ADSC QUANTUM 315'
_diffrn_detector.area_resol_mean ?
_diffrn_detector.dtime ?
_diffrn_detector.pdbx_frames_total ?
_diffrn_detector.pdbx_collection_time_total ?
_diffrn_detector.pdbx_collection_date 2015-09-24
_diffrn_detector.pdbx_frequency ?
#
_diffrn_radiation.collimation ?
_diffrn_radiation.diffrn_id 1
_diffrn_radiation.filter_edge ?
_diffrn_radiation.inhomogeneity ?
_diffrn_radiation.monochromator ?
_diffrn_radiation.polarisn_norm ?
_diffrn_radiation.polarisn_ratio ?
_diffrn_radiation.probe ?
_diffrn_radiation.type ?
_diffrn_radiation.xray_symbol ?
_diffrn_radiation.wavelength_id 1
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l M
_diffrn_radiation.pdbx_wavelength_list ?
_diffrn_radiation.pdbx_wavelength ?
_diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH'
_diffrn_radiation.pdbx_analyzer ?
_diffrn_radiation.pdbx_scattering_type x-ray
#
_diffrn_radiation_wavelength.id 1
_diffrn_radiation_wavelength.wavelength 0.9537
_diffrn_radiation_wavelength.wt 1.0
#
_diffrn_source.current ?
_diffrn_source.details ?
_diffrn_source.diffrn_id 1
_diffrn_source.power ?
_diffrn_source.size ?
_diffrn_source.source SYNCHROTRON
_diffrn_source.target ?
_diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX2'
_diffrn_source.voltage ?
_diffrn_source.take-off_angle ?
_diffrn_source.pdbx_wavelength_list 0.9537
_diffrn_source.pdbx_wavelength ?
_diffrn_source.pdbx_synchrotron_beamline MX2
_diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron'
#
_reflns.B_iso_Wilson_estimate ?
_reflns.entry_id 6O9T
_reflns.data_reduction_details ?
_reflns.data_reduction_method ?
_reflns.d_resolution_high 3.9
_reflns.d_resolution_low 46.11
_reflns.details ?
_reflns.limit_h_max ?
_reflns.limit_h_min ?
_reflns.limit_k_max ?
_reflns.limit_k_min ?
_reflns.limit_l_max ?
_reflns.limit_l_min ?
_reflns.number_all ?
_reflns.number_obs 4688
_reflns.observed_criterion ?
_reflns.observed_criterion_F_max ?
_reflns.observed_criterion_F_min ?
_reflns.observed_criterion_I_max ?
_reflns.observed_criterion_I_min ?
_reflns.observed_criterion_sigma_F ?
_reflns.observed_criterion_sigma_I ?
_reflns.percent_possible_obs 99
_reflns.R_free_details ?
_reflns.Rmerge_F_all ?
_reflns.Rmerge_F_obs ?
_reflns.Friedel_coverage ?
_reflns.number_gt ?
_reflns.threshold_expression ?
_reflns.pdbx_redundancy 7.0
_reflns.pdbx_Rmerge_I_obs ?
_reflns.pdbx_Rmerge_I_all ?
_reflns.pdbx_Rsym_value ?
_reflns.pdbx_netI_over_av_sigmaI ?
_reflns.pdbx_netI_over_sigmaI 7.74
_reflns.pdbx_res_netI_over_av_sigmaI_2 ?
_reflns.pdbx_res_netI_over_sigmaI_2 ?
_reflns.pdbx_chi_squared ?
_reflns.pdbx_scaling_rejects ?
_reflns.pdbx_d_res_high_opt ?
_reflns.pdbx_d_res_low_opt ?
_reflns.pdbx_d_res_opt_method ?
_reflns.phase_calculation_details ?
_reflns.pdbx_Rrim_I_all 0.168
_reflns.pdbx_Rpim_I_all ?
_reflns.pdbx_d_opt ?
_reflns.pdbx_number_measured_all ?
_reflns.pdbx_diffrn_id 1
_reflns.pdbx_ordinal 1
_reflns.pdbx_CC_half 0.999
_reflns.pdbx_R_split ?
#
_reflns_shell.d_res_high 3.90
_reflns_shell.d_res_low 4.14
_reflns_shell.meanI_over_sigI_all ?
_reflns_shell.meanI_over_sigI_obs 1.0
_reflns_shell.number_measured_all ?
_reflns_shell.number_measured_obs ?
_reflns_shell.number_possible ?
_reflns_shell.number_unique_all ?
_reflns_shell.number_unique_obs 702
_reflns_shell.percent_possible_all 96.7
_reflns_shell.percent_possible_obs ?
_reflns_shell.Rmerge_F_all ?
_reflns_shell.Rmerge_F_obs ?
_reflns_shell.Rmerge_I_all ?
_reflns_shell.Rmerge_I_obs ?
_reflns_shell.meanI_over_sigI_gt ?
_reflns_shell.meanI_over_uI_all ?
_reflns_shell.meanI_over_uI_gt ?
_reflns_shell.number_measured_gt ?
_reflns_shell.number_unique_gt ?
_reflns_shell.percent_possible_gt ?
_reflns_shell.Rmerge_F_gt ?
_reflns_shell.Rmerge_I_gt ?
_reflns_shell.pdbx_redundancy 6.3
_reflns_shell.pdbx_Rsym_value ?
_reflns_shell.pdbx_chi_squared ?
_reflns_shell.pdbx_netI_over_sigmaI_all ?
_reflns_shell.pdbx_netI_over_sigmaI_obs ?
_reflns_shell.pdbx_Rrim_I_all ?
_reflns_shell.pdbx_Rpim_I_all ?
_reflns_shell.pdbx_rejects ?
_reflns_shell.pdbx_ordinal 1
_reflns_shell.pdbx_diffrn_id 1
_reflns_shell.pdbx_CC_half 0.33
_reflns_shell.pdbx_R_split ?
#
_refine.aniso_B[1][1] -4.2824
_refine.aniso_B[1][2] 0.0000
_refine.aniso_B[1][3] 0.0000
_refine.aniso_B[2][2] -4.2824
_refine.aniso_B[2][3] 0.0000
_refine.aniso_B[3][3] 8.5648
_refine.B_iso_max 280.170
_refine.B_iso_mean 219.2800
_refine.B_iso_min 140.790
_refine.correlation_coeff_Fo_to_Fc 0.8761
_refine.correlation_coeff_Fo_to_Fc_free 0.9283
_refine.details ?
_refine.diff_density_max ?
_refine.diff_density_max_esd ?
_refine.diff_density_min ?
_refine.diff_density_min_esd ?
_refine.diff_density_rms ?
_refine.diff_density_rms_esd ?
_refine.entry_id 6O9T
_refine.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine.ls_abs_structure_details ?
_refine.ls_abs_structure_Flack ?
_refine.ls_abs_structure_Flack_esd ?
_refine.ls_abs_structure_Rogers ?
_refine.ls_abs_structure_Rogers_esd ?
_refine.ls_d_res_high 4.0100
_refine.ls_d_res_low 46.1100
_refine.ls_extinction_coef ?
_refine.ls_extinction_coef_esd ?
_refine.ls_extinction_expression ?
_refine.ls_extinction_method ?
_refine.ls_goodness_of_fit_all ?
_refine.ls_goodness_of_fit_all_esd ?
_refine.ls_goodness_of_fit_obs ?
_refine.ls_goodness_of_fit_obs_esd ?
_refine.ls_hydrogen_treatment ?
_refine.ls_matrix_type ?
_refine.ls_number_constraints ?
_refine.ls_number_parameters ?
_refine.ls_number_reflns_all ?
_refine.ls_number_reflns_obs 4340
_refine.ls_number_reflns_R_free 195
_refine.ls_number_reflns_R_work ?
_refine.ls_number_restraints ?
_refine.ls_percent_reflns_obs 99.5600
_refine.ls_percent_reflns_R_free 4.4900
_refine.ls_R_factor_all ?
_refine.ls_R_factor_obs 0.2472
_refine.ls_R_factor_R_free 0.2725
_refine.ls_R_factor_R_free_error ?
_refine.ls_R_factor_R_free_error_details ?
_refine.ls_R_factor_R_work 0.2460
_refine.ls_R_Fsqd_factor_obs ?
_refine.ls_R_I_factor_obs ?
_refine.ls_redundancy_reflns_all ?
_refine.ls_redundancy_reflns_obs ?
_refine.ls_restrained_S_all ?
_refine.ls_restrained_S_obs ?
_refine.ls_shift_over_esd_max ?
_refine.ls_shift_over_esd_mean ?
_refine.ls_structure_factor_coef ?
_refine.ls_weighting_details ?
_refine.ls_weighting_scheme ?
_refine.ls_wR_factor_all ?
_refine.ls_wR_factor_obs ?
_refine.ls_wR_factor_R_free ?
_refine.ls_wR_factor_R_work ?
_refine.occupancy_max ?
_refine.occupancy_min ?
_refine.solvent_model_details ?
_refine.solvent_model_param_bsol ?
_refine.solvent_model_param_ksol ?
_refine.ls_R_factor_gt ?
_refine.ls_goodness_of_fit_gt ?
_refine.ls_goodness_of_fit_ref ?
_refine.ls_shift_over_su_max ?
_refine.ls_shift_over_su_max_lt ?
_refine.ls_shift_over_su_mean ?
_refine.ls_shift_over_su_mean_lt ?
_refine.pdbx_ls_sigma_I ?
_refine.pdbx_ls_sigma_F 0.000
_refine.pdbx_ls_sigma_Fsqd ?
_refine.pdbx_data_cutoff_high_absF ?
_refine.pdbx_data_cutoff_high_rms_absF ?
_refine.pdbx_data_cutoff_low_absF ?
_refine.pdbx_isotropic_thermal_model ?
_refine.pdbx_ls_cross_valid_method THROUGHOUT
_refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT'
_refine.pdbx_starting_model 1XL4
_refine.pdbx_stereochemistry_target_values ?
_refine.pdbx_R_Free_selection_details RANDOM
_refine.pdbx_stereochem_target_val_spec_case ?
_refine.pdbx_overall_ESU_R ?
_refine.pdbx_overall_ESU_R_Free ?
