data_6O9T # _entry.id 6O9T # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6O9T pdb_00006o9t 10.2210/pdb6o9t/pdb WWPDB D_1000240269 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-05-27 2 'Structure model' 1 1 2020-12-09 3 'Structure model' 1 2 2020-12-16 4 'Structure model' 1 3 2023-10-11 5 'Structure model' 1 4 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Database references' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Refinement description' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' pdbx_struct_conn_angle 4 2 'Structure model' struct_conn 5 2 'Structure model' struct_conn_type 6 3 'Structure model' citation 7 3 'Structure model' citation_author 8 4 'Structure model' chem_comp_atom 9 4 'Structure model' chem_comp_bond 10 4 'Structure model' database_2 11 4 'Structure model' pdbx_initial_refinement_model 12 5 'Structure model' pdbx_entry_details 13 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 15 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 16 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 17 2 'Structure model' '_pdbx_struct_conn_angle.value' 18 2 'Structure model' '_struct_conn.conn_type_id' 19 2 'Structure model' '_struct_conn.id' 20 2 'Structure model' '_struct_conn.pdbx_dist_value' 21 2 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 22 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 23 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 24 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 25 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 26 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 27 2 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 28 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 29 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 30 2 'Structure model' '_struct_conn.ptnr2_label_atom_id' 31 2 'Structure model' '_struct_conn.ptnr2_label_comp_id' 32 2 'Structure model' '_struct_conn.ptnr2_symmetry' 33 2 'Structure model' '_struct_conn_type.id' 34 3 'Structure model' '_citation.journal_volume' 35 3 'Structure model' '_citation.page_first' 36 3 'Structure model' '_citation.page_last' 37 3 'Structure model' '_citation.title' 38 3 'Structure model' '_citation_author.identifier_ORCID' 39 4 'Structure model' '_database_2.pdbx_DOI' 40 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6O9T _pdbx_database_status.recvd_initial_deposition_date 2019-03-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Gulbis, J.M.' 1 0000-0003-2091-2237 'Black, K.A.' 2 0000-0002-4094-6170 'Miller, D.M.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 11 _citation.language ? _citation.page_first 3024 _citation.page_last 3024 _citation.title 'A constricted opening in Kir channels does not impede potassium conduction.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-020-16842-0 _citation.pdbx_database_id_PubMed 32541684 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Black, K.A.' 1 ? primary 'He, S.' 2 ? primary 'Jin, R.' 3 ? primary 'Miller, D.M.' 4 ? primary 'Bolla, J.R.' 5 ? primary 'Clarke, O.B.' 6 ? primary 'Johnson, P.' 7 ? primary 'Windley, M.' 8 ? primary 'Burns, C.J.' 9 ? primary 'Hill, A.P.' 10 ? primary 'Laver, D.' 11 ? primary 'Robinson, C.V.' 12 ? primary 'Smith, B.J.' 13 ? primary 'Gulbis, J.M.' 14 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Inward rectifier potassium channel Kirbac3.1' 33792.785 1 ? 'C71V, C119V, C262S, A133C, T136C' ? ? 2 non-polymer syn 'POTASSIUM ION' 39.098 2 ? ? ? ? 3 non-polymer syn '2,3,5,6-tetramethyl-1H,7H-pyrazolo[1,2-a]pyrazole-1,7-dione' 192.214 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTGGMKPPARKPRILNSDGSSNITRLGLEKRGWLDDHYHDLLTVSWPVFITLITGLYLVTNALFALAYLAVGDVIENARP GSFTDAFFFSVQTMATIGYGKLIPIGPLANTLVTLEALVGMLGLAVAASLIYCRFCRPTAGVLFSSRMVISDFEGKPTLM MRLANLRIEQIIEADVHLVLVRSEISQEGMVFRRFHDLTLTRSRSPIFSLSWTVMHPIDHHSPIYGETDETLRNSHSEFL VLFTGHHEAFAQNVHARHAYSSDEIIWGGHFVDVFTTLPDGRRALDLGKFHEIAQHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MTGGMKPPARKPRILNSDGSSNITRLGLEKRGWLDDHYHDLLTVSWPVFITLITGLYLVTNALFALAYLAVGDVIENARP GSFTDAFFFSVQTMATIGYGKLIPIGPLANTLVTLEALVGMLGLAVAASLIYCRFCRPTAGVLFSSRMVISDFEGKPTLM MRLANLRIEQIIEADVHLVLVRSEISQEGMVFRRFHDLTLTRSRSPIFSLSWTVMHPIDHHSPIYGETDETLRNSHSEFL VLFTGHHEAFAQNVHARHAYSSDEIIWGGHFVDVFTTLPDGRRALDLGKFHEIAQHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'POTASSIUM ION' K 3 '2,3,5,6-tetramethyl-1H,7H-pyrazolo[1,2-a]pyrazole-1,7-dione' 6E3 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 GLY n 1 4 GLY n 1 5 MET n 1 6 LYS n 1 7 PRO n 1 8 PRO n 1 9 ALA n 1 10 ARG n 1 11 LYS n 1 12 PRO n 1 13 ARG n 1 14 ILE n 1 15 LEU n 1 16 ASN n 1 17 SER n 1 18 ASP n 1 19 GLY n 1 20 SER n 1 21 SER n 1 22 ASN n 1 23 ILE n 1 24 THR n 1 25 ARG n 1 26 LEU n 1 27 GLY n 1 28 LEU n 1 29 GLU n 1 30 LYS n 1 31 ARG n 1 32 GLY n 1 33 TRP n 1 34 LEU n 1 35 ASP n 1 36 ASP n 1 37 HIS n 1 38 TYR n 1 39 HIS n 1 40 ASP n 1 41 LEU n 1 42 LEU n 1 43 THR n 1 44 VAL n 1 45 SER n 1 46 TRP n 1 47 PRO n 1 48 VAL n 1 49 PHE n 1 50 ILE n 1 51 THR n 1 52 LEU n 1 53 ILE n 1 54 THR n 1 55 GLY n 1 56 LEU n 1 57 TYR n 1 58 LEU n 1 59 VAL n 1 60 THR n 1 61 ASN n 1 62 ALA n 1 63 LEU n 1 64 PHE n 1 65 ALA n 1 66 LEU n 1 67 ALA n 1 68 TYR n 1 69 LEU n 1 70 ALA n 1 71 VAL n 1 72 GLY n 1 73 ASP n 1 74 VAL n 1 75 ILE n 1 76 GLU n 1 77 ASN n 1 78 ALA n 1 79 ARG n 1 80 PRO n 1 81 GLY n 1 82 SER n 1 83 PHE n 1 84 THR n 1 85 ASP n 1 86 ALA n 1 87 PHE n 1 88 PHE n 1 89 PHE n 1 90 SER n 1 91 VAL n 1 92 GLN n 1 93 THR n 1 94 MET n 1 95 ALA n 1 96 THR n 1 97 ILE n 1 98 GLY n 1 99 TYR n 1 100 GLY n 1 101 LYS n 1 102 LEU n 1 103 ILE n 1 104 PRO n 1 105 ILE n 1 106 GLY n 1 107 PRO n 1 108 LEU n 1 109 ALA n 1 110 ASN n 1 111 THR n 1 112 LEU n 1 113 VAL n 1 114 THR n 1 115 LEU n 1 116 GLU n 1 117 ALA n 1 118 LEU n 1 119 VAL n 1 120 GLY n 1 121 MET n 1 122 LEU n 1 123 GLY n 1 124 LEU n 1 125 ALA n 1 126 VAL n 1 127 ALA n 1 128 ALA n 1 129 SER n 1 130 LEU n 1 131 ILE n 1 132 TYR n 1 133 CYS n 1 134 ARG n 1 135 PHE n 1 136 CYS n 1 137 ARG n 1 138 PRO n 1 139 THR n 1 140 ALA n 1 141 GLY n 1 142 VAL n 1 143 LEU n 1 144 PHE n 1 145 SER n 1 146 SER n 1 147 ARG n 1 148 MET n 1 149 VAL n 1 150 ILE n 1 151 SER n 1 152 ASP n 1 153 PHE n 1 154 GLU n 1 155 GLY n 1 156 LYS n 1 157 PRO n 1 158 THR n 1 159 LEU n 1 160 MET n 1 161 MET n 1 162 ARG n 1 163 LEU n 1 164 ALA n 1 165 ASN n 1 166 LEU n 1 167 ARG n 1 168 ILE n 1 169 GLU n 1 170 GLN n 1 171 ILE n 1 172 ILE n 1 173 GLU n 1 174 ALA