_refine.pdbx_solvent_vdw_probe_radii ?
_refine.pdbx_solvent_ion_probe_radii ?
_refine.pdbx_solvent_shrinkage_radii ?
_refine.pdbx_real_space_R ?
_refine.pdbx_density_correlation ?
_refine.pdbx_pd_number_of_powder_patterns ?
_refine.pdbx_pd_number_of_points ?
_refine.pdbx_pd_meas_number_of_points ?
_refine.pdbx_pd_proc_ls_prof_R_factor ?
_refine.pdbx_pd_proc_ls_prof_wR_factor ?
_refine.pdbx_pd_Marquardt_correlation_coeff ?
_refine.pdbx_pd_Fsqrd_R_factor ?
_refine.pdbx_pd_ls_matrix_band_width ?
_refine.pdbx_overall_phase_error ?
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI ?
_refine.pdbx_overall_SU_R_free_Blow_DPI 0.7590
_refine.pdbx_overall_SU_R_Blow_DPI ?
_refine.pdbx_TLS_residual_ADP_flag ?
_refine.pdbx_diffrn_id 1
_refine.overall_SU_B ?
_refine.overall_SU_ML ?
_refine.overall_SU_R_Cruickshank_DPI ?
_refine.overall_SU_R_free ?
_refine.overall_FOM_free_R_set ?
_refine.overall_FOM_work_R_set ?
_refine.pdbx_average_fsc_overall ?
_refine.pdbx_average_fsc_work ?
_refine.pdbx_average_fsc_free ?
#
_refine_analyze.entry_id 6O9T
_refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine_analyze.Luzzati_coordinate_error_free ?
_refine_analyze.Luzzati_coordinate_error_obs 1.179
_refine_analyze.Luzzati_d_res_low_free ?
_refine_analyze.Luzzati_d_res_low_obs ?
_refine_analyze.Luzzati_sigma_a_free ?
_refine_analyze.Luzzati_sigma_a_free_details ?
_refine_analyze.Luzzati_sigma_a_obs ?
_refine_analyze.Luzzati_sigma_a_obs_details ?
_refine_analyze.number_disordered_residues ?
_refine_analyze.occupancy_sum_hydrogen ?
_refine_analyze.occupancy_sum_non_hydrogen ?
_refine_analyze.RG_d_res_high ?
_refine_analyze.RG_d_res_low ?
_refine_analyze.RG_free ?
_refine_analyze.RG_work ?
_refine_analyze.RG_free_work_ratio ?
_refine_analyze.pdbx_Luzzati_d_res_high_obs ?
#
_refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine_hist.cycle_id final
_refine_hist.details ?
_refine_hist.d_res_high 4.0100
_refine_hist.d_res_low 46.1100
_refine_hist.number_atoms_solvent 0
_refine_hist.number_atoms_total 2071
_refine_hist.number_reflns_all ?
_refine_hist.number_reflns_obs ?
_refine_hist.number_reflns_R_free ?
_refine_hist.number_reflns_R_work ?
_refine_hist.R_factor_all ?
_refine_hist.R_factor_obs ?
_refine_hist.R_factor_R_free ?
_refine_hist.R_factor_R_work ?
_refine_hist.pdbx_number_residues_total 274
_refine_hist.pdbx_B_iso_mean_ligand 223.25
_refine_hist.pdbx_B_iso_mean_solvent ?
_refine_hist.pdbx_number_atoms_protein 2055
_refine_hist.pdbx_number_atoms_nucleic_acid 0
_refine_hist.pdbx_number_atoms_ligand 16
_refine_hist.pdbx_number_atoms_lipid ?
_refine_hist.pdbx_number_atoms_carb ?
_refine_hist.pdbx_pseudo_atom_details ?
#
loop_
_refine_ls_restr.pdbx_refine_id
_refine_ls_restr.criterion
_refine_ls_restr.dev_ideal
_refine_ls_restr.dev_ideal_target
_refine_ls_restr.number
_refine_ls_restr.rejects
_refine_ls_restr.type
_refine_ls_restr.weight
_refine_ls_restr.pdbx_restraint_function
'X-RAY DIFFRACTION' ? ? ? 661 ? t_dihedral_angle_d 2.000 SINUSOIDAL
'X-RAY DIFFRACTION' ? ? ? 41 ? t_trig_c_planes 2.000 HARMONIC
'X-RAY DIFFRACTION' ? ? ? 343 ? t_gen_planes 5.000 HARMONIC
'X-RAY DIFFRACTION' ? ? ? 2124 ? t_it 20.000 HARMONIC
'X-RAY DIFFRACTION' ? ? ? 8 ? t_nbd 5.000 SEMIHARMONIC
'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ?
'X-RAY DIFFRACTION' ? ? ? 293 ? t_chiral_improper_torsion 5.000 SEMIHARMONIC
'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ?
'X-RAY DIFFRACTION' ? ? ? 2387 ? t_ideal_dist_contact 4.000 SEMIHARMONIC
'X-RAY DIFFRACTION' ? 0.010 ? 2124 ? t_bond_d 2.000 HARMONIC
'X-RAY DIFFRACTION' ? 1.190 ? 2907 ? t_angle_deg 2.000 HARMONIC
'X-RAY DIFFRACTION' ? 2.700 ? ? ? t_omega_torsion ? ?
'X-RAY DIFFRACTION' ? 22.700 ? ? ? t_other_torsion ? ?
#
_refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine_ls_shell.d_res_high 4.0100
_refine_ls_shell.d_res_low 4.4800
_refine_ls_shell.number_reflns_all 1199
_refine_ls_shell.number_reflns_obs ?
_refine_ls_shell.number_reflns_R_free 52
_refine_ls_shell.number_reflns_R_work 1147
_refine_ls_shell.percent_reflns_obs 99.5600
_refine_ls_shell.percent_reflns_R_free 4.3400
_refine_ls_shell.R_factor_all 0.2521
_refine_ls_shell.R_factor_obs ?
_refine_ls_shell.R_factor_R_free 0.2571
_refine_ls_shell.R_factor_R_free_error 0.0000
_refine_ls_shell.R_factor_R_work 0.2519
_refine_ls_shell.redundancy_reflns_all ?
_refine_ls_shell.redundancy_reflns_obs ?
_refine_ls_shell.wR_factor_all ?
_refine_ls_shell.wR_factor_obs ?
_refine_ls_shell.wR_factor_R_free ?
_refine_ls_shell.wR_factor_R_work ?
_refine_ls_shell.pdbx_total_number_of_bins_used 5
_refine_ls_shell.pdbx_phase_error ?
_refine_ls_shell.pdbx_fsc_work ?
_refine_ls_shell.pdbx_fsc_free ?
#
_struct.entry_id 6O9T
_struct.title 'KirBac3.1 mutant at a resolution of 4.1 Angstroms'
_struct.pdbx_model_details ?
_struct.pdbx_formula_weight ?
_struct.pdbx_formula_weight_method ?
_struct.pdbx_model_type_details ?
_struct.pdbx_CASP_flag N
#
_struct_keywords.entry_id 6O9T
_struct_keywords.text 'MEMBRANE PROTEIN'
_struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN'
#
loop_
_struct_asym.id
_struct_asym.pdbx_blank_PDB_chainid_flag
_struct_asym.pdbx_modified
_struct_asym.entity_id
_struct_asym.details
A N N 1 ?
B N N 2 ?
C N N 2 ?
D N N 3 ?
#
_struct_ref.id 1
_struct_ref.db_name UNP
_struct_ref.db_code IRK10_MAGMG
_struct_ref.pdbx_db_accession D9N164
_struct_ref.pdbx_db_isoform ?
_struct_ref.entity_id 1
_struct_ref.pdbx_seq_one_letter_code
;MTGGMKPPARKPRILNSDGSSNITRLGLEKRGWLDDHYHDLLTVSWPVFITLITGLYLVTNALFALAYLACGDVIENARP
GSFTDAFFFSVQTMATIGYGKLIPIGPLANTLVTLEALCGMLGLAVAASLIYARFTRPTAGVLFSSRMVISDFEGKPTLM
MRLANLRIEQIIEADVHLVLVRSEISQEGMVFRRFHDLTLTRSRSPIFSLSWTVMHPIDHHSPIYGETDETLRNSHSEFL
VLFTGHHEAFAQNVHARHAYSCDEIIWGGHFVDVFTTLPDGRRALDLGKFHEIAQ
;
_struct_ref.pdbx_align_begin 1
#
_struct_ref_seq.align_id 1
_struct_ref_seq.ref_id 1
_struct_ref_seq.pdbx_PDB_id_code 6O9T
_struct_ref_seq.pdbx_strand_id A
_struct_ref_seq.seq_align_beg 1
_struct_ref_seq.pdbx_seq_align_beg_ins_code ?
_struct_ref_seq.seq_align_end 295
_struct_ref_seq.pdbx_seq_align_end_ins_code ?
_struct_ref_seq.pdbx_db_accession D9N164
_struct_ref_seq.db_align_beg 1
_struct_ref_seq.pdbx_db_align_beg_ins_code ?
_struct_ref_seq.db_align_end 295
_struct_ref_seq.pdbx_db_align_end_ins_code ?
_struct_ref_seq.pdbx_auth_seq_align_beg 1
_struct_ref_seq.pdbx_auth_seq_align_end 295
#
loop_
_struct_ref_seq_dif.align_id
_struct_ref_seq_dif.pdbx_pdb_id_code
_struct_ref_seq_dif.mon_id
_struct_ref_seq_dif.pdbx_pdb_strand_id
_struct_ref_seq_dif.seq_num
_struct_ref_seq_dif.pdbx_pdb_ins_code
_struct_ref_seq_dif.pdbx_seq_db_name
_struct_ref_seq_dif.pdbx_seq_db_accession_code
_struct_ref_seq_dif.db_mon_id
_struct_ref_seq_dif.pdbx_seq_db_seq_num
_struct_ref_seq_dif.details
_struct_ref_seq_dif.pdbx_auth_seq_num
_struct_ref_seq_dif.pdbx_ordinal
1 6O9T VAL A 71 ? UNP D9N164 CYS 71 'engineered mutation' 71 1
1 6O9T VAL A 119 ? UNP D9N164 CYS 119 'engineered mutation' 119 2
1 6O9T CYS A 133 ? UNP D9N164 ALA 133 'engineered mutation' 133 3
1 6O9T CYS A 136 ? UNP D9N164 THR 136 'engineered mutation' 136 4
1 6O9T SER A 262 ? UNP D9N164 CYS 262 'engineered mutation' 262 5
1 6O9T HIS A 296 ? UNP D9N164 ? ? 'expression tag' 296 6
1 6O9T HIS A 297 ? UNP D9N164 ? ? 'expression tag' 297 7
1 6O9T HIS A 298 ? UNP D9N164 ? ? 'expression tag' 298 8
1 6O9T HIS A 299 ? UNP D9N164 ? ? 'expression tag' 299 9
1 6O9T HIS A 300 ? UNP D9N164 ? ? 'expression tag' 300 10
1 6O9T HIS A 301 ? UNP D9N164 ? ? 'expression tag' 301 11
#
_pdbx_struct_assembly.id 1
_pdbx_struct_assembly.details author_and_software_defined_assembly
_pdbx_struct_assembly.method_details PISA
_pdbx_struct_assembly.oligomeric_details tetrameric
_pdbx_struct_assembly.oligomeric_count 4
#
loop_
_pdbx_struct_assembly_prop.biol_id
_pdbx_struct_assembly_prop.type
_pdbx_struct_assembly_prop.value
_pdbx_struct_assembly_prop.details
1 'ABSA (A^2)' 17030 ?
1 MORE -144 ?
1 'SSA (A^2)' 46270 ?
#
_pdbx_struct_assembly_gen.assembly_id 1
_pdbx_struct_assembly_gen.oper_expression 1,2,3,4
_pdbx_struct_assembly_gen.asym_id_list A,B,C,D
#
_pdbx_struct_assembly_auth_evidence.id 1
_pdbx_struct_assembly_auth_evidence.assembly_id 1
_pdbx_struct_assembly_auth_evidence.experimental_support homology
_pdbx_struct_assembly_auth_evidence.details ?
#
loop_
_pdbx_struct_oper_list.id
_pdbx_struct_oper_list.type
_pdbx_struct_oper_list.name
_pdbx_struct_oper_list.symmetry_operation
_pdbx_struct_oper_list.matrix[1][1]
_pdbx_struct_oper_list.matrix[1][2]
_pdbx_struct_oper_list.matrix[1][3]
_pdbx_struct_oper_list.vector[1]
_pdbx_struct_oper_list.matrix[2][1]
_pdbx_struct_oper_list.matrix[2][2]
_pdbx_struct_oper_list.matrix[2][3]
_pdbx_struct_oper_list.vector[2]
_pdbx_struct_oper_list.matrix[3][1]
_pdbx_struct_oper_list.matrix[3][2]
_pdbx_struct_oper_list.matrix[3][3]
_pdbx_struct_oper_list.vector[3]
1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000
1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000
2 'crystal symmetry operation' 2_545 -x,-y-1,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000
-1.0000000000 0.0000000000 -103.1100000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000
3 'crystal symmetry operation' 3_445 -y-1/2,x-1/2,z 0.0000000000 -1.0000000000 0.0000000000 -51.5550000000 1.0000000000
0.0000000000 0.0000000000 -51.5550000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000
4 'crystal symmetry operation' 4_545 y+1/2,-x-1/2,z 0.0000000000 1.0000000000 0.0000000000 51.5550000000 -1.0000000000
0.0000000000 0.0000000000 -51.5550000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000
#
loop_
_struct_conf.conf_type_id
_struct_conf.id
_struct_conf.pdbx_PDB_helix_id
_struct_conf.beg_label_comp_id
_struct_conf.beg_label_asym_id
_struct_conf.beg_label_seq_id
_struct_conf.pdbx_beg_PDB_ins_code
_struct_conf.end_label_comp_id
_struct_conf.end_label_asym_id
_struct_conf.end_label_seq_id
_struct_conf.pdbx_end_PDB_ins_code
_struct_conf.beg_auth_comp_id
_struct_conf.beg_auth_asym_id
_struct_conf.beg_auth_seq_id
_struct_conf.end_auth_comp_id
_struct_conf.end_auth_asym_id
_struct_conf.end_auth_seq_id
_struct_conf.pdbx_PDB_helix_class
_struct_conf.details
_struct_conf.pdbx_PDB_helix_length
HELX_P HELX_P1 AA1 ASP A 36 ? VAL A 44 ? ASP A 36 VAL A 44 1 ? 9
HELX_P HELX_P2 AA2 SER A 45 ? VAL A 71 ? SER A 45 VAL A 71 1 ? 27
HELX_P HELX_P3 AA3 SER A 82 ? ALA A 95 ? SER A 82 ALA A 95 1 ? 14
HELX_P HELX_P4 AA4 ILE A 105 ? CYS A 136 ? ILE A 105 CYS A 136 1 ? 32
HELX_P HELX_P5 AA5 THR A 228 ? SER A 235 ? THR A 228 SER A 235 1 ? 8
HELX_P HELX_P6 AA6 LEU A 287 ? HIS A 291 ? LEU A 287 HIS A 291 5 ? 5
#
_struct_conf_type.id HELX_P
_struct_conf_type.criteria ?
_struct_conf_type.reference ?
#
loop_
_struct_conn.id
_struct_conn.conn_type_id
_struct_conn.pdbx_leaving_atom_flag
_struct_conn.pdbx_PDB_id
_struct_conn.ptnr1_label_asym_id
_struct_conn.ptnr1_label_comp_id
_struct_conn.ptnr1_label_seq_id
_struct_conn.ptnr1_label_atom_id
_struct_conn.pdbx_ptnr1_label_alt_id
_struct_conn.pdbx_ptnr1_PDB_ins_code
_struct_conn.pdbx_ptnr1_standard_comp_id
_struct_conn.ptnr1_symmetry
_struct_conn.ptnr2_label_asym_id
_struct_conn.ptnr2_label_comp_id
_struct_conn.ptnr2_label_seq_id
_struct_conn.ptnr2_label_atom_id
_struct_conn.pdbx_ptnr2_label_alt_id
_struct_conn.pdbx_ptnr2_PDB_ins_code
_struct_conn.ptnr1_auth_asym_id
_struct_conn.ptnr1_auth_comp_id
_struct_conn.ptnr1_auth_seq_id
_struct_conn.ptnr2_auth_asym_id
_struct_conn.ptnr2_auth_comp_id
_struct_conn.ptnr2_auth_seq_id
_struct_conn.ptnr2_symmetry
_struct_conn.pdbx_ptnr3_label_atom_id
_struct_conn.pdbx_ptnr3_label_seq_id
_struct_conn.pdbx_ptnr3_label_comp_id
_struct_conn.pdbx_ptnr3_label_asym_id
_struct_conn.pdbx_ptnr3_label_alt_id
_struct_conn.pdbx_ptnr3_PDB_ins_code
_struct_conn.details
_struct_conn.pdbx_dist_value
_struct_conn.pdbx_value_order
_struct_conn.pdbx_role
covale1 covale none ? A CYS 133 SG ? ? ? 1_555 D 6E3 . C8 ? ? A CYS 133 A 6E3 403 3_445 ? ? ? ? ? ? ? 1.885 ? ?
covale2 covale none ? A CYS 136 SG ? ? ? 1_555 D 6E3 . C7 ? ? A CYS 136 A 6E3 403 1_555 ? ? ? ? ? ? ? 1.778 ? ?
metalc1 metalc ? ? A THR 96 O ? ? ? 1_555 C K . K ? ? A THR 96 A K 402 1_555 ? ? ? ? ? ? ? 2.357 ? ?
metalc2 metalc ? ? A THR 96 O ? ? ? 1_555 C K . K ? ? A THR 96 A K 402 4_545 ? ? ? ? ? ? ? 2.357 ? ?
metalc3 metalc ? ? A GLY 98 O ? ? ? 1_555 B K . K ? ? A GLY 98 A K 401 1_555 ? ? ? ? ? ? ? 2.373 ? ?
metalc4 metalc ? ? A GLY 98 O ? ? ? 1_555 B K . K ? ? A GLY 98 A K 401 4_545 ? ? ? ? ? ? ? 2.373 ? ?
metalc5 metalc ? ? A TYR 99 O ? ? ? 1_555 B K . K ? ? A TYR 99 A K 401 1_555 ? ? ? ? ? ? ? 3.459 ? ?
metalc6 metalc ? ? A TYR 99 O ? ? ? 1_555 B K . K ? ? A TYR 99 A K 401 4_545 ? ? ? ? ? ? ? 3.459 ? ?
#
loop_
_struct_conn_type.id
_struct_conn_type.criteria
_struct_conn_type.reference
covale ? ?
metalc ? ?