n 1 175 ASP n 1 176 VAL n 1 177 HIS n 1 178 LEU n 1 179 VAL n 1 180 LEU n 1 181 VAL n 1 182 ARG n 1 183 SER n 1 184 GLU n 1 185 ILE n 1 186 SER n 1 187 GLN n 1 188 GLU n 1 189 GLY n 1 190 MET n 1 191 VAL n 1 192 PHE n 1 193 ARG n 1 194 ARG n 1 195 PHE n 1 196 HIS n 1 197 ASP n 1 198 LEU n 1 199 THR n 1 200 LEU n 1 201 THR n 1 202 ARG n 1 203 SER n 1 204 ARG n 1 205 SER n 1 206 PRO n 1 207 ILE n 1 208 PHE n 1 209 SER n 1 210 LEU n 1 211 SER n 1 212 TRP n 1 213 THR n 1 214 VAL n 1 215 MET n 1 216 HIS n 1 217 PRO n 1 218 ILE n 1 219 ASP n 1 220 HIS n 1 221 HIS n 1 222 SER n 1 223 PRO n 1 224 ILE n 1 225 TYR n 1 226 GLY n 1 227 GLU n 1 228 THR n 1 229 ASP n 1 230 GLU n 1 231 THR n 1 232 LEU n 1 233 ARG n 1 234 ASN n 1 235 SER n 1 236 HIS n 1 237 SER n 1 238 GLU n 1 239 PHE n 1 240 LEU n 1 241 VAL n 1 242 LEU n 1 243 PHE n 1 244 THR n 1 245 GLY n 1 246 HIS n 1 247 HIS n 1 248 GLU n 1 249 ALA n 1 250 PHE n 1 251 ALA n 1 252 GLN n 1 253 ASN n 1 254 VAL n 1 255 HIS n 1 256 ALA n 1 257 ARG n 1 258 HIS n 1 259 ALA n 1 260 TYR n 1 261 SER n 1 262 SER n 1 263 ASP n 1 264 GLU n 1 265 ILE n 1 266 ILE n 1 267 TRP n 1 268 GLY n 1 269 GLY n 1 270 HIS n 1 271 PHE n 1 272 VAL n 1 273 ASP n 1 274 VAL n 1 275 PHE n 1 276 THR n 1 277 THR n 1 278 LEU n 1 279 PRO n 1 280 ASP n 1 281 GLY n 1 282 ARG n 1 283 ARG n 1 284 ALA n 1 285 LEU n 1 286 ASP n 1 287 LEU n 1 288 GLY n 1 289 LYS n 1 290 PHE n 1 291 HIS n 1 292 GLU n 1 293 ILE n 1 294 ALA n 1 295 GLN n 1 296 HIS n 1 297 HIS n 1 298 HIS n 1 299 HIS n 1 300 HIS n 1 301 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 301 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Magnetospirillum magnetotacticum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 188 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 6E3 non-polymer . '2,3,5,6-tetramethyl-1H,7H-pyrazolo[1,2-a]pyrazole-1,7-dione' ? 'C10 H12 N2 O2' 192.214 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 K non-polymer . 'POTASSIUM ION' ? 'K 1' 39.098 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 GLY 3 3 ? ? ? A . n A 1 4 GLY 4 4 ? ? ? A . n A 1 5 MET 5 5 ? ? ? A . n A 1 6 LYS 6 6 ? ? ? A . n A 1 7 PRO 7 7 ? ? ? A . n A 1 8 PRO 8 8 ? ? ? A . n A 1 9 ALA 9 9 ? ? ? A . n A 1 10 ARG 10 10 ? ? ? A . n A 1 11 LYS 11 11 ? ? ? A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 GLY 27 27 ? ? ? A . n A 1 28 LEU 28 28 ? ? ? A . n A 1 29 GLU 29 29 ? ? ? A . n A 1 30 LYS 30 30 ? ? ? A . n A 1 31 ARG 31 31 ? ? ? A . n A 1 32 GLY 32 32 ? ? ? A . n A 1 33 TRP 33 33 ? ? ? A . n A 1 34 LEU 34 34 ? ? ? A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 HIS 37 37 37 HIS HIS A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 TRP 46 46 46 TRP TRP A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 MET 94 94 94 MET MET A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 PRO 104 104 104 PRO PRO A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 PRO 107 107 107 PRO PRO A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 ASN 110 110 110 ASN ASN A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 MET 121 121 121 MET MET A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 TYR 132 132 132 TYR TYR A . n A 1 133 CYS 133 133 133 CYS CYS A . n A 1 134 ARG 134 134 134 ARG ARG A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 CYS 136 136 136 CYS CYS A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 PRO 138 138 138 PRO PRO A . n A 1 139 THR 139 139 139 THR THR A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 PHE 144 144 144 PHE PHE A . n A 1 145 SER 145 145 145 SER SER A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 MET 148 148 148 MET MET A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 ASP 152 152 152 ASP ASP A . n A 1 153 PHE 153 153 153 PHE PHE A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 PRO 157 157 157 PRO PRO A . n A 1 158 THR 158 158 158 THR THR A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 MET 160 160 160 MET MET A . n A 1 161 MET 161 161 161 MET MET A . n A 1 162 ARG 162 162 162 ARG ARG A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 ASN 165 165 165 ASN ASN A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 ARG 167 167 167 ARG ARG A . n A 1 168 ILE 168 168 168 ILE ILE A . n A 1 169 GLU 169 169 169 GLU GLU A . n A 1 170 GLN 170 170 170 GLN GLN A . n A 1 171 ILE 171 171 171 ILE ILE A . n A 1 172 ILE 172 172 172 ILE ILE A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 ALA 174 174 174 ALA ALA A . n A 1 175 ASP 175 175 175 ASP ASP A . n A 1 176 VAL 176 176 176 VAL VAL A . n A 1 177 HIS 177 177 177 HIS HIS A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 VAL 179 179 179 VAL VAL A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 ARG 182 182 182 ARG ARG A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 GLU 184 184 184 GLU GLU A . n A 1 185 ILE 185 185 185 ILE ILE A . n A 1 186 SER 186 186 186 SER SER A . n A 1 187 GLN 187 187 187 GLN GLN A . n A 1 188 GLU 188 188 188 GLU GLU A . n A 1 189 GLY 189 189 189 GLY GLY A . n A 1 190 MET 190 190 190 MET MET A . n A 1 191 VAL 191 191 191 VAL VAL A . n A 1 192 PHE 192 192 192 PHE PHE A . n A 1 193 ARG 193 193 193 ARG ARG A . n A 1 194 ARG 194 194 194 ARG ARG A . n A 1 195 PHE 195 195 195 PHE PHE A . n A 1 196 HIS 196 196 196 HIS HIS A . n A 1 197 ASP 197 197 197 ASP ASP A . n A 1 198 LEU 198 198 198 LEU LEU A . n A 1 199 THR 199 199 199 THR THR A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 THR 201 201 201 THR THR A . n A 1 202 ARG 202 202 202 ARG ARG A . n A 1 203 SER 203 203 203 SER SER A . n A 1 204 ARG 204 204 204 ARG ARG A . n A 1 205 SER 205 205 205 SER SER A . n A 1 206 PRO 206 206 206 PRO PRO A . n A 1 207 ILE 207 207 207 ILE ILE A . n A 1 208 PHE 208 208 208 PHE PHE A . n A 1 209 SER 209 209 209 SER SER A . n A 1 210 LEU 210 210 210 LEU LEU A . n A 1 211 SER 211 211 211 SER SER A . n A 1 212 TRP 212 212 212 TRP TRP A . n A 1 213 THR 213 213 213 THR THR A . n A 1 214 VAL 214 214 214 VAL VAL A . n A 1 215 MET 215 215 215 MET MET A . n A 1 216 HIS 216 216 216 HIS HIS A . n A 1 217 PRO 217 217 217 PRO PRO A . n A 1 218 ILE 218 218 218 ILE ILE A . n A 1 219 ASP 219 219 219 ASP ASP A . n A 1 220 HIS 220 220 220 HIS HIS A . n A 1 221 HIS 221 221 221 HIS HIS A . n A 1 222 SER 222 222 222 SER SER A . n A 1 223 PRO 223 223 223 PRO PRO A . n A 1 224 ILE 224 224 224 ILE ILE A . n A 1 225 TYR 225 225 225 TYR TYR A . n A 1 226 GLY 226 226 226 GLY GLY A . n A 1 227 GLU 227 227 227 