#
loop_
_pdbx_struct_conn_angle.id
_pdbx_struct_conn_angle.ptnr1_label_atom_id
_pdbx_struct_conn_angle.ptnr1_label_alt_id
_pdbx_struct_conn_angle.ptnr1_label_asym_id
_pdbx_struct_conn_angle.ptnr1_label_comp_id
_pdbx_struct_conn_angle.ptnr1_label_seq_id
_pdbx_struct_conn_angle.ptnr1_auth_atom_id
_pdbx_struct_conn_angle.ptnr1_auth_asym_id
_pdbx_struct_conn_angle.ptnr1_auth_comp_id
_pdbx_struct_conn_angle.ptnr1_auth_seq_id
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code
_pdbx_struct_conn_angle.ptnr1_symmetry
_pdbx_struct_conn_angle.ptnr2_label_atom_id
_pdbx_struct_conn_angle.ptnr2_label_alt_id
_pdbx_struct_conn_angle.ptnr2_label_asym_id
_pdbx_struct_conn_angle.ptnr2_label_comp_id
_pdbx_struct_conn_angle.ptnr2_label_seq_id
_pdbx_struct_conn_angle.ptnr2_auth_atom_id
_pdbx_struct_conn_angle.ptnr2_auth_asym_id
_pdbx_struct_conn_angle.ptnr2_auth_comp_id
_pdbx_struct_conn_angle.ptnr2_auth_seq_id
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code
_pdbx_struct_conn_angle.ptnr2_symmetry
_pdbx_struct_conn_angle.ptnr3_label_atom_id
_pdbx_struct_conn_angle.ptnr3_label_alt_id
_pdbx_struct_conn_angle.ptnr3_label_asym_id
_pdbx_struct_conn_angle.ptnr3_label_comp_id
_pdbx_struct_conn_angle.ptnr3_label_seq_id
_pdbx_struct_conn_angle.ptnr3_auth_atom_id
_pdbx_struct_conn_angle.ptnr3_auth_asym_id
_pdbx_struct_conn_angle.ptnr3_auth_comp_id
_pdbx_struct_conn_angle.ptnr3_auth_seq_id
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code
_pdbx_struct_conn_angle.ptnr3_symmetry
_pdbx_struct_conn_angle.value
_pdbx_struct_conn_angle.value_esd
1 O ? A THR 96 ? A THR 96 ? 1_555 K ? C K . ? A K 402 ? 1_555 O ? A THR 96 ? A THR 96 ? 1_555 0.0 ?
2 O ? A GLY 98 ? A GLY 98 ? 1_555 K ? B K . ? A K 401 ? 1_555 O ? A GLY 98 ? A GLY 98 ? 1_555 0.0 ?
3 O ? A GLY 98 ? A GLY 98 ? 1_555 K ? B K . ? A K 401 ? 1_555 O ? A TYR 99 ? A TYR 99 ? 1_555 59.4 ?
4 O ? A GLY 98 ? A GLY 98 ? 1_555 K ? B K . ? A K 401 ? 1_555 O ? A TYR 99 ? A TYR 99 ? 1_555 59.4 ?
5 O ? A GLY 98 ? A GLY 98 ? 1_555 K ? B K . ? A K 401 ? 1_555 O ? A TYR 99 ? A TYR 99 ? 1_555 59.4 ?
6 O ? A GLY 98 ? A GLY 98 ? 1_555 K ? B K . ? A K 401 ? 1_555 O ? A TYR 99 ? A TYR 99 ? 1_555 59.4 ?
7 O ? A TYR 99 ? A TYR 99 ? 1_555 K ? B K . ? A K 401 ? 1_555 O ? A TYR 99 ? A TYR 99 ? 1_555 0.0 ?
#
loop_
_pdbx_modification_feature.ordinal
_pdbx_modification_feature.label_comp_id
_pdbx_modification_feature.label_asym_id
_pdbx_modification_feature.label_seq_id
_pdbx_modification_feature.label_alt_id
_pdbx_modification_feature.modified_residue_label_comp_id
_pdbx_modification_feature.modified_residue_label_asym_id
_pdbx_modification_feature.modified_residue_label_seq_id
_pdbx_modification_feature.modified_residue_label_alt_id
_pdbx_modification_feature.auth_comp_id
_pdbx_modification_feature.auth_asym_id
_pdbx_modification_feature.auth_seq_id
_pdbx_modification_feature.PDB_ins_code
_pdbx_modification_feature.symmetry
_pdbx_modification_feature.modified_residue_auth_comp_id
_pdbx_modification_feature.modified_residue_auth_asym_id
_pdbx_modification_feature.modified_residue_auth_seq_id
_pdbx_modification_feature.modified_residue_PDB_ins_code
_pdbx_modification_feature.modified_residue_symmetry
_pdbx_modification_feature.comp_id_linking_atom
_pdbx_modification_feature.modified_residue_id_linking_atom
_pdbx_modification_feature.modified_residue_id
_pdbx_modification_feature.ref_pcm_id
_pdbx_modification_feature.ref_comp_id
_pdbx_modification_feature.type
_pdbx_modification_feature.category
1 6E3 D . ? CYS A 136 ? 6E3 A 403 ? 1_555 CYS A 136 ? 1_555 C7 SG CYS 1 6E3 None Crosslinker
2 6E3 D . ? CYS A 133 ? 6E3 A 403 ? 3_445 CYS A 133 ? 1_555 C8 SG CYS 2 6E3 None Crosslinker
#
loop_
_struct_sheet.id
_struct_sheet.type
_struct_sheet.number_strands
_struct_sheet.details
AA1 ? 3 ?
AA2 ? 4 ?
AA3 ? 3 ?
AA4 ? 4 ?
AA5 ? 2 ?
#
loop_
_struct_sheet_order.sheet_id
_struct_sheet_order.range_id_1
_struct_sheet_order.range_id_2
_struct_sheet_order.offset
_struct_sheet_order.sense
AA1 1 2 ? anti-parallel
AA1 2 3 ? anti-parallel
AA2 1 2 ? anti-parallel
AA2 2 3 ? anti-parallel
AA2 3 4 ? parallel
AA3 1 2 ? anti-parallel
AA3 2 3 ? anti-parallel
AA4 1 2 ? anti-parallel
AA4 2 3 ? anti-parallel
AA4 3 4 ? anti-parallel
AA5 1 2 ? anti-parallel
#
loop_
_struct_sheet_range.sheet_id
_struct_sheet_range.id
_struct_sheet_range.beg_label_comp_id
_struct_sheet_range.beg_label_asym_id
_struct_sheet_range.beg_label_seq_id
_struct_sheet_range.pdbx_beg_PDB_ins_code
_struct_sheet_range.end_label_comp_id
_struct_sheet_range.end_label_asym_id
_struct_sheet_range.end_label_seq_id
_struct_sheet_range.pdbx_end_PDB_ins_code
_struct_sheet_range.beg_auth_comp_id
_struct_sheet_range.beg_auth_asym_id
_struct_sheet_range.beg_auth_seq_id
_struct_sheet_range.end_auth_comp_id
_struct_sheet_range.end_auth_asym_id
_struct_sheet_range.end_auth_seq_id
AA1 1 VAL A 142 ? PHE A 144 ? VAL A 142 PHE A 144
AA1 2 LYS A 156 ? ASN A 165 ? LYS A 156 ASN A 165
AA1 3 SER A 211 ? PRO A 217 ? SER A 211 PRO A 217
AA2 1 VAL A 142 ? PHE A 144 ? VAL A 142 PHE A 144
AA2 2 LYS A 156 ? ASN A 165 ? LYS A 156 ASN A 165
AA2 3 MET A 148 ? PHE A 153 ? MET A 148 PHE A 153
AA2 4 ILE A 265 ? TRP A 267 ? ILE A 265 TRP A 267
AA3 1 VAL A 191 ? LEU A 198 ? VAL A 191 LEU A 198
AA3 2 ILE A 171 ? ILE A 185 ? ILE A 171 ILE A 185
AA3 3 ARG A 204 ? PHE A 208 ? ARG A 204 PHE A 208
AA4 1 VAL A 191 ? LEU A 198 ? VAL A 191 LEU A 198
AA4 2 ILE A 171 ? ILE A 185 ? ILE A 171 ILE A 185
AA4 3 GLU A 238 ? HIS A 247 ? GLU A 238 HIS A 247
AA4 4 ASN A 253 ? SER A 261 ? ASN A 253 SER A 261
AA5 1 PHE A 275 ? THR A 277 ? PHE A 275 THR A 277
AA5 2 ARG A 283 ? LEU A 285 ? ARG A 283 LEU A 285
#
loop_
_pdbx_struct_sheet_hbond.sheet_id
_pdbx_struct_sheet_hbond.range_id_1
_pdbx_struct_sheet_hbond.range_id_2
_pdbx_struct_sheet_hbond.range_1_label_atom_id
_pdbx_struct_sheet_hbond.range_1_label_comp_id
_pdbx_struct_sheet_hbond.range_1_label_asym_id
_pdbx_struct_sheet_hbond.range_1_label_seq_id
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code
_pdbx_struct_sheet_hbond.range_1_auth_atom_id
_pdbx_struct_sheet_hbond.range_1_auth_comp_id
_pdbx_struct_sheet_hbond.range_1_auth_asym_id
_pdbx_struct_sheet_hbond.range_1_auth_seq_id
_pdbx_struct_sheet_hbond.range_2_label_atom_id
_pdbx_struct_sheet_hbond.range_2_label_comp_id
_pdbx_struct_sheet_hbond.range_2_label_asym_id
_pdbx_struct_sheet_hbond.range_2_label_seq_id
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code
_pdbx_struct_sheet_hbond.range_2_auth_atom_id
_pdbx_struct_sheet_hbond.range_2_auth_comp_id
_pdbx_struct_sheet_hbond.range_2_auth_asym_id
_pdbx_struct_sheet_hbond.range_2_auth_seq_id
AA1 1 2 N LEU A 143 ? N LEU A 143 O ALA A 164 ? O ALA A 164
AA1 2 3 N LEU A 159 ? N LEU A 159 O HIS A 216 ? O HIS A 216
AA2 1 2 N LEU A 143 ? N LEU A 143 O ALA A 164 ? O ALA A 164
AA2 2 3 O MET A 160 ? O MET A 160 N VAL A 149 ? N VAL A 149
AA2 3 4 N ILE A 150 ? N ILE A 150 O ILE A 266 ? O ILE A 266
AA3 1 2 O PHE A 192 ? O PHE A 192 N GLU A 184 ? N GLU A 184
AA3 2 3 N ILE A 171 ? N ILE A 171 O PHE A 208 ? O PHE A 208
AA4 1 2 O PHE A 192 ? O PHE A 192 N GLU A 184 ? N GLU A 184
AA4 2 3 N VAL A 181 ? N VAL A 181 O GLU A 238 ? O GLU A 238
AA4 3 4 N PHE A 239 ? N PHE A 239 O TYR A 260 ? O TYR A 260
AA5 1 2 N THR A 276 ? N THR A 276 O ALA A 284 ? O ALA A 284
#
loop_
_struct_site.id
_struct_site.pdbx_evidence_code
_struct_site.pdbx_auth_asym_id
_struct_site.pdbx_auth_comp_id
_struct_site.pdbx_auth_seq_id
_struct_site.pdbx_auth_ins_code
_struct_site.pdbx_num_residues
_struct_site.details
AC1 Software A K 401 ? 8 'binding site for residue K A 401'
AC2 Software A K 402 ? 4 'binding site for residue K A 402'
AC3 Software A 6E3 403 ? 6 'binding site for residue 6E3 A 403'