GLU GLU A . n A 1 228 THR 228 228 228 THR THR A . n A 1 229 ASP 229 229 229 ASP ASP A . n A 1 230 GLU 230 230 230 GLU GLU A . n A 1 231 THR 231 231 231 THR THR A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 ARG 233 233 233 ARG ARG A . n A 1 234 ASN 234 234 234 ASN ASN A . n A 1 235 SER 235 235 235 SER SER A . n A 1 236 HIS 236 236 236 HIS HIS A . n A 1 237 SER 237 237 237 SER SER A . n A 1 238 GLU 238 238 238 GLU GLU A . n A 1 239 PHE 239 239 239 PHE PHE A . n A 1 240 LEU 240 240 240 LEU LEU A . n A 1 241 VAL 241 241 241 VAL VAL A . n A 1 242 LEU 242 242 242 LEU LEU A . n A 1 243 PHE 243 243 243 PHE PHE A . n A 1 244 THR 244 244 244 THR THR A . n A 1 245 GLY 245 245 245 GLY GLY A . n A 1 246 HIS 246 246 246 HIS HIS A . n A 1 247 HIS 247 247 247 HIS HIS A . n A 1 248 GLU 248 248 248 GLU GLU A . n A 1 249 ALA 249 249 249 ALA ALA A . n A 1 250 PHE 250 250 250 PHE PHE A . n A 1 251 ALA 251 251 251 ALA ALA A . n A 1 252 GLN 252 252 252 GLN GLN A . n A 1 253 ASN 253 253 253 ASN ASN A . n A 1 254 VAL 254 254 254 VAL VAL A . n A 1 255 HIS 255 255 255 HIS HIS A . n A 1 256 ALA 256 256 256 ALA ALA A . n A 1 257 ARG 257 257 257 ARG ARG A . n A 1 258 HIS 258 258 258 HIS HIS A . n A 1 259 ALA 259 259 259 ALA ALA A . n A 1 260 TYR 260 260 260 TYR TYR A . n A 1 261 SER 261 261 261 SER SER A . n A 1 262 SER 262 262 262 SER SER A . n A 1 263 ASP 263 263 263 ASP ASP A . n A 1 264 GLU 264 264 264 GLU GLU A . n A 1 265 ILE 265 265 265 ILE ILE A . n A 1 266 ILE 266 266 266 ILE ILE A . n A 1 267 TRP 267 267 267 TRP TRP A . n A 1 268 GLY 268 268 268 GLY GLY A . n A 1 269 GLY 269 269 269 GLY GLY A . n A 1 270 HIS 270 270 270 HIS HIS A . n A 1 271 PHE 271 271 271 PHE PHE A . n A 1 272 VAL 272 272 272 VAL VAL A . n A 1 273 ASP 273 273 273 ASP ASP A . n A 1 274 VAL 274 274 274 VAL VAL A . n A 1 275 PHE 275 275 275 PHE PHE A . n A 1 276 THR 276 276 276 THR THR A . n A 1 277 THR 277 277 277 THR THR A . n A 1 278 LEU 278 278 278 LEU LEU A . n A 1 279 PRO 279 279 279 PRO PRO A . n A 1 280 ASP 280 280 280 ASP ASP A . n A 1 281 GLY 281 281 281 GLY GLY A . n A 1 282 ARG 282 282 282 ARG ARG A . n A 1 283 ARG 283 283 283 ARG ARG A . n A 1 284 ALA 284 284 284 ALA ALA A . n A 1 285 LEU 285 285 285 LEU LEU A . n A 1 286 ASP 286 286 286 ASP ASP A . n A 1 287 LEU 287 287 287 LEU LEU A . n A 1 288 GLY 288 288 288 GLY GLY A . n A 1 289 LYS 289 289 289 LYS LYS A . n A 1 290 PHE 290 290 290 PHE PHE A . n A 1 291 HIS 291 291 291 HIS HIS A . n A 1 292 GLU 292 292 292 GLU GLU A . n A 1 293 ILE 293 293 293 ILE ILE A . n A 1 294 ALA 294 294 ? ? ? A . n A 1 295 GLN 295 295 ? ? ? A . n A 1 296 HIS 296 296 ? ? ? A . n A 1 297 HIS 297 297 ? ? ? A . n A 1 298 HIS 298 298 ? ? ? A . n A 1 299 HIS 299 299 ? ? ? A . n A 1 300 HIS 300 300 ? ? ? A . n A 1 301 HIS 301 301 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 6E3 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 6E3 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 K 1 401 1 K K A . C 2 K 1 402 4 K K A . D 3 6E3 1 403 500 6E3 6E3 A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU 15 ? CG ? A LEU 15 CG 2 1 Y 1 A LEU 15 ? CD1 ? A LEU 15 CD1 3 1 Y 1 A LEU 15 ? CD2 ? A LEU 15 CD2 4 1 Y 1 A SER 20 ? OG ? A SER 20 OG 5 1 Y 1 A ASP 35 ? CG ? A ASP 35 CG 6 1 Y 1 A ASP 35 ? OD1 ? A ASP 35 OD1 7 1 Y 1 A ASP 35 ? OD2 ? A ASP 35 OD2 8 1 Y 1 A LEU 42 ? CG ? A LEU 42 CG 9 1 Y 1 A LEU 42 ? CD1 ? A LEU 42 CD1 10 1 Y 1 A LEU 42 ? CD2 ? A LEU 42 CD2 11 1 Y 1 A ILE 53 ? CG1 ? A ILE 53 CG1 12 1 Y 1 A ILE 53 ? CG2 ? A ILE 53 CG2 13 1 Y 1 A ILE 53 ? CD1 ? A ILE 53 CD1 14 1 Y 1 A VAL 71 ? CG1 ? A VAL 71 CG1 15 1 Y 1 A VAL 71 ? CG2 ? A VAL 71 CG2 16 1 Y 1 A ARG 79 ? CG ? A ARG 79 CG 17 1 Y 1 A ARG 79 ? CD ? A ARG 79 CD 18 1 Y 1 A ARG 79 ? NE ? A ARG 79 NE 19 1 Y 1 A ARG 79 ? CZ ? A ARG 79 CZ 20 1 Y 1 A ARG 79 ? NH1 ? A ARG 79 NH1 21 1 Y 1 A ARG 79 ? NH2 ? A ARG 79 NH2 22 1 Y 1 A LYS 101 ? CG ? A LYS 101 CG 23 1 Y 1 A LYS 101 ? CD ? A LYS 101 CD 24 1 Y 1 A LYS 101 ? CE ? A LYS 101 CE 25 1 Y 1 A LYS 101 ? NZ ? A LYS 101 NZ 26 1 Y 1 A LEU 108 ? CG ? A LEU 108 CG 27 1 Y 1 A LEU 108 ? CD1 ? A LEU 108 CD1 28 1 Y 1 A LEU 108 ? CD2 ? A LEU 108 CD2 29 1 Y 1 A ARG 147 ? CG ? A ARG 147 CG 30 1 Y 1 A ARG 147 ? CD ? A ARG 147 CD 31 1 Y 1 A ARG 147 ? NE ? A ARG 147 NE 32 1 Y 1 A ARG 147 ? CZ ? A ARG 147 CZ 33 1 Y 1 A ARG 147 ? NH1 ? A ARG 147 NH1 34 1 Y 1 A ARG 147 ? NH2 ? A ARG 147 NH2 35 1 Y 1 A ILE 150 ? CD1 ? A ILE 150 CD1 36 1 Y 1 A SER 151 ? OG ? A SER 151 OG 37 1 Y 1 A GLU 169 ? CG ? A GLU 169 CG 38 1 Y 1 A GLU 169 ? CD ? A GLU 169 CD 39 1 Y 1 A GLU 169 ? OE1 ? A GLU 169 OE1 40 1 Y 1 A GLU 169 ? OE2 ? A GLU 169 OE2 41 1 Y 1 A GLU 173 ? CG ? A GLU 173 CG 42 1 Y 1 A GLU 173 ? CD ? A GLU 173 CD 43 1 Y 1 A GLU 173 ? OE1 ? A GLU 173 OE1 44 1 Y 1 A GLU 173 ? OE2 ? A GLU 173 OE2 45 1 Y 1 A ASP 175 ? CG ? A ASP 175 CG 46 1 Y 1 A ASP 175 ? OD1 ? A ASP 175 OD1 47 1 Y 1 A ASP 175 ? OD2 ? A ASP 175 OD2 48 1 Y 1 A ILE 185 ? CG1 ? A ILE 185 CG1 49 1 Y 1 A ILE 185 ? CG2 ? A ILE 185 CG2 50 1 Y 1 A ILE 185 ? CD1 ? A ILE 185 CD1 51 1 Y 1 A GLU 188 ? CG ? A GLU 188 CG 52 1 Y 1 A GLU 188 ? CD ? A GLU 188 CD 53 1 Y 1 A GLU 188 ? OE1 ? A GLU 188 OE1 54 1 Y 1 A GLU 188 ? OE2 ? A GLU 188 OE2 55 1 Y 1 A MET 190 ? CG ? A MET 190 CG 56 1 Y 1 A MET 190 ? SD ? A MET 190 SD 57 1 Y 1 A MET 190 ? CE ? A MET 190 CE 58 1 Y 1 A ARG 193 ? CG ? A ARG 193 CG 59 1 Y 1 A ARG 193 ? CD ? A ARG 193 CD 60 1 Y 1 A ARG 193 ? NE ? A ARG 193 NE 61 1 Y 1 A ARG 193 ? CZ ? A ARG 193 CZ 62 1 Y 1 A ARG 193 ? NH1 ? A ARG 193 NH1 63 1 Y 1 A ARG 193 ? NH2 ? A ARG 193 NH2 64 1 Y 1 A ARG 194 ? CG ? A ARG 194 CG 65 1 Y 1 A ARG 194 ? CD ? A ARG 194 CD 66 1 Y 1 A ARG 194 ? NE ? A ARG 194 NE 67 1 Y 1 A ARG 194 ? CZ ? A ARG 194 CZ 68 1 Y 1 A ARG 194 ? NH1 ? A ARG 194 NH1 69 1 Y 1 A ARG 194 ? NH2 ? A ARG 194 NH2 70 1 Y 1 A LEU 210 ? CG ? A LEU 210 CG 71 1 Y 1 A LEU 210 ? CD1 ? A LEU 210 CD1 72 1 Y 1 A LEU 210 ? CD2 ? A LEU 210 CD2 73 1 Y 1 A HIS 270 ? CG ? A HIS 270 CG 74 1 Y 1 A HIS 270 ? ND1 ? A HIS 270 ND1 75 1 Y 1 A HIS 270 ? CD2 ? A HIS 270 CD2 76 1 Y 1 A HIS 270 ? CE1 ? A HIS 270 CE1 77 1 Y 1 A HIS 270 ? NE2 ? A HIS 270 NE2 78 1 Y 1 A VAL 274 ? CG1 ? A VAL 274 CG1 79 1 Y 1 A VAL 274 ? CG2 ? A VAL 274 CG2 80 1 Y 1 A PHE 275 ? CG ? A PHE 275 CG 81 1 Y 1 A PHE 275 ? CD1 ? A PHE 275 CD1 82 1 Y 1 A PHE 275 ? CD2 ? A PHE 275 CD2 83 1 Y 1 A PHE 275 ? CE1 ? A PHE 275 CE1 84 1 Y 1 A PHE 275 ? CE2 ? A PHE 275 CE2 85 1 Y 1 A PHE 275 ? CZ ? A PHE 275 CZ 86 1 Y 1 A ARG 282 ? CG ? A ARG 282 CG 87 1 Y 1 A ARG 282 ? CD ? A ARG 282 CD 88 1 Y 1 A ARG 282 ? NE ? A ARG 282 NE 89 1 Y 1 A ARG 282 ? CZ ? A ARG 282 CZ 90 1 Y 1 A ARG 282 ? NH1 ? A ARG 282 NH1 91 1 Y 1 A ARG 282 ? NH2 ? A ARG 282 NH2 92 1 Y 1 A ARG 283 ? CG ? A ARG 283 CG 93 1 Y 1 A ARG 283 ? CD ? A ARG 283 CD 94 1 Y 1 A ARG 283 ? NE ? A ARG 283 NE 95 1 Y 1 A ARG 283 ? CZ ? A ARG 283 CZ 96 1 Y 1 A ARG 283 ? NH1 ? A ARG 283 NH1 97 1 Y 1 A ARG 283 ? NH2 ? A ARG 283 NH2 98 1 Y 1 A LEU 285 ? CG ? A LEU 285 CG 99 1 Y 1 A LEU 285 ? CD1 ? A LEU 285 CD1 100 1 Y 1 A LEU 285 ? CD2 ? A LEU 285 CD2 101 1 Y 1 A LYS 289 ? CG ? A LYS 289 CG 102 1 Y 1 A LYS 289 ? CD ? A LYS 289 CD 103 1 Y 1 A LYS 289 ? CE ? A LYS 289 CE 104 1 Y 1 A LYS 289 ? NZ ? A LYS 289 NZ 105 1 Y 1 A ILE 293 ? CG1 ? A ILE 293 CG1 106 1 Y 1 A ILE 293 ? CG2 ? A ILE 293 CG2 107 1 Y 1 A ILE 293 ? CD1 ? A ILE 293 CD1 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.10.2 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? TRUNCATE ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6O9T _cell.details ? _cell.formula_units_Z ? _cell.length_a 103.110 _cell.length_a_esd ? _cell.length_b 103.110 _cell.length_b_esd ? _cell.length_c 89.270 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6O9T _symmetry.cell_setting ? _symmetry.Int_Tables_number 90 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 4 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6O9T _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.51 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 64.96 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 292 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '33% (v/v) PEG 400, 0.1 M MES, pH 6.5; 4% (v/v) ethylene glycol, 0.1 M NaCl' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-09-24 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9537 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9537 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX2 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6O9T _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.9 _reflns.d_resolution_low 46.11 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 4688 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.0 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.74 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.168 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 3.90 _reflns_shell.d_res_low 4.14 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.0 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 702 _reflns_shell.percent_possible_all 96.7 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.33 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -4.2824 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] -4.2824 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 8.5648 _refine.B_iso_max 280.170 _refine.B_iso_mean 219.2800 _refine.B_iso_min 140.790 _refine.correlation_coeff_Fo_to_Fc 0.8761 _refine.correlation_coeff_Fo_to_Fc_free 0.9283 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6O9T _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 4.0100 _refine.ls_d_res_low 46.1100 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4340 _refine.ls_number_reflns_R_free 195 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.5600 _refine.ls_percent_reflns_R_free 4.4900 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2472 _refine.ls_R_factor_R_free 0.2725 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2460 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1XL4 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI 0.7590 _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 6O9T _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 1.179 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 4.0100 _refine_hist.d_res_low 46.1100 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2071 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 274 _refine_hist.pdbx_B_iso_mean_ligand 223.25 _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2055 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 16 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? ? ? 661 ? t_dihedral_angle_d 2.000 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? 41 ? t_trig_c_planes 2.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 343 ? t_gen_planes 5.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 2124 ? t_it 20.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 8 ? t_nbd 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 293 ? t_chiral_improper_torsion 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 2387 ? t_ideal_dist_contact 4.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? 0.010 ? 2124 ? t_bond_d 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 1.190 ? 2907 ? t_angle_deg 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 2.700 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 22.700 ? ? ? t_other_torsion ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 4.0100 _refine_ls_shell.d_res_low 4.4800 _refine_ls_shell.number_reflns_all 1199 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 52 _refine_ls_shell.number_reflns_R_work 1147 _refine_ls_shell.percent_reflns_obs 99.5600 _refine_ls_shell.percent_reflns_R_free 4.3400 _refine_ls_shell.R_factor_all 0.2521 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2571 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2519 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 5 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6O9T _struct.title 'KirBac3.1 mutant at a resolution of 4.1 Angstroms' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6O9T _struct_keywords.text 'MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code IRK10_MAGMG _struct_ref.pdbx_db_accession D9N164 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTGGMKPPARKPRILNSDGSSNITRLGLEKRGWLDDHYHDLLTVSWPVFITLITGLYLVTNALFALAYLACGDVIENARP GSFTDAFFFSVQTMATIGYGKLIPIGPLANTLVTLEALCGMLGLAVAASLIYARFTRPTAGVLFSSRMVISDFEGKPTLM MRLANLRIEQIIEADVHLVLVRSEISQEGMVFRRFHDLTLTRSRSPIFSLSWTVMHPIDHHSPIYGETDETLRNSHSEFL VLFTGHHEAFAQNVHARHAYSCDEIIWGGHFVDVFTTLPDGRRALDLGKFHEIAQ ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6O9T _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 295 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession D9N164 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 295 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 295 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6O9T VAL A 71 ? UNP D9N164 CYS 71 'engineered mutation' 71 1 1 6O9T VAL A 119 ? UNP D9N164 CYS 119 'engineered mutation' 119 2 1 6O9T CYS A 133 ? UNP D9N164 ALA 133 'engineered mutation' 133 3 1 6O9T CYS A 136 ? UNP D9N164 THR 136 'engineered mutation' 136 4 1 6O9T SER A 262 ? UNP D9N164 CYS 262 'engineered mutation' 262 5 1 6O9T HIS A 296 ? UNP D9N164 ? ? 