#
loop_
_struct_site_gen.id
_struct_site_gen.site_id
_struct_site_gen.pdbx_num_res
_struct_site_gen.label_comp_id
_struct_site_gen.label_asym_id
_struct_site_gen.label_seq_id
_struct_site_gen.pdbx_auth_ins_code
_struct_site_gen.auth_comp_id
_struct_site_gen.auth_asym_id
_struct_site_gen.auth_seq_id
_struct_site_gen.label_atom_id
_struct_site_gen.label_alt_id
_struct_site_gen.symmetry
_struct_site_gen.details
1 AC1 8 GLY A 98 ? GLY A 98 . ? 3_445 ?
2 AC1 8 GLY A 98 ? GLY A 98 . ? 1_555 ?
3 AC1 8 GLY A 98 ? GLY A 98 . ? 4_545 ?
4 AC1 8 GLY A 98 ? GLY A 98 . ? 2_545 ?
5 AC1 8 TYR A 99 ? TYR A 99 . ? 2_545 ?
6 AC1 8 TYR A 99 ? TYR A 99 . ? 3_445 ?
7 AC1 8 TYR A 99 ? TYR A 99 . ? 4_545 ?
8 AC1 8 TYR A 99 ? TYR A 99 . ? 1_555 ?
9 AC2 4 THR A 96 ? THR A 96 . ? 3_445 ?
10 AC2 4 THR A 96 ? THR A 96 . ? 1_555 ?
11 AC2 4 THR A 96 ? THR A 96 . ? 2_545 ?
12 AC2 4 THR A 96 ? THR A 96 . ? 4_545 ?
13 AC3 6 TYR A 38 ? TYR A 38 . ? 4_545 ?
14 AC3 6 SER A 129 ? SER A 129 . ? 4_545 ?
15 AC3 6 CYS A 133 ? CYS A 133 . ? 4_545 ?
16 AC3 6 PHE A 135 ? PHE A 135 . ? 1_555 ?
17 AC3 6 CYS A 136 ? CYS A 136 . ? 1_555 ?
18 AC3 6 PHE A 250 ? PHE A 250 . ? 1_555 ?
#
_pdbx_entry_details.entry_id 6O9T
_pdbx_entry_details.compound_details ?
_pdbx_entry_details.source_details ?
_pdbx_entry_details.nonpolymer_details ?
_pdbx_entry_details.sequence_details ?
_pdbx_entry_details.has_ligand_of_interest ?
_pdbx_entry_details.has_protein_modification Y
#
loop_
_pdbx_validate_torsion.id
_pdbx_validate_torsion.PDB_model_num
_pdbx_validate_torsion.auth_comp_id
_pdbx_validate_torsion.auth_asym_id
_pdbx_validate_torsion.auth_seq_id
_pdbx_validate_torsion.PDB_ins_code
_pdbx_validate_torsion.label_alt_id
_pdbx_validate_torsion.phi
_pdbx_validate_torsion.psi
1 1 ASN A 77 ? ? 73.76 -11.16
2 1 CYS A 136 ? ? -93.29 55.67
3 1 PRO A 138 ? ? -66.20 90.16
4 1 ALA A 140 ? ? -68.31 93.12
5 1 LEU A 210 ? ? -104.78 -126.86
6 1 ALA A 251 ? ? 106.93 -62.37
#
loop_
_pdbx_struct_special_symmetry.id
_pdbx_struct_special_symmetry.PDB_model_num
_pdbx_struct_special_symmetry.auth_asym_id
_pdbx_struct_special_symmetry.auth_comp_id
_pdbx_struct_special_symmetry.auth_seq_id
_pdbx_struct_special_symmetry.PDB_ins_code
_pdbx_struct_special_symmetry.label_asym_id
_pdbx_struct_special_symmetry.label_comp_id
_pdbx_struct_special_symmetry.label_seq_id
1 1 A K 401 ? B K .
2 1 A K 402 ? C K .
#
loop_
_pdbx_refine_tls.id
_pdbx_refine_tls.pdbx_refine_id
_pdbx_refine_tls.details
_pdbx_refine_tls.method
_pdbx_refine_tls.origin_x
_pdbx_refine_tls.origin_y
_pdbx_refine_tls.origin_z
_pdbx_refine_tls.T[1][1]
_pdbx_refine_tls.T[1][1]_esd
_pdbx_refine_tls.T[1][2]
_pdbx_refine_tls.T[1][2]_esd
_pdbx_refine_tls.T[1][3]
_pdbx_refine_tls.T[1][3]_esd
_pdbx_refine_tls.T[2][2]
_pdbx_refine_tls.T[2][2]_esd
_pdbx_refine_tls.T[2][3]
_pdbx_refine_tls.T[2][3]_esd
_pdbx_refine_tls.T[3][3]
_pdbx_refine_tls.T[3][3]_esd
_pdbx_refine_tls.L[1][1]
_pdbx_refine_tls.L[1][1]_esd
_pdbx_refine_tls.L[1][2]
_pdbx_refine_tls.L[1][2]_esd
_pdbx_refine_tls.L[1][3]
_pdbx_refine_tls.L[1][3]_esd
_pdbx_refine_tls.L[2][2]
_pdbx_refine_tls.L[2][2]_esd
_pdbx_refine_tls.L[2][3]
_pdbx_refine_tls.L[2][3]_esd
_pdbx_refine_tls.L[3][3]
_pdbx_refine_tls.L[3][3]_esd
_pdbx_refine_tls.S[1][1]
_pdbx_refine_tls.S[1][1]_esd
_pdbx_refine_tls.S[1][2]
_pdbx_refine_tls.S[1][2]_esd
_pdbx_refine_tls.S[1][3]
_pdbx_refine_tls.S[1][3]_esd
_pdbx_refine_tls.S[2][1]
_pdbx_refine_tls.S[2][1]_esd
_pdbx_refine_tls.S[2][2]
_pdbx_refine_tls.S[2][2]_esd
_pdbx_refine_tls.S[2][3]
_pdbx_refine_tls.S[2][3]_esd
_pdbx_refine_tls.S[3][1]
_pdbx_refine_tls.S[3][1]_esd
_pdbx_refine_tls.S[3][2]
_pdbx_refine_tls.S[3][2]_esd
_pdbx_refine_tls.S[3][3]
_pdbx_refine_tls.S[3][3]_esd
1 'X-RAY DIFFRACTION' ? refined -11.1923 -23.5730 6.6611 -0.6025 ? 0.3870 ? -0.2268 ? -0.1020 ? -0.1821 ? 0.8260 ? 9.6819 ?
-6.7486 ? -5.0067 ? 10.7586 ? 1.8567 ? 2.2334 ? 0.0537 ? 0.0321 ? 0.0818 ? -0.0368 ? 0.0159 ? 0.1359 ? -0.6243 ? -0.0775 ?
-0.0696 ?
2 'X-RAY DIFFRACTION' ? refined -9.2904 -41.9553 47.2484 0.6218 ? 0.2618 ? 0.2904 ? 0.3856 ? -0.3811 ? -0.5470 ? 6.6062 ?
1.2759 ? 1.9503 ? 3.3799 ? -0.6925 ? 13.8738 ? -0.0622 ? -1.8202 ? 0.9479 ? 1.2269 ? 0.1243 ? 1.0601 ? 0.0545 ? -1.2180 ?
-0.0620 ?
3 'X-RAY DIFFRACTION' ? refined 5.4702 -31.2040 0.5893 -0.4013 ? -0.0309 ? 0.2012 ? 0.0791 ? 0.3896 ? 0.3156 ? 21.9316 ?
-7.2226 ? 8.4301 ? 8.1776 ? -1.4117 ? 7.7388 ? 0.3837 ? 0.8800 ? 1.4039 ? -0.5737 ? -0.7319 ? -0.5706 ? 0.7581 ? 0.3690 ?
0.3482 ?
4 'X-RAY DIFFRACTION' ? refined 6.8566 -44.8129 24.8819 0.3232 ? -0.3515 ? -0.0376 ? 0.3853 ? 0.2526 ? 0.0976 ? 0.2654 ?
0.1696 ? -0.0835 ? 0.4231 ? -0.0835 ? 0.2575 ? -0.0039 ? 0.0105 ? 0.0051 ? -0.0032 ? 0.0036 ? -0.0132 ? -0.0234 ? -0.0094 ?
0.0003 ?
#
loop_
_pdbx_refine_tls_group.id
_pdbx_refine_tls_group.pdbx_refine_id
_pdbx_refine_tls_group.refine_tls_id
_pdbx_refine_tls_group.beg_label_asym_id
_pdbx_refine_tls_group.beg_label_seq_id
_pdbx_refine_tls_group.beg_auth_asym_id
_pdbx_refine_tls_group.beg_auth_seq_id
_pdbx_refine_tls_group.end_label_asym_id
_pdbx_refine_tls_group.end_label_seq_id
_pdbx_refine_tls_group.end_auth_asym_id
_pdbx_refine_tls_group.end_auth_seq_id
_pdbx_refine_tls_group.selection
_pdbx_refine_tls_group.selection_details
1 'X-RAY DIFFRACTION' 1 ? ? A 8 ? ? A 26 ? '{ A|8 - A|26 }'
2 'X-RAY DIFFRACTION' 2 ? ? A 35 ? ? A 136 ? '{ A|35 - A|136 }'
3 'X-RAY DIFFRACTION' 3 ? ? A 137 ? ? A 295 ? '{ A|137 - A|295 }'
4 'X-RAY DIFFRACTION' 4 ? ? A 403 ? ? A 403 ? '{ A|403 - A|403 }'
#
loop_
_pdbx_unobs_or_zero_occ_residues.id
_pdbx_unobs_or_zero_occ_residues.PDB_model_num
_pdbx_unobs_or_zero_occ_residues.polymer_flag
_pdbx_unobs_or_zero_occ_residues.occupancy_flag
_pdbx_unobs_or_zero_occ_residues.auth_asym_id
_pdbx_unobs_or_zero_occ_residues.auth_comp_id
_pdbx_unobs_or_zero_occ_residues.auth_seq_id
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code
_pdbx_unobs_or_zero_occ_residues.label_asym_id
_pdbx_unobs_or_zero_occ_residues.label_comp_id
_pdbx_unobs_or_zero_occ_residues.label_seq_id
1 1 Y 1 A MET 1 ? A MET 1
2 1 Y 1 A THR 2 ? A THR 2
3 1 Y 1 A GLY 3 ? A GLY 3
4 1 Y 1 A GLY 4 ? A GLY 4
5 1 Y 1 A MET 5 ? A MET 5
6 1 Y 1 A LYS 6 ? A LYS 6
7 1 Y 1 A PRO 7 ? A PRO 7
8 1 Y 1 A PRO 8 ? A PRO 8
9 1 Y 1 A ALA 9 ? A ALA 9
10 1 Y 1 A ARG 10 ? A ARG 10
11 1 Y 1 A LYS 11 ? A LYS 11
12 1 Y 1 A GLY 27 ? A GLY 27
13 1 Y 1 A LEU 28 ? A LEU 28
14 1 Y 1 A GLU 29 ? A GLU 29
15 1 Y 1 A LYS 30 ? A LYS 30
16 1 Y 1 A ARG 31 ? A ARG 31
17 1 Y 1 A GLY 32 ? A GLY 32
18 1 Y 1 A TRP 33 ? A TRP 33
19 1 Y 1 A LEU 34 ? A LEU 34
20 1 Y 1 A ALA 294 ? A ALA 294
21 1 Y 1 A GLN 295 ? A GLN 295
22 1 Y 1 A HIS 296 ? A HIS 296
23 1 Y 1 A HIS 297 ? A HIS 297
24 1 Y 1 A HIS 298 ? A HIS 298
25 1 Y 1 A HIS 299 ? A HIS 299
26 1 Y 1 A HIS 300 ? A HIS 300
27 1 Y 1 A HIS 301 ? A HIS 301
#
loop_
_chem_comp_atom.comp_id
_chem_comp_atom.atom_id
_chem_comp_atom.type_symbol
_chem_comp_atom.pdbx_aromatic_flag
_chem_comp_atom.pdbx_stereo_config
_chem_comp_atom.pdbx_ordinal
6E3 O1 O N N 1
6E3 C7 C N N 2
6E3 C8 C N N 3
6E3 C9 C N N 4
6E3 N N N N 5
6E3 C3 C N N 6
6E3 C4 C N N 7
6E3 C5 C N N 8
6E3 C6 C N N 9
6E3 C1 C N N 10
6E3 N1 N N N 11
6E3 C C N N 12
6E3 O O N N 13
6E3 C2 C N N 14
6E3 H4 H N N 15
6E3 H3 H N N 16
6E3 H11 H N N 17
6E3 H6 H N N 18
6E3 H5 H N N 19
6E3 H7 H N N 20
6E3 H9 H N N 21
6E3 H10 H N N 22
6E3 H8 H N N 23
6E3 H2 H N N 24
6E3 H1 H N N 25
6E3 H H N N 26
ALA N N N N 27
ALA CA C N S 28
ALA C C N N 29
ALA O O N N 30
ALA CB C N N 31
ALA OXT O N N 32
ALA H H N N 33
ALA H2 H N N 34
ALA HA H N N 35
ALA HB1 H N N 36
ALA HB2 H N N 37
ALA HB3 H N N 38
ALA HXT H N N 39
ARG N N N N 40
ARG CA C N S 41
ARG C C N N 42
ARG O O N N 43
ARG CB C N N 44
ARG CG C N N 45
ARG CD C N N 46
ARG NE N N N 47
ARG CZ C N N 48
ARG NH1 N N N 49
ARG NH2 N N N 50
ARG OXT O N N 51
ARG H H N N 52
ARG H2 H N N 53
ARG HA H N N 54
ARG HB2 H N N 55
ARG HB3 H N N 56
ARG HG2 H N N 57
ARG HG3 H N N 58
ARG HD2 H N N 59
ARG HD3 H N N 60
ARG HE H N N 61
ARG HH11 H N N 62
ARG HH12 H N N 63
ARG HH21 H N N 64
ARG HH22 H N N 65
ARG HXT H N N 66
ASN N N N N 67
ASN CA C N S 68
ASN C C N N 69
ASN O O N N 70
ASN CB C N N 71
ASN CG C N N 72
ASN OD1 O N N 73
ASN ND2 N N N 74
ASN OXT O N N 75
ASN H H N N 76
ASN H2 H N N 77
ASN HA H N N 78
ASN HB2 H N N 79
ASN HB3 H N N 80
ASN HD21 H N N 81
ASN HD22 H N N 82
ASN HXT H N N 83
ASP N N N N 84
ASP CA C N S 85
ASP C C N N 86
ASP O O N N 87
ASP CB C N N 88
ASP CG C N N 89
ASP OD1 O N N 90
ASP OD2 O N N 91
ASP OXT O N N 92
ASP H H N N 93
ASP H2 H N N 94
ASP HA H N N 95
ASP HB2 H N N 96
ASP HB3 H N N 97
ASP HD2 H N N 98
ASP HXT H N N 99
CYS N N N N 100
CYS CA C N R 101
CYS C C N N 102
CYS O O N N 103
CYS CB C N N 104
CYS SG S N N 105
CYS OXT O N N 106
CYS H H N N 107
CYS H2 H N N 108
CYS HA H N N 109
CYS HB2 H N N 110
CYS HB3 H N N 111
CYS HG H N N 112
CYS HXT H N N 113
GLN N N N N 114
GLN CA C N S 115
GLN C C N N 116
GLN O O N N 117
GLN CB C N N 118
GLN CG C N N 119
GLN CD C N N 120
GLN OE1 O N N 121
GLN NE2 N N N 122
GLN OXT O N N 123
GLN H H N N 124
GLN H2 H N N 125
GLN HA H N N 126
GLN HB2 H N N 127
GLN HB3 H N N 128
GLN HG2 H N N 129
GLN HG3 H N N 130
GLN HE21 H N N 131
GLN HE22 H N N 132
GLN HXT H N N 133
GLU N N N N 134
GLU CA C N S 135
GLU C C N N 136
GLU O O N N 137
GLU CB C N N 138
GLU CG C N N 139
GLU CD C N N 140
GLU OE1 O N N 141
GLU OE2 O N N 142
GLU OXT O N N 143
GLU H H N N 144
GLU H2 H N N 145
GLU HA H N N 146
GLU HB2 H N N 147
GLU HB3 H N N 148
GLU HG2 H N N 149
GLU HG3 H N N 150
GLU HE2 H N N 151
GLU HXT H N N 152
GLY N N N N 153
GLY CA C N N 154
GLY C C N N 155
GLY O O N N 156
GLY OXT O N N 157
GLY H H N N 158
GLY H2 H N N 159
GLY HA2 H N N 160
GLY HA3 H N N 161
GLY HXT H N N 162
HIS N N N N 163
HIS CA C N S 164
HIS C C N N 165
HIS O O N N 166
HIS CB C N N 167
HIS CG C Y N 168
HIS ND1 N Y N 169
HIS CD2 C Y N 170
HIS CE1 C Y N 171
HIS NE2 N Y N 172
HIS OXT O N N 173
HIS H H N N 174
HIS H2 H N N 175
HIS HA H N N 176
HIS HB2 H N N 177
HIS HB3 H N N 178
HIS HD1 H N N 179
HIS HD2 H N N 180
HIS HE1 H N N 181
HIS HE2 H N N 182
HIS HXT H N N 183
ILE N N N N 184
ILE CA C N S 185
ILE C C N N 186
ILE O O N N 187
ILE CB C N S 188
ILE CG1 C N N 189
ILE CG2 C N N 190
ILE CD1 C N N 191
ILE OXT O N N 192
ILE H H N N 193
ILE H2 H N N 194
ILE HA H N N 195
ILE HB H N N 196
ILE HG12 H N N 197
ILE HG13 H N N 198
ILE HG21 H N N 199
ILE HG22 H N N 200
ILE HG23 H N N 201
ILE HD11 H N N 202
ILE HD12 H N N 203
ILE HD13 H N N 204
ILE HXT H N N 205
K K K N N 206
LEU N N N N 207
LEU CA C N S 208
LEU C C N N 209
LEU O O N N 210
LEU CB C N N 211
LEU CG C N N 212
LEU CD1 C N N 213
LEU CD2 C N N 214
LEU OXT O N N 215
LEU H H N N 216
LEU H2 H N N 217
LEU HA H N N 218
LEU HB2 H N N 219
LEU HB3 H N N 220
LEU HG H N N 221
LEU HD11 H N N 222
LEU HD12 H N N 223
LEU HD13 H N N 224
LEU HD21 H N N 225
LEU HD22 H N N 226
LEU HD23 H N N 227
LEU HXT H N N 228
LYS N N N N 229
LYS CA C N S 230
LYS C C N N 231
LYS O O N N 232
LYS CB C N N 233
LYS CG C N N 234
LYS CD C N N 235
LYS CE C N N 236
LYS NZ N N N 237
LYS OXT O N N 238
LYS H H N N 239
LYS H2 H N N 240
LYS HA H N N 241
LYS HB2 H N N 242
LYS HB3 H N N 243
LYS HG2 H N N 244
LYS HG3 H N N 245
LYS HD2 H N N 246
LYS HD3 H N N 247
LYS HE2 H N N 248
LYS HE3 H N N 249
LYS HZ1 H N N 250
LYS HZ2 H N N 251
LYS HZ3 H N N 252
LYS HXT H N N 253
MET N N N N 254
MET CA C N S 255
MET C C N N 256
MET O O N N 257
MET CB C N N 258
MET CG C N N 259
MET SD S N N 260