'expression tag' 296 6 1 6O9T HIS A 297 ? UNP D9N164 ? ? 'expression tag' 297 7 1 6O9T HIS A 298 ? UNP D9N164 ? ? 'expression tag' 298 8 1 6O9T HIS A 299 ? UNP D9N164 ? ? 'expression tag' 299 9 1 6O9T HIS A 300 ? UNP D9N164 ? ? 'expression tag' 300 10 1 6O9T HIS A 301 ? UNP D9N164 ? ? 'expression tag' 301 11 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 17030 ? 1 MORE -144 ? 1 'SSA (A^2)' 46270 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support homology _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_545 -x,-y-1,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -103.1100000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_445 -y-1/2,x-1/2,z 0.0000000000 -1.0000000000 0.0000000000 -51.5550000000 1.0000000000 0.0000000000 0.0000000000 -51.5550000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_545 y+1/2,-x-1/2,z 0.0000000000 1.0000000000 0.0000000000 51.5550000000 -1.0000000000 0.0000000000 0.0000000000 -51.5550000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 36 ? VAL A 44 ? ASP A 36 VAL A 44 1 ? 9 HELX_P HELX_P2 AA2 SER A 45 ? VAL A 71 ? SER A 45 VAL A 71 1 ? 27 HELX_P HELX_P3 AA3 SER A 82 ? ALA A 95 ? SER A 82 ALA A 95 1 ? 14 HELX_P HELX_P4 AA4 ILE A 105 ? CYS A 136 ? ILE A 105 CYS A 136 1 ? 32 HELX_P HELX_P5 AA5 THR A 228 ? SER A 235 ? THR A 228 SER A 235 1 ? 8 HELX_P HELX_P6 AA6 LEU A 287 ? HIS A 291 ? LEU A 287 HIS A 291 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A CYS 133 SG ? ? ? 1_555 D 6E3 . C8 ? ? A CYS 133 A 6E3 403 3_445 ? ? ? ? ? ? ? 1.885 ? ? covale2 covale none ? A CYS 136 SG ? ? ? 1_555 D 6E3 . C7 ? ? A CYS 136 A 6E3 403 1_555 ? ? ? ? ? ? ? 1.778 ? ? metalc1 metalc ? ? A THR 96 O ? ? ? 1_555 C K . K ? ? A THR 96 A K 402 1_555 ? ? ? ? ? ? ? 2.357 ? ? metalc2 metalc ? ? A THR 96 O ? ? ? 1_555 C K . K ? ? A THR 96 A K 402 4_545 ? ? ? ? ? ? ? 2.357 ? ? metalc3 metalc ? ? A GLY 98 O ? ? ? 1_555 B K . K ? ? A GLY 98 A K 401 1_555 ? ? ? ? ? ? ? 2.373 ? ? metalc4 metalc ? ? A GLY 98 O ? ? ? 1_555 B K . K ? ? A GLY 98 A K 401 4_545 ? ? ? ? ? ? ? 2.373 ? ? metalc5 metalc ? ? A TYR 99 O ? ? ? 1_555 B K . K ? ? A TYR 99 A K 401 1_555 ? ? ? ? ? ? ? 3.459 ? ? metalc6 metalc ? ? A TYR 99 O ? ? ? 1_555 B K . K ? ? A TYR 99 A K 401 4_545 ? ? ? ? ? ? ? 3.459 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A THR 96 ? A THR 96 ? 1_555 K ? C K . ? A K 402 ? 1_555 O ? A THR 96 ? A THR 96 ? 1_555 0.0 ? 2 O ? A GLY 98 ? A GLY 98 ? 1_555 K ? B K . ? A K 401 ? 1_555 O ? A GLY 98 ? A GLY 98 ? 1_555 0.0 ? 3 O ? A GLY 98 ? A GLY 98 ? 1_555 K ? B K . ? A K 401 ? 1_555 O ? A TYR 99 ? A TYR 99 ? 1_555 59.4 ? 4 O ? A GLY 98 ? A GLY 98 ? 1_555 K ? B K . ? A K 401 ? 1_555 O ? A TYR 99 ? A TYR 99 ? 1_555 59.4 ? 5 O ? A GLY 98 ? A GLY 98 ? 1_555 K ? B K . ? A K 401 ? 1_555 O ? A TYR 99 ? A TYR 99 ? 1_555 59.4 ? 6 O ? A GLY 98 ? A GLY 98 ? 1_555 K ? B K . ? A K 401 ? 1_555 O ? A TYR 99 ? A TYR 99 ? 1_555 59.4 ? 7 O ? A TYR 99 ? A TYR 99 ? 1_555 K ? B K . ? A K 401 ? 1_555 O ? A TYR 99 ? A TYR 99 ? 1_555 0.0 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 6E3 D . ? CYS A 136 ? 6E3 A 403 ? 1_555 CYS A 136 ? 1_555 C7 SG CYS 1 6E3 None Crosslinker 2 6E3 D . ? CYS A 133 ? 6E3 A 403 ? 3_445 CYS A 133 ? 1_555 C8 SG CYS 2 6E3 None Crosslinker # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 4 ? AA3 ? 3 ? AA4 ? 4 ? AA5 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA5 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 142 ? PHE A 144 ? VAL A 142 PHE A 144 AA1 2 LYS A 156 ? ASN A 165 ? LYS A 156 ASN A 165 AA1 3 SER A 211 ? PRO A 217 ? SER A 211 PRO A 217 AA2 1 VAL A 142 ? PHE A 144 ? VAL A 142 PHE A 144 AA2 2 LYS A 156 ? ASN A 165 ? LYS A 156 ASN A 165 AA2 3 MET A 148 ? PHE A 153 ? MET A 148 PHE A 153 AA2 4 ILE A 265 ? TRP A 267 ? ILE A 265 TRP A 267 AA3 1 VAL A 191 ? LEU A 198 ? VAL A 191 LEU A 198 AA3 2 ILE A 171 ? ILE A 185 ? ILE A 171 ILE A 185 AA3 3 ARG A 204 ? PHE A 208 ? ARG A 204 PHE A 208 AA4 1 VAL A 191 ? LEU A 198 ? VAL A 191 LEU A 198 AA4 2 ILE A 171 ? ILE A 185 ? ILE A 171 ILE A 185 AA4 3 GLU A 238 ? HIS A 247 ? GLU A 238 HIS A 247 AA4 4 ASN A 253 ? SER A 261 ? ASN A 253 SER A 261 AA5 1 PHE A 275 ? THR A 277 ? PHE A 275 THR A 277 AA5 2 ARG A 283 ? LEU A 285 ? ARG A 283 LEU A 285 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 143 ? N LEU A 143 O ALA A 164 ? O ALA A 164 AA1 2 3 N LEU A 159 ? N LEU A 159 O HIS A 216 ? O HIS A 216 AA2 1 2 N LEU A 143 ? N LEU A 143 O ALA A 164 ? O ALA A 164 AA2 2 3 O MET A 160 ? O MET A 160 N VAL A 149 ? N VAL A 149 AA2 3 4 N ILE A 150 ? N ILE A 150 O ILE A 266 ? O ILE A 266 AA3 1 2 O PHE A 192 ? O PHE A 192 N GLU A 184 ? N GLU A 184 AA3 2 3 N ILE A 171 ? N ILE A 171 O PHE A 208 ? O PHE A 208 AA4 1 2 O PHE A 192 ? O PHE A 192 N GLU A 184 ? N GLU A 184 AA4 2 3 N VAL A 181 ? N VAL A 181 O GLU A 238 ? O GLU A 238 AA4 3 4 N PHE A 239 ? N PHE A 239 O TYR A 260 ? O TYR A 260 AA5 1 2 N THR A 276 ? N THR A 276 O ALA A 284 ? O ALA A 284 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A K 401 ? 8 'binding site for residue K A 401' AC2 Software A K 402 ? 4 'binding site for residue K A 402' AC3 Software A 6E3 403 ? 6 'binding site for residue 6E3 A 403' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 GLY A 98 ? GLY A 98 . ? 3_445 ? 2 AC1 8 GLY A 98 ? GLY A 98 . ? 1_555 ? 3 AC1 8 GLY A 98 ? GLY A 98 . ? 4_545 ? 4 AC1 8 GLY A 98 ? GLY A 98 . ? 2_545 ? 5 AC1 8 TYR A 99 ? TYR A 99 . ? 2_545 ? 6 AC1 8 TYR A 99 ? TYR A 99 . ? 3_445 ? 7 AC1 8 TYR A 99 ? TYR A 99 . ? 4_545 ? 8 AC1 8 TYR A 99 ? TYR A 99 . ? 1_555 ? 9 AC2 4 THR A 96 ? THR A 96 . ? 3_445 ? 10 AC2 4 THR A 96 ? THR A 96 . ? 1_555 ? 11 AC2 4 THR A 96 ? THR A 96 . ? 2_545 ? 12 AC2 4 THR A 96 ? THR A 96 . ? 4_545 ? 13 AC3 6 TYR A 38 ? TYR A 38 . ? 4_545 ? 14 AC3 6 SER A 129 ? SER A 129 . ? 4_545 ? 15 AC3 6 CYS A 133 ? CYS A 133 . ? 4_545 ? 16 AC3 6 PHE A 135 ? PHE A 135 . ? 1_555 ? 17 AC3 6 CYS A 136 ? CYS A 136 . ? 1_555 ? 18 AC3 6 PHE A 250 ? PHE A 250 . ? 1_555 ? # _pdbx_entry_details.entry_id 6O9T _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 77 ? ? 