MET CE C N N 261
MET OXT O N N 262
MET H H N N 263
MET H2 H N N 264
MET HA H N N 265
MET HB2 H N N 266
MET HB3 H N N 267
MET HG2 H N N 268
MET HG3 H N N 269
MET HE1 H N N 270
MET HE2 H N N 271
MET HE3 H N N 272
MET HXT H N N 273
PHE N N N N 274
PHE CA C N S 275
PHE C C N N 276
PHE O O N N 277
PHE CB C N N 278
PHE CG C Y N 279
PHE CD1 C Y N 280
PHE CD2 C Y N 281
PHE CE1 C Y N 282
PHE CE2 C Y N 283
PHE CZ C Y N 284
PHE OXT O N N 285
PHE H H N N 286
PHE H2 H N N 287
PHE HA H N N 288
PHE HB2 H N N 289
PHE HB3 H N N 290
PHE HD1 H N N 291
PHE HD2 H N N 292
PHE HE1 H N N 293
PHE HE2 H N N 294
PHE HZ H N N 295
PHE HXT H N N 296
PRO N N N N 297
PRO CA C N S 298
PRO C C N N 299
PRO O O N N 300
PRO CB C N N 301
PRO CG C N N 302
PRO CD C N N 303
PRO OXT O N N 304
PRO H H N N 305
PRO HA H N N 306
PRO HB2 H N N 307
PRO HB3 H N N 308
PRO HG2 H N N 309
PRO HG3 H N N 310
PRO HD2 H N N 311
PRO HD3 H N N 312
PRO HXT H N N 313
SER N N N N 314
SER CA C N S 315
SER C C N N 316
SER O O N N 317
SER CB C N N 318
SER OG O N N 319
SER OXT O N N 320
SER H H N N 321
SER H2 H N N 322
SER HA H N N 323
SER HB2 H N N 324
SER HB3 H N N 325
SER HG H N N 326
SER HXT H N N 327
THR N N N N 328
THR CA C N S 329
THR C C N N 330
THR O O N N 331
THR CB C N R 332
THR OG1 O N N 333
THR CG2 C N N 334
THR OXT O N N 335
THR H H N N 336
THR H2 H N N 337
THR HA H N N 338
THR HB H N N 339
THR HG1 H N N 340
THR HG21 H N N 341
THR HG22 H N N 342
THR HG23 H N N 343
THR HXT H N N 344
TRP N N N N 345
TRP CA C N S 346
TRP C C N N 347
TRP O O N N 348
TRP CB C N N 349
TRP CG C Y N 350
TRP CD1 C Y N 351
TRP CD2 C Y N 352
TRP NE1 N Y N 353
TRP CE2 C Y N 354
TRP CE3 C Y N 355
TRP CZ2 C Y N 356
TRP CZ3 C Y N 357
TRP CH2 C Y N 358
TRP OXT O N N 359
TRP H H N N 360
TRP H2 H N N 361
TRP HA H N N 362
TRP HB2 H N N 363
TRP HB3 H N N 364
TRP HD1 H N N 365
TRP HE1 H N N 366
TRP HE3 H N N 367
TRP HZ2 H N N 368
TRP HZ3 H N N 369
TRP HH2 H N N 370
TRP HXT H N N 371
TYR N N N N 372
TYR CA C N S 373
TYR C C N N 374
TYR O O N N 375
TYR CB C N N 376
TYR CG C Y N 377
TYR CD1 C Y N 378
TYR CD2 C Y N 379
TYR CE1 C Y N 380
TYR CE2 C Y N 381
TYR CZ C Y N 382
TYR OH O N N 383
TYR OXT O N N 384
TYR H H N N 385
TYR H2 H N N 386
TYR HA H N N 387
TYR HB2 H N N 388
TYR HB3 H N N 389
TYR HD1 H N N 390
TYR HD2 H N N 391
TYR HE1 H N N 392
TYR HE2 H N N 393
TYR HH H N N 394
TYR HXT H N N 395
VAL N N N N 396
VAL CA C N S 397
VAL C C N N 398
VAL O O N N 399
VAL CB C N N 400
VAL CG1 C N N 401
VAL CG2 C N N 402
VAL OXT O N N 403
VAL H H N N 404
VAL H2 H N N 405
VAL HA H N N 406
VAL HB H N N 407
VAL HG11 H N N 408
VAL HG12 H N N 409
VAL HG13 H N N 410
VAL HG21 H N N 411
VAL HG22 H N N 412
VAL HG23 H N N 413
VAL HXT H N N 414
#
loop_
_chem_comp_bond.comp_id
_chem_comp_bond.atom_id_1
_chem_comp_bond.atom_id_2
_chem_comp_bond.value_order
_chem_comp_bond.pdbx_aromatic_flag
_chem_comp_bond.pdbx_stereo_config
_chem_comp_bond.pdbx_ordinal
6E3 C9 C1 sing N N 1
6E3 C8 C2 sing N N 2
6E3 C6 C4 sing N N 3
6E3 C7 C3 sing N N 4
6E3 C2 C1 doub N N 5
6E3 C2 N sing N N 6
6E3 C1 C sing N N 7
6E3 C4 C3 doub N N 8
6E3 C4 C5 sing N N 9
6E3 C3 N sing N N 10
6E3 C5 O1 doub N N 11
6E3 C5 N1 sing N N 12
6E3 N N1 sing N N 13
6E3 C N1 sing N N 14
6E3 C O doub N N 15
6E3 C7 H4 sing N N 16
6E3 C7 H3 sing N N 17
6E3 C7 H11 sing N N 18
6E3 C8 H6 sing N N 19
6E3 C8 H5 sing N N 20
6E3 C8 H7 sing N N 21
6E3 C9 H9 sing N N 22
6E3 C9 H10 sing N N 23
6E3 C9 H8 sing N N 24
6E3 C6 H2 sing N N 25
6E3 C6 H1 sing N N 26
6E3 C6 H sing N N 27
ALA N CA sing N N 28
ALA N H sing N N 29
ALA N H2 sing N N 30
ALA CA C sing N N 31
ALA CA CB sing N N 32
ALA CA HA sing N N 33
ALA C O doub N N 34
ALA C OXT sing N N 35
ALA CB HB1 sing N N 36
ALA CB HB2 sing N N 37
ALA CB HB3 sing N N 38
ALA OXT HXT sing N N 39
ARG N CA sing N N 40
ARG N H sing N N 41
ARG N H2 sing N N 42
ARG CA C sing N N 43
ARG CA CB sing N N 44
ARG CA HA sing N N 45
ARG C O doub N N 46
ARG C OXT sing N N 47
ARG CB CG sing N N 48
ARG CB HB2 sing N N 49
ARG CB HB3 sing N N 50
ARG CG CD sing N N 51
ARG CG HG2 sing N N 52
ARG CG HG3 sing N N 53
ARG CD NE sing N N 54
ARG CD HD2 sing N N 55
ARG CD HD3 sing N N 56
ARG NE CZ sing N N 57
ARG NE HE sing N N 58
ARG CZ NH1 sing N N 59
ARG CZ NH2 doub N N 60
ARG NH1 HH11 sing N N 61
ARG NH1 HH12 sing N N 62
ARG NH2 HH21 sing N N 63
ARG NH2 HH22 sing N N 64
ARG OXT HXT sing N N 65
ASN N CA sing N N 66
ASN N H sing N N 67
ASN N H2 sing N N 68
ASN CA C sing N N 69
ASN CA CB sing N N 70
ASN CA HA sing N N 71
ASN C O doub N N 72
ASN C OXT sing N N 73
ASN CB CG sing N N 74
ASN CB HB2 sing N N 75
ASN CB HB3 sing N N 76
ASN CG OD1 doub N N 77
ASN CG ND2 sing N N 78
ASN ND2 HD21 sing N N 79
ASN ND2 HD22 sing N N 80
ASN OXT HXT sing N N 81
ASP N CA sing N N 82
ASP N H sing N N 83
ASP N H2 sing N N 84
ASP CA C sing N N 85
ASP CA CB sing N N 86
ASP CA HA sing N N 87
ASP C O doub N N 88
ASP C OXT sing N N 89
ASP CB CG sing N N 90
ASP CB HB2 sing N N 91
ASP CB HB3 sing N N 92
ASP CG OD1 doub N N 93
ASP CG OD2 sing N N 94
ASP OD2 HD2 sing N N 95
ASP OXT HXT sing N N 96
CYS N CA sing N N 97
CYS N H sing N N 98
CYS N H2 sing N N 99
CYS CA C sing N N 100
CYS CA CB sing N N 101
CYS CA HA sing N N 102
CYS C O doub N N 103
CYS C OXT sing N N 104
CYS CB SG sing N N 105
CYS CB HB2 sing N N 106
CYS CB HB3 sing N N 107
CYS SG HG sing N N 108
CYS OXT HXT sing N N 109
GLN N CA sing N N 110
GLN N H sing N N 111
GLN N H2 sing N N 112
GLN CA C sing N N 113
GLN CA CB sing N N 114
GLN CA HA sing N N 115
GLN C O doub N N 116
GLN C OXT sing N N 117
GLN CB CG sing N N 118
GLN CB HB2 sing N N 119
GLN CB HB3 sing N N 120
GLN CG CD sing N N 121
GLN CG HG2 sing N N 122
GLN CG HG3 sing N N 123
GLN CD OE1 doub N N 124
GLN CD NE2 sing N N 125
GLN NE2 HE21 sing N N 126
GLN NE2 HE22 sing N N 127
GLN OXT HXT sing N N 128
GLU N CA sing N N 129
GLU N H sing N N 130
GLU N H2 sing N N 131
GLU CA C sing N N 132
GLU CA CB sing N N 133
GLU CA HA sing N N 134
GLU C O doub N N 135
GLU C OXT sing N N 136
GLU CB CG sing N N 137
GLU CB HB2 sing N N 138
GLU CB HB3 sing N N 139
GLU CG CD sing N N 140
GLU CG HG2 sing N N 141
GLU CG HG3 sing N N 142
GLU CD OE1 doub N N 143
GLU CD OE2 sing N N 144
GLU OE2 HE2 sing N N 145
GLU OXT HXT sing N N 146
GLY N CA sing N N 147
GLY N H sing N N 148
GLY N H2 sing N N 149
GLY CA C sing N N 150
GLY CA HA2 sing N N 151
GLY CA HA3 sing N N 152
GLY C O doub N N 153
GLY C OXT sing N N 154
GLY OXT HXT sing N N 155
HIS N CA sing N N 156
HIS N H sing N N 157
HIS N H2 sing N N 158
HIS CA C sing N N 159
HIS CA CB sing N N 160
HIS CA HA sing N N 161
HIS C O doub N N 162
HIS C OXT sing N N 163
HIS CB CG sing N N 164
HIS CB HB2 sing N N 165
HIS CB HB3 sing N N 166
HIS CG ND1 sing Y N 167
HIS CG CD2 doub Y N 168
HIS ND1 CE1 doub Y N 169
HIS ND1 HD1 sing N N 170
HIS CD2 NE2 sing Y N 171
HIS CD2 HD2 sing N N 172
HIS CE1 NE2 sing Y N 173
HIS CE1 HE1 sing N N 174
HIS NE2 HE2 sing N N 175
HIS OXT HXT sing N N 176
ILE N CA sing N N 177
ILE N H sing N N 178
ILE N H2 sing N N 179
ILE CA C sing N N 180
ILE CA CB sing N N 181
ILE CA HA sing N N 182
ILE C O doub N N 183
ILE C OXT sing N N 184
ILE CB CG1 sing N N 185
ILE CB CG2 sing N N 186
ILE CB HB sing N N 187
ILE CG1 CD1 sing N N 188
ILE CG1 HG12 sing N N 189
ILE CG1 HG13 sing N N 190
ILE CG2 HG21 sing N N 191
ILE CG2 HG22 sing N N 192
ILE CG2 HG23 sing N N 193
ILE CD1 HD11 sing N N 194
ILE CD1 HD12 sing N N 195
ILE CD1 HD13 sing N N 196
ILE OXT HXT sing N N 197
LEU N CA sing N N 198
LEU N H sing N N 199
LEU N H2 sing N N 200
LEU CA C sing N N 201
LEU CA CB sing N N 202
LEU CA HA sing N N 203
LEU C O doub N N 204
LEU C OXT sing N N 205
LEU CB CG sing N N 206
LEU CB HB2 sing N N 207
LEU CB HB3 sing N N 208
LEU CG CD1 sing N N 209
LEU CG CD2 sing N N 210
LEU CG HG sing N N 211
LEU CD1 HD11 sing N N 212
LEU CD1 HD12 sing N N 213
LEU CD1 HD13 sing N N 214
LEU CD2 HD21 sing N N 215
LEU CD2 HD22 sing N N 216
LEU CD2 HD23 sing N N 217
LEU OXT HXT sing N N 218
LYS N CA sing N N 219
LYS N H sing N N 220
LYS N H2 sing N N 221
LYS CA C sing N N 222
LYS CA CB sing N N 223
LYS CA HA sing N N 224
LYS C O doub N N 225
LYS C OXT sing N N 226
LYS CB CG sing N N 227
LYS CB HB2 sing N N 228
LYS CB HB3 sing N N 229
LYS CG CD sing N N 230
LYS CG HG2 sing N N 231
LYS CG HG3 sing N N 232
LYS CD CE sing N N 233
LYS CD HD2 sing N N 234
LYS CD HD3 sing N N 235
LYS CE NZ sing N N 236
LYS CE HE2 sing N N 237
LYS CE HE3 sing N N 238
LYS NZ HZ1 sing N N 239
LYS NZ HZ2 sing N N 240
LYS NZ HZ3 sing N N 241
LYS OXT HXT sing N N 242
MET N CA sing N N 243
MET N H sing N N 244
MET N H2 sing N N 245
MET CA C sing N N 246
MET CA CB sing N N 247
MET CA HA sing N N 248
MET C O doub N N 249
MET C OXT sing N N 250
MET CB CG sing N N 251
MET CB HB2 sing N N 252
MET CB HB3 sing N N 253
MET CG SD sing N N 254
MET CG HG2 sing N N 255
MET CG HG3 sing N N 256
MET SD CE sing N N 257
MET CE HE1 sing N N 258
MET CE HE2 sing N N 259
MET CE HE3 sing N N 260
MET OXT HXT sing N N 261
PHE N CA sing N N 262
PHE N H sing N N 263
PHE N H2 sing N N 264
PHE CA C sing N N 265
PHE CA CB sing N N 266
PHE CA HA sing N N 267
PHE C O doub N N 268
PHE C OXT sing N N 269
PHE CB CG sing N N 270
PHE CB HB2 sing N N 271
PHE CB HB3 sing N N 272
PHE CG CD1 doub Y N 273
PHE CG CD2 sing Y N 274
PHE CD1 CE1 sing Y N 275
PHE CD1 HD1 sing N N 276
PHE CD2 CE2 doub Y N 277
PHE CD2 HD2 sing N N 278
PHE CE1 CZ doub Y N 279
PHE CE1 HE1 sing N N 280
PHE CE2 CZ sing Y N 281
PHE CE2 HE2 sing N N 282
PHE CZ HZ sing N N 283
PHE OXT HXT sing N N 284
PRO N CA sing N N 285
PRO N CD sing N N 286
PRO N H sing N N 287
PRO CA C sing N N 288
PRO CA CB sing N N 289
PRO CA HA sing N N 290
PRO C O doub N N 291
PRO C OXT sing N N 292
PRO CB CG sing N N 293
PRO CB HB2 sing N N 294
PRO CB HB3 sing N N 295
PRO CG CD sing N N 296
PRO CG HG2 sing N N 297
PRO CG HG3 sing N N 298
PRO CD HD2 sing N N 299
PRO CD HD3 sing N N 300
PRO OXT HXT sing N N 301
SER N CA sing N N 302
SER N H sing N N 303
SER N H2 sing N N 304
SER CA C sing N N 305
SER CA CB sing N N 306
SER CA HA sing N N 307
SER C O doub N N 308
SER C OXT sing N N 309
SER CB OG sing N N 310
SER CB HB2 sing N N 311
SER CB HB3 sing N N 312
SER OG HG sing N N 313
SER OXT HXT sing N N 314
THR N CA sing N N 315
THR N H sing N N 316
THR N H2 sing N N 317
THR CA C sing N N 318
THR CA CB sing N N 319
THR CA HA sing N N 320
THR C O doub N N 321
THR C OXT sing N N 322
THR CB OG1 sing N N 323
THR CB CG2 sing N N 324
THR CB HB sing N N 325
THR OG1 HG1 sing N N 326
THR CG2 HG21 sing N N 327
THR CG2 HG22 sing N N 328
THR CG2 HG23 sing N N 329
THR OXT HXT sing N N 330
TRP N CA sing N N 331
TRP N H sing N N 332
TRP N H2 sing N N 333
TRP CA C sing N N 334
TRP CA CB sing N N 335
TRP CA HA sing N N 336
TRP C O doub N N 337
TRP C OXT sing N N 338
TRP CB CG sing N N 339
TRP CB HB2 sing N N 340
TRP CB HB3 sing N N 341
TRP CG CD1 doub Y N 342
TRP CG CD2 sing Y N 343
TRP CD1 NE1 sing Y N 344
TRP CD1 HD1 sing N N 345
TRP CD2 CE2 doub Y N 346
TRP CD2 CE3 sing Y N 347
TRP NE1 CE2 sing Y N 348
TRP NE1 HE1 sing N N 349
TRP CE2 CZ2 sing Y N 350
TRP CE3 CZ3 doub Y N 351
TRP CE3 HE3 sing N N 352
TRP CZ2 CH2 doub Y N 353
TRP CZ2 HZ2 sing N N 354
TRP CZ3 CH2 sing Y N 355
TRP CZ3 HZ3 sing N N 356
TRP CH2 HH2 sing N N 357
TRP OXT HXT sing N N 358
TYR N CA sing N N 359
TYR N H sing N N 360
TYR N H2 sing N N 361
TYR CA C sing N N 362
TYR CA CB sing N N 363
TYR CA HA sing N N 364
TYR C O doub N N 365
TYR C OXT sing N N 366
TYR CB CG sing N N 367
TYR CB HB2 sing N N 368
TYR CB HB3 sing N N 369
TYR CG CD1 doub Y N 370
TYR CG CD2 sing Y N 371
TYR CD1 CE1 sing Y N 372
TYR CD1 HD1 sing N N 373
TYR CD2 CE2 doub Y N 374
TYR CD2 HD2 sing N N 375
TYR CE1 CZ doub Y N 376
TYR CE1 HE1 sing N N 377
TYR CE2 CZ sing Y N 378
TYR CE2 HE2 sing N N 379
TYR CZ OH sing N N 380
TYR OH HH sing N N 381
TYR OXT HXT sing N N 382
VAL N CA sing N N 383
VAL N H sing N N 384
VAL N H2 sing N N 385
VAL CA C sing N N 386
VAL CA CB sing N N 387
VAL CA HA sing N N 388
VAL C O doub N N 389
VAL C OXT sing N N 390
VAL CB CG1 sing N N 391
VAL CB CG2 sing N N 392
VAL CB HB sing N N 393
VAL CG1 HG11 sing N N 394
VAL CG1 HG12 sing N N 395
VAL CG1 HG13 sing N N 396
VAL CG2 HG21 sing N N 397
VAL CG2 HG22 sing N N 398
VAL CG2 HG23 sing N N 399
VAL OXT HXT sing N N 400
#
_pdbx_audit_support.funding_organization 'National Health and Medical Research Council (NHMRC, Australia)'
_pdbx_audit_support.country Australia
_pdbx_audit_support.grant_number ?
_pdbx_audit_support.ordinal 1
#
_pdbx_initial_refinement_model.id 1
_pdbx_initial_refinement_model.entity_id_list ?
_pdbx_initial_refinement_model.type 'experimental model'
_pdbx_initial_refinement_model.source_name PDB
_pdbx_initial_refinement_model.accession_code 1XL4
_pdbx_initial_refinement_model.details ?
#
_atom_sites.entry_id 6O9T
_atom_sites.fract_transf_matrix[1][1] 0.009698
_atom_sites.fract_transf_matrix[1][2] 0.000000
_atom_sites.fract_transf_matrix[1][3] 0.000000
_atom_sites.fract_transf_matrix[2][1] 0.000000
_atom_sites.fract_transf_matrix[2][2] 0.009698
_atom_sites.fract_transf_matrix[2][3] 0.000000
_atom_sites.fract_transf_matrix[3][1] 0.000000
_atom_sites.fract_transf_matrix[3][2] 0.000000
_atom_sites.fract_transf_matrix[3][3] 0.011202
_atom_sites.fract_transf_vector[1] 0.00000
_atom_sites.fract_transf_vector[2] 0.00000
_atom_sites.fract_transf_vector[3] 0.00000
#
loop_
_atom_type.symbol
C
K
N
O
S
#
loop_