73.76 -11.16 2 1 CYS A 136 ? ? -93.29 55.67 3 1 PRO A 138 ? ? -66.20 90.16 4 1 ALA A 140 ? ? -68.31 93.12 5 1 LEU A 210 ? ? -104.78 -126.86 6 1 ALA A 251 ? ? 106.93 -62.37 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A K 401 ? B K . 2 1 A K 402 ? C K . # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -11.1923 -23.5730 6.6611 -0.6025 ? 0.3870 ? -0.2268 ? -0.1020 ? -0.1821 ? 0.8260 ? 9.6819 ? -6.7486 ? -5.0067 ? 10.7586 ? 1.8567 ? 2.2334 ? 0.0537 ? 0.0321 ? 0.0818 ? -0.0368 ? 0.0159 ? 0.1359 ? -0.6243 ? -0.0775 ? -0.0696 ? 2 'X-RAY DIFFRACTION' ? refined -9.2904 -41.9553 47.2484 0.6218 ? 0.2618 ? 0.2904 ? 0.3856 ? -0.3811 ? -0.5470 ? 6.6062 ? 1.2759 ? 1.9503 ? 3.3799 ? -0.6925 ? 13.8738 ? -0.0622 ? -1.8202 ? 0.9479 ? 1.2269 ? 0.1243 ? 1.0601 ? 0.0545 ? -1.2180 ? -0.0620 ? 3 'X-RAY DIFFRACTION' ? refined 5.4702 -31.2040 0.5893 -0.4013 ? -0.0309 ? 0.2012 ? 0.0791 ? 0.3896 ? 0.3156 ? 21.9316 ? -7.2226 ? 8.4301 ? 8.1776 ? -1.4117 ? 7.7388 ? 0.3837 ? 0.8800 ? 1.4039 ? -0.5737 ? -0.7319 ? -0.5706 ? 0.7581 ? 0.3690 ? 0.3482 ? 4 'X-RAY DIFFRACTION' ? refined 6.8566 -44.8129 24.8819 0.3232 ? -0.3515 ? -0.0376 ? 0.3853 ? 0.2526 ? 0.0976 ? 0.2654 ? 0.1696 ? -0.0835 ? 0.4231 ? -0.0835 ? 0.2575 ? -0.0039 ? 0.0105 ? 0.0051 ? -0.0032 ? 0.0036 ? -0.0132 ? -0.0234 ? -0.0094 ? 0.0003 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 8 ? ? A 26 ? '{ A|8 - A|26 }' 2 'X-RAY DIFFRACTION' 2 ? ? A 35 ? ? A 136 ? '{ A|35 - A|136 }' 3 'X-RAY DIFFRACTION' 3 ? ? A 137 ? ? A 295 ? '{ A|137 - A|295 }' 4 'X-RAY DIFFRACTION' 4 ? ? A 403 ? ? A 403 ? '{ A|403 - A|403 }' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A GLY 3 ? A GLY 3 4 1 Y 1 A GLY 4 ? A GLY 4 5 1 Y 1 A MET 5 ? A MET 5 6 1 Y 1 A LYS 6 ? A LYS 6 7 1 Y 1 A PRO 7 ? A PRO 7 8 1 Y 1 A PRO 8 ? A PRO 8 9 1 Y 1 A ALA 9 ? A ALA 9 10 1 Y 1 A ARG 10 ? A ARG 10 11 1 Y 1 A LYS 11 ? A LYS 11 12 1 Y 1 A GLY 27 ? A GLY 27 13 1 Y 1 A LEU 28 ? A LEU 28 14 1 Y 1 A GLU 29 ? A GLU 29 15 1 Y 1 A LYS 30 ? A LYS 30 16 1 Y 1 A ARG 31 ? A ARG 31 17 1 Y 1 A GLY 32 ? A GLY 32 18 1 Y 1 A TRP 33 ? A TRP 33 19 1 Y 1 A LEU 34 ? A LEU 34 20 1 Y 1 A ALA 294 ? A ALA 294 21 1 Y 1 A GLN 295 ? A GLN 295 22 1 Y 1 A HIS 296 ? A HIS 296 23 1 Y 1 A HIS 297 ? A HIS 297 24 1 Y 1 A HIS 298 ? A HIS 298 25 1 Y 1 A HIS 299 ? A HIS 299 26 1 Y 1 A HIS 300 ? A HIS 300 27 1 Y 1 A HIS 301 ? A HIS 301 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 6E3 O1 O N N 1 6E3 C7 C N N 2 6E3 C8 C N N 3 6E3 C9 C N N 4 6E3 N N N N 5 6E3 C3 C N N 6 6E3 C4 C N N 7 6E3 C5 C N N 8 6E3 C6 C N N 9 6E3 C1 C N N 10 6E3 N1 N N N 11 6E3 C C N N 12 6E3 O O N N 13 6E3 C2 C N N 14 6E3 H4 H N N 15 6E3 H3 H N N 16 6E3 H11 H N N 17 6E3 H6 H N N 18 6E3 H5 H N N 19 6E3 H7 H N N 20 6E3 H9 H N N 21 6E3 H10 H N N 22 6E3 H8 H N N 23 6E3 H2 H N N 24 6E3 H1 H N N 25 6E3 H H N N 26 ALA N N N N 27 ALA CA C N S 28 ALA C C N N 29 ALA O O N N 30 ALA CB C N N 31 ALA OXT O N N 32 ALA H H N N 33 ALA H2 H N N 34 ALA HA H N N 35 ALA HB1 H N N 36 ALA HB2 H N N 37 ALA HB3 H N N 38 ALA HXT H N N 39 ARG N N N N 40 ARG CA C N S 41 ARG C C N N 42 ARG O O N N 43 ARG CB C N N 44 ARG CG C N N 45 ARG CD C N N 46 ARG NE N N N 47 ARG CZ C N N 48 ARG NH1 N N N 49 ARG NH2 N N N 50 ARG OXT O N N 51 ARG H H N N 52 ARG H2 H N N 53 ARG HA H N N 54 ARG HB2 H N N 55 ARG HB3 H N N 56 ARG HG2 H N N 57 ARG HG3 H N N 58 ARG HD2 H N N 59 ARG HD3 H N N 60 ARG HE H N N 61 ARG HH11 H N N 62 ARG HH12 H N N 63 ARG HH21 H N N 64 ARG HH22 H N N 65 ARG HXT H N N 66 ASN N N N N 67 ASN CA C N S 68 ASN C C N N 69 ASN O O N N 70 ASN CB C N N 71 ASN CG C N N 72 ASN OD1 O N N 73 ASN ND2 N N N 74 ASN OXT O N N 75 ASN H H N N 76 ASN H2 H N N 77 ASN HA H N N 78 ASN HB2 H N N 79 ASN HB3 H N N 80 ASN HD21 H N N 81 ASN HD22 H N N 82 ASN HXT H N N 83 ASP N N N N 84 ASP CA C N S 85 ASP C C N N 86 ASP O O N N 87 ASP CB C N N 88 ASP CG C N N 89 ASP OD1 O N N 90 ASP OD2 O N N 91 ASP OXT O N N 92 ASP H H N N 93 ASP H2 H N N 94 ASP HA H N N 95 ASP HB2 H N N 96 ASP HB3 H N N 97 ASP HD2 H N N 98 ASP HXT H N N 99 CYS N N N N 100 CYS CA C N R 101 CYS C C N N 102 CYS O O N N 103 CYS CB C N N 104 CYS SG S N N 105 CYS OXT O N N 106 CYS H H N N 107 CYS H2 H N N 108 CYS HA H N N 109 CYS HB2 H N N 110 CYS HB3 H N N 111 CYS HG H N N 112 CYS HXT H N N 113 GLN N N N N 114 GLN CA C N S 115 GLN C C N N 116 GLN O O N N 117 GLN CB C N N 118 GLN CG C N N 119 GLN CD C N N 120 GLN OE1 O N N 121 GLN NE2 N N N 122 GLN OXT O N N 123 GLN H H N N 124 GLN H2 H N N 125 GLN HA H N N 126 GLN HB2 H N N 127 GLN HB3 H N N 128 GLN HG2 H N N 129 GLN HG3 H N N 130 GLN HE21 H N N 131 GLN HE22 H N N 132 GLN HXT H N N 133 GLU N N N N 134 GLU CA C N S 135 GLU C C N N 136 GLU O O N N 137 GLU CB C N N 138 GLU CG C N N 139 GLU CD C N N 140 GLU OE1 O N N 141 GLU OE2 O N N 142 GLU OXT O N N 143 GLU H H N N 144 GLU H2 H N N 145 GLU HA H N N 146 GLU HB2 H N N 147 GLU HB3 H N N 148 GLU HG2 H N N 149 GLU HG3 H N N 150 GLU HE2 H N N 151 GLU HXT H N N 152 GLY N N N N 153 GLY CA C N N 154 GLY C C N N 155 GLY O O N N 156 GLY OXT O N N 157 GLY H H N N 158 GLY H2 H N N 159 GLY HA2 H N N 160 GLY HA3 H N N 161 GLY HXT H N N 162 HIS N N N N 163 HIS CA C N S 164 HIS C C N N 165 HIS O O N N 166 HIS CB C N N 167 HIS CG C Y N 168 HIS ND1 N Y N 169 HIS CD2 C Y N 170 HIS CE1 C Y N 171 HIS NE2 N Y N 172 HIS OXT O N N 173 HIS H H N N 174 HIS H2 H N N 175 HIS HA H N N 176 HIS HB2 H N N 177 HIS HB3 H N N 178 HIS HD1 H N N 179 HIS HD2 H N N 180 HIS HE1 H N N 181 HIS HE2 H N N 182 HIS HXT H N N 183 ILE N N N N 184 ILE CA C N S 185 ILE C C N N 186 ILE O O N N 187 ILE CB C N S 188 ILE CG1 C N N 189 ILE CG2 C N N 190 ILE CD1 C N N 191 ILE OXT O N N 192 ILE H H N N 193 ILE H2 H N N 194 ILE HA H N N 195 ILE HB H N N 196 ILE HG12 H N N 197 ILE HG13 H N N 198 ILE HG21 H N N 199 ILE HG22 H N N 200 ILE HG23 H N N 201 ILE HD11 H N N 202 ILE HD12 H N N 203 ILE HD13 H N N 204 ILE HXT H N N 205 K K K N N 206 LEU N N N N 207 LEU CA C N S 208 LEU C C N N 209 LEU O O N N 210 LEU CB C N N 211 LEU CG C N N 212 LEU CD1 C N N 213 LEU CD2 C N N 214 LEU OXT O N N 215 LEU H H N N 216 LEU H2 H N N 217 LEU HA H N N 218 LEU HB2 H N N 219 LEU HB3 H N N 220 LEU HG H N N 221 LEU HD11 H N N 222 LEU HD12 H N N 223 LEU HD13 H N N 224 LEU HD21 H N N 225 LEU HD22 H N N 226 LEU HD23 H N N 227 LEU HXT H N N 228 LYS N N N N 229 LYS CA C N S 230 LYS C C N N 231 LYS O O N N 232 LYS CB C N N 233 LYS CG C N N 234 LYS CD C N N 235 LYS CE C N N 236 LYS NZ N N N 237 LYS OXT O N N 238 LYS H H N N 239 LYS H2 H N N 240 LYS HA H N N 241 LYS HB2 H N N 242 LYS HB3 H N N 243 LYS HG2 H N N 244 LYS HG3 H N N 245 LYS HD2 H N N 246 LYS HD3 H N N 247 LYS HE2 H N N 248 LYS HE3 H N N 249 LYS HZ1 H N N 250 LYS HZ2 H N N 251 LYS HZ3 H N N 252 LYS HXT H N N 253 MET N N N N 254 MET CA C N S 255 MET C C N N 256 MET O O N N 257 MET CB C N N 258 MET CG C N N 259 MET SD S N N 260 MET CE C N N 261 MET OXT O N N 262 MET H H N N 263 MET H2 H N N 264 MET HA H N N 265 MET HB2 H N N 266 MET HB3 H N N 267 MET HG2 H N N 268 MET HG3 H N N 269 MET HE1 H N N 270 MET HE2 H N N 271 MET HE3 H N N 272 MET HXT H N N 273 PHE N N N N 274 PHE CA C N S 275 PHE C C N N 276 PHE O O N N 277 PHE CB C N N 278 PHE CG C Y N 279 PHE CD1 C Y N 280 PHE CD2 C Y N 281 PHE CE1 C Y N 282 PHE CE2 C Y N 283 PHE CZ C Y N 284 PHE OXT O N N 285 PHE H H N N 286 PHE H2 H N N 287 PHE HA H N N 288 PHE HB2 H N N 289 PHE HB3 H N N 290 PHE HD1 H N N 291 PHE HD2 H N N 292 PHE HE1 H N N 293 PHE HE2 H N N 294 PHE HZ H N N 295 PHE HXT H N N 296 PRO N N N N 297 PRO CA C N S 298 PRO C C N N 299 PRO O O N N 300 PRO CB C N N 301 PRO CG C N N 302 PRO CD C N N 303 PRO OXT O N N 304 PRO H H N N 305 PRO HA H N N 306 PRO HB2 H N N 307 PRO HB3 H N N 308 PRO HG2 H N N 309 PRO HG3 H N N 310 PRO HD2 H N N 311 PRO HD3 H N N 312 PRO HXT H N N 313 SER N N N N 314 SER CA C N S 315 SER C C N N 316 SER O O N N 317 SER CB C N N 318 SER OG O N N 319 SER OXT O N N 320 SER H H N N 321 SER H2 H N N 322 SER HA H N N 323 SER HB2 H N N 324 SER HB3 H N N 325 SER HG H N N 326 SER HXT H N N 327 THR N N N N 328 THR CA C N S 329 THR C C N N 330 THR O O N N 331 THR CB C N R 332 THR OG1 O N N 333 THR CG2 C N N 334 THR OXT O N N 335 THR H H N N 336 THR H2 H N N 337 THR HA H N N 338 THR HB H N N 339 THR HG1 H N N 340 THR HG21 H N N 341 THR HG22 H N N 342 THR HG23 H N N 343 THR HXT H N N 344 TRP N N N N 345 TRP CA C N S 346 TRP C C N N 347 TRP O O N N 348 TRP CB C N N 349 TRP CG C Y N 350 TRP CD1 C Y N 351 TRP CD2 C Y N 352 TRP NE1 N Y N 353 TRP CE2 C Y N 354 TRP CE3 C Y N 355 TRP CZ2 C Y N 356 TRP CZ3 C Y N 357 TRP CH2 C Y N 358 TRP OXT O N N 359 TRP H H N N 360 TRP H2 H N N 361 TRP HA H N N 362 TRP HB2 H N N 363 TRP HB3 H N N 364 TRP HD1 H N N 365 TRP HE1 H N N 366 TRP HE3 H N N 367 TRP HZ2 H N N 368 TRP HZ3 H N N 369 TRP HH2 H N N 370 TRP HXT H N N 371 TYR N N N N 372 TYR CA C N S 373 TYR C C N N 374 TYR O O N N 375 TYR CB C N N 376 TYR CG C Y N 377 TYR CD1 C Y N 378 TYR CD2 C Y N 379 TYR CE1 C Y N 380 TYR CE2 C Y N 381 TYR CZ C Y N 382 TYR OH O N N 383 TYR OXT O N N 384 TYR H H N N 385 TYR H2 H N N 386 TYR HA H N N 387 TYR HB2 H N N 388 TYR HB3 H N N 389 TYR HD1 H N N 390 TYR HD2 H N N 391 TYR HE1 H N N 392 TYR HE2 H N N 393 TYR HH H N N 394 TYR HXT H N N 395 VAL N N N N 396 VAL CA C N S 397 VAL C C N N 398 VAL O O N N 399 VAL CB C N N 400 VAL CG1 C N N 401 VAL CG2 C N N 402 VAL OXT O N N 403 VAL H H N N 404 VAL H2 H N N 405 VAL HA H N N 406 VAL HB H N N 407 VAL HG11 H N N 408 VAL HG12 H N N 409 VAL HG13 H N N 410 VAL HG21 H N N 411 VAL HG22 H N N 412 VAL HG23 H N N 413 VAL HXT H N N 414 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 6E3 C9 C1 sing N N 1 6E3 C8 C2 sing N N 2 6E3 C6 C4 sing N N 3 6E3 C7 C3 sing N N 4 6E3 C2 C1 doub N N 5 6E3 C2 N sing N N 6 6E3 C1 C sing N N 7 6E3 C4 C3 doub N N 8 6E3 C4 C5 sing N N 9 6E3 C3 N sing N N 10 6E3 C5 O1 doub N N 11 6E3 C5 N1 sing N N 12 6E3 N N1 sing N N 13 6E3 C N1 sing N N 14 6E3 C O doub N N 15 6E3 C7 H4 sing N N 16 6E3 C7 H3 sing N N 17 6E3 C7 H11 sing N N 18 6E3 C8 H6 sing N N 19 6E3 C8 H5 sing N N 20 6E3 C8 H7 sing N N 21 6E3 C9 H9 sing N N 22 6E3 C9 H10 sing N N 23 6E3 C9 H8 sing N N 24 6E3 C6 H2 sing N N 25 6E3 C6 H1 sing N N 26 6E3 C6 H sing N N 27 ALA N CA sing N N 28 ALA N H sing N N 29 ALA N H2 sing N N 30 ALA CA C sing N N 31 ALA CA CB sing N N 32 ALA CA HA sing N N 33 ALA C O doub N N 34 ALA C OXT sing N N 35 ALA CB HB1 sing N N 36 ALA CB HB2 sing N N 37 ALA CB HB3 sing N N 38 ALA OXT HXT sing N N 39 ARG N CA sing N N 40 ARG N H sing N N 41 ARG N H2 sing N N 42 ARG CA C sing N N 43 ARG CA CB sing N N 44 ARG CA HA sing N N 45 ARG C O doub N N 46 ARG C OXT sing N N 47 ARG CB CG sing N N 48 ARG CB HB2 sing N N 49 ARG CB HB3 sing N N 50 ARG CG CD sing N N 51 ARG CG HG2 sing N N 52 ARG CG HG3 sing N N 53 ARG CD NE sing N N 54 ARG CD HD2 sing N N 55 ARG CD HD3 sing N N 56 ARG NE CZ sing N N 57 ARG NE HE sing N N 58 ARG CZ NH1 sing N N 59 ARG CZ NH2 doub N N 60 ARG NH1 HH11 sing N N 61 ARG NH1 HH12 sing N N 62 ARG NH2 HH21 sing N N 63 ARG NH2 HH22 sing N N 64 ARG OXT HXT sing N N 65 ASN N CA sing N N 66 ASN N H sing N N 67 ASN N H2 sing N N 68 ASN CA C sing N N 69 ASN CA CB sing N N 70 ASN CA HA sing N N 71 ASN C O doub N N 72 ASN C OXT sing N N 73 ASN CB CG sing N N 74 ASN CB HB2 sing N N 75 ASN CB HB3 sing N N 76 ASN CG OD1 doub N N 77 ASN CG ND2 sing N N 78 ASN ND2 HD21 sing N N 79 ASN ND2 HD22 sing N N 80 ASN OXT HXT sing N N 81 ASP N CA sing N N 82 ASP N H sing N N 83 ASP N H2 sing N N 84 ASP CA C sing N N 85 ASP CA CB sing N N 86 ASP CA HA sing N N 87 ASP C O doub N N 88 ASP C OXT sing N N 89 ASP CB CG sing N N 90 ASP CB HB2 sing N N 91 ASP CB HB3 sing N N 92 ASP CG OD1 doub N N 93 ASP CG OD2 sing N N 94 ASP OD2 HD2 sing N N 95 ASP OXT HXT sing N N 96 CYS N CA sing N N 97 CYS N H sing N N 98 CYS N H2 sing N N 99 CYS CA C sing N N 100 CYS CA CB sing N N 101 CYS CA HA sing N N 102 CYS C O doub N N 103 CYS C OXT sing N N 104 CYS CB SG sing N N 105 CYS CB HB2 sing N N 106 CYS CB HB3 sing N N 107 CYS SG HG sing N N 108 CYS OXT HXT sing N N 109 GLN N CA sing N N 110 GLN N H sing N N 111 GLN N H2 sing N N 112 GLN CA C sing N N 113 GLN CA CB sing N N 114 GLN CA HA sing N N 115 GLN C O doub N N 116 GLN C OXT sing N N 117 GLN CB CG sing N N 118 GLN CB HB2 sing N N 119 GLN CB HB3 sing N N 120 GLN CG CD sing N N 121 GLN CG HG2 sing N N 122 GLN CG HG3 sing N N 123 GLN CD OE1 doub N N 124 GLN CD NE2 sing N N 125 GLN NE2 HE21 sing N N 126 GLN NE2 HE22 sing N N 127 GLN OXT HXT sing N N 128 GLU N CA sing N N 129 GLU N H sing N N 130 GLU N H2 sing N N 131 GLU CA C sing N N 132 GLU CA CB sing N N 133 GLU CA HA sing N N 134 GLU C O doub N N 135 GLU C OXT sing N N 136 GLU CB CG sing N N 137 GLU CB HB2 sing N N 138 GLU CB HB3 sing N N 139 GLU CG CD sing N N 140 GLU CG HG2 sing N N 141 GLU CG HG3 sing N N 142 GLU CD OE1 doub N N 143 GLU CD OE2 sing N N 144 GLU OE2 HE2 sing N N 145 GLU OXT HXT sing N N 146 GLY N CA sing N N 147 GLY N H sing N N 148 GLY N H2 sing N N 149 GLY CA C sing N N 150 GLY CA HA2 sing N N 151 GLY CA HA3 sing N N 152 GLY C O doub N N 153 GLY C OXT sing N N 154 GLY OXT HXT sing N N 155 HIS N CA sing N N 156 HIS N H sing N N 157 HIS N H2 sing N N 158 HIS CA C sing N N 159 HIS CA CB sing N N 160 HIS CA HA sing N N 161 HIS C O doub N N 162 HIS C OXT sing N N 163 HIS CB CG sing N N 164 HIS CB HB2 sing N N 165 HIS CB HB3 sing N N 166 HIS CG ND1 sing Y N 167 HIS CG CD2 doub Y N 168 HIS ND1 CE1 doub Y N 169 HIS ND1 HD1 sing N N 170 HIS CD2 NE2 sing Y N 171 HIS CD2 HD2 sing N N 172 HIS CE1 NE2 sing Y N 173 HIS CE1 HE1 sing N N 174 HIS NE2 HE2 sing N N 175 HIS OXT HXT sing N N 176 ILE N CA sing N N 177 ILE N H sing N N 178 ILE N H2 sing N N 179 ILE CA C sing N N 180 ILE CA CB sing N N 181 ILE CA HA sing N N 182 ILE C O doub N N 183 ILE C OXT sing N N 184 ILE CB CG1 sing N N 185 ILE CB CG2 sing N N 186 ILE CB HB sing N N 187 ILE CG1 CD1 sing N N 188 ILE CG1 HG12 sing N N 189 ILE CG1 HG13 sing N N 190 ILE CG2 HG21 sing N N 191 ILE CG2 HG22 sing N N 192 ILE CG2 HG23 sing N N 193 ILE CD1 HD11 sing N N 194 ILE CD1 HD12 sing N N 195 ILE CD1 HD13 sing N N 196 ILE OXT HXT sing N N 197 LEU N CA sing N N 198 LEU N H sing N N 199 LEU N H2 sing N N 200 LEU CA C sing N N 201 LEU CA CB sing N N 202 LEU CA HA sing N N 203 LEU C O doub N N 204 LEU C OXT sing N N 205 LEU CB CG sing N N 206 LEU CB HB2 sing N N 207 LEU CB HB3 sing N N 208 LEU CG CD1 sing N N 209 LEU CG CD2 sing N N 210 LEU CG HG sing N N 211 LEU CD1 HD11 sing N N 212 LEU CD1 HD12 sing N N 213 LEU CD1 HD13 sing N N 214 LEU CD2 HD21 sing N N 215 LEU CD2 HD22 sing N N 216 LEU CD2 HD23 sing N N 217 LEU OXT HXT sing N N 218 LYS N CA sing N N 219 LYS N H sing N N 220 LYS N H2 sing N N 221 LYS CA C sing N N 222 LYS CA CB sing N N 223 LYS CA HA sing N N 224 LYS C O doub N N 225 LYS C OXT sing N N 226 LYS CB CG sing N N 227 LYS CB HB2 sing N N 228 LYS CB HB3 sing N N 229 LYS CG CD sing N N 230 LYS CG HG2 sing N N 231 LYS CG HG3 sing N N 232 LYS CD CE sing N N 233 LYS CD HD2 sing N N 234 LYS CD HD3 sing N N 235 LYS CE NZ sing N N 236 LYS CE HE2 sing N N 237 LYS CE HE3 sing N N 238 LYS NZ HZ1 sing N N 239 LYS NZ HZ2 sing N N 240 LYS NZ HZ3 sing N N 241 LYS OXT HXT sing N N 242 MET N CA sing N N 243 MET N H sing N N 244 MET N H2 sing N N 245 MET CA C sing N N 246 MET CA CB sing N N 247 MET CA HA sing N N 248 MET C O doub N N 249 MET C OXT sing N N 250 MET CB CG sing N N 251 MET CB HB2 sing N N 252 MET CB HB3 sing N N 253 MET CG SD sing N N 254 MET CG HG2 sing N N 255 MET CG HG3 sing N N 256 MET SD CE sing N N 257 MET CE HE1 sing N N 258 MET CE HE2 sing N N 259 MET CE HE3 sing N N 260 MET OXT HXT sing N N 261 PHE N CA sing N N 262 PHE N H sing N N 263 PHE N H2 sing N N 264 PHE CA C sing N N 265 PHE CA CB sing N N 266 PHE CA HA sing N N 267 PHE C O doub N N 268 PHE C OXT sing N N 269 PHE CB CG sing N N 270 PHE CB HB2 sing N N 271 PHE CB HB3 sing N N 272 PHE CG CD1 doub Y N 273 PHE CG CD2 sing Y N 274 PHE CD1 CE1 sing Y N 275 PHE CD1 HD1 sing N N 276 PHE CD2 CE2 doub Y N 277 PHE CD2 HD2 sing N N 278 PHE CE1 CZ doub Y N 279 PHE CE1 HE1 sing N N 280 PHE CE2 CZ sing Y N 281 PHE CE2 HE2 sing N N 282 PHE CZ HZ sing N N 283 PHE OXT HXT sing N N 284 PRO N CA sing N N 285 PRO N CD sing N N 286 PRO N H sing N N 287 PRO CA C sing N N 288 PRO CA CB sing N N 289 PRO CA HA sing N N 290 PRO C O doub N N 291 PRO C OXT sing N N 292 PRO CB CG sing N N 293 PRO CB HB2 sing N N 294 PRO CB HB3 sing N N 295 PRO CG CD sing N N 296 PRO CG HG2 sing N N 297 PRO CG HG3 sing N N 298 PRO CD HD2 sing N N 299 PRO CD HD3 sing N N 300 PRO OXT HXT sing N N 301 SER N CA sing N N 302 SER N H sing N N 303 SER N H2 sing N N 304 SER CA C sing N N 305 SER CA CB sing N N 306 SER CA HA sing N N 307 SER C O doub N N 308 SER C OXT sing N N 309 SER CB OG sing N N 310 SER CB HB2 sing N N 311 SER CB HB3 sing N N 312 SER OG HG sing N N 313 SER OXT HXT sing N N 314 THR N CA sing N N 315 THR N H sing N N 316 THR N H2 sing N N 317 THR CA C sing N N 318 THR CA CB sing N N 319 THR CA HA sing N N 320 THR C O doub N N 321 THR C OXT sing N N 322 THR CB OG1 sing N N 323 THR CB CG2 sing N N 324 THR CB HB sing N N 325 THR OG1 HG1 sing N N 326 THR CG2 HG21 sing N N 327 THR CG2 HG22 sing N N 328 THR CG2 HG23 sing N N 329 THR OXT HXT sing N N 330 TRP N CA sing N N 331 TRP N H sing N N 332 TRP N H2 sing N N 333 TRP CA C sing N N 334 TRP CA CB sing N N 335 TRP CA HA sing N N 336 TRP C O doub N N 337 TRP C OXT sing N N 338 TRP CB CG sing N N 339 TRP CB HB2 sing N N 340 TRP CB HB3 sing N N 341 TRP CG CD1 doub Y N 342 TRP CG CD2 sing Y N 343 TRP CD1 NE1 sing Y N 344 TRP CD1 HD1 sing N N 345 TRP CD2 CE2 doub Y N 346 TRP CD2 CE3 sing Y N 347 TRP NE1 CE2 sing Y N 348 TRP NE1 HE1 sing N N 349 TRP CE2 CZ2 sing Y N 350 TRP CE3 CZ3 doub Y N 351 TRP CE3 HE3 sing N N 352 TRP CZ2 CH2 doub Y N 353 TRP CZ2 HZ2 sing N N 354 TRP CZ3 CH2 sing Y N 355 TRP CZ3 HZ3 sing N N 356 TRP CH2 HH2 sing N N 357 TRP OXT HXT sing N N 358 TYR N CA sing N N 359 TYR N H sing N N 360 TYR N H2 sing N N 361 TYR CA C sing N N 362 TYR CA CB sing N N 363 TYR CA HA sing N N 364 TYR C O doub N N 365 TYR C OXT sing N N 366 TYR CB CG sing N N 367 TYR CB HB2 sing N N 368 TYR CB HB3 sing N N 369 TYR CG CD1 doub Y N 370 TYR CG CD2 sing Y N 371 TYR CD1 CE1 sing Y N 372 TYR CD1 HD1 sing N N 373 TYR CD2 CE2 doub Y N 374 TYR CD2 HD2 sing N N 375 TYR CE1 CZ doub Y N 376 TYR CE1 HE1 sing N N 377 TYR CE2 CZ sing Y N 378 TYR CE2 HE2 sing N N 379 TYR CZ OH sing N N 380 TYR OH HH sing N N 381 TYR OXT HXT sing N N 382 VAL N CA sing N N 383 VAL N H sing N N 384 VAL N H2 sing N N 385 VAL CA C sing N N 386 VAL CA CB sing N N 387 VAL CA HA sing N N 388 VAL C O doub N N 389 VAL C OXT sing N N 390 VAL CB CG1 sing N N 391 VAL CB CG2 sing N N 392 VAL CB HB sing N N 393 VAL CG1 HG11 sing N N 394 VAL CG1 HG12 sing N N 395 VAL CG1 HG13 sing N N 396 VAL CG2 HG21 sing N N 397 VAL CG2 HG22 sing N N 398 VAL CG2 HG23 sing N N 399 VAL OXT HXT sing N N 400 # _pdbx_audit_support.funding_organization 'National Health and Medical Research Council (NHMRC, Australia)' _pdbx_audit_support.country Australia _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1XL4 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6O9T _atom_sites.fract_transf_matrix[1][1] 0.009698 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009698 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011202 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C K N O S # loop_