data_6OA8 # _entry.id 6OA8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6OA8 pdb_00006oa8 10.2210/pdb6oa8/pdb WWPDB D_1000240276 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'sfGFP Y66pNO2F' _pdbx_database_related.db_id 6B9C _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6OA8 _pdbx_database_status.recvd_initial_deposition_date 2019-03-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Piacentini, J.' 1 ? 'Olenginski, G.M.' 2 ? 'Brewer, S.H.' 3 ? 'Phillips-Piro, C.M.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr.,Sect.D' _citation.journal_id_ASTM ABCRE6 _citation.journal_id_CSD ? _citation.journal_id_ISSN 1399-0047 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Structural and spectrophotometric investigation of two unnatural amino-acid altered chromophores in the superfolder green fluorescent protein ; _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2059798321006525 _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Olenginski, G.M.' 1 ? primary 'Piacentini, J.' 2 ? primary 'Harris, D.R.' 3 ? primary 'Runko, N.' 4 ? primary 'Papoutsis, B.M.' 5 ? primary 'Alter, J.R.' 6 ? primary 'Hess, K.R.' 7 ? primary 'Brewer, S.H.' 8 ? primary 'Phillips-Piro, C.M.' 9 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6OA8 _cell.details ? _cell.formula_units_Z ? _cell.length_a 55.266 _cell.length_a_esd ? _cell.length_b 55.266 _cell.length_b_esd ? _cell.length_c 166.483 _cell.length_c_esd ? _cell.volume 508494.147 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6OA8 _symmetry.cell_setting ? _symmetry.Int_Tables_number 91 _symmetry.space_group_name_Hall 'P 4w 2c' _symmetry.space_group_name_H-M 'P 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Green fluorescent protein' 26907.336 1 ? ? ? ? 2 non-polymer nat 1,2-ETHANEDIOL 62.068 3 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 8 ? ? ? ? 4 non-polymer syn 'SODIUM ION' 22.990 4 ? ? ? ? 5 water nat water 18.015 325 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTL(M3V)VQCFSRYPDH MKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQ KNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMVLLEFVTAAGITHGMDELY K ; _entity_poly.pdbx_seq_one_letter_code_can ;MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLXVQCFSRYPDHMKRH DFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGI KANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMVLLEFVTAAGITHGMDELYK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 SER n 1 4 LYS n 1 5 GLY n 1 6 GLU n 1 7 GLU n 1 8 LEU n 1 9 PHE n 1 10 THR n 1 11 GLY n 1 12 VAL n 1 13 VAL n 1 14 PRO n 1 15 ILE n 1 16 LEU n 1 17 VAL n 1 18 GLU n 1 19 LEU n 1 20 ASP n 1 21 GLY n 1 22 ASP n 1 23 VAL n 1 24 ASN n 1 25 GLY n 1 26 HIS n 1 27 LYS n 1 28 PHE n 1 29 SER n 1 30 VAL n 1 31 ARG n 1 32 GLY n 1 33 GLU n 1 34 GLY n 1 35 GLU n 1 36 GLY n 1 37 ASP n 1 38 ALA n 1 39 THR n 1 40 ASN n 1 41 GLY n 1 42 LYS n 1 43 LEU n 1 44 THR n 1 45 LEU n 1 46 LYS n 1 47 PHE n 1 48 ILE n 1 49 CYS n 1 50 THR n 1 51 THR n 1 52 GLY n 1 53 LYS n 1 54 LEU n 1 55 PRO n 1 56 VAL n 1 57 PRO n 1 58 TRP n 1 59 PRO n 1 60 THR n 1 61 LEU n 1 62 VAL n 1 63 THR n 1 64 THR n 1 65 LEU n 1 66 M3V n 1 67 VAL n 1 68 GLN n 1 69 CYS n 1 70 PHE n 1 71 SER n 1 72 ARG n 1 73 TYR n 1 74 PRO n 1 75 ASP n 1 76 HIS n 1 77 MET n 1 78 LYS n 1 79 ARG n 1 80 HIS n 1 81 ASP n 1 82 PHE n 1 83 PHE n 1 84 LYS n 1 85 SER n 1 86 ALA n 1 87 MET n 1 88 PRO n 1 89 GLU n 1 90 GLY n 1 91 TYR n 1 92 VAL n 1 93 GLN n 1 94 GLU n 1 95 ARG n 1 96 THR n 1 97 ILE n 1 98 SER n 1 99 PHE n 1 100 LYS n 1 101 ASP n 1 102 ASP n 1 103 GLY n 1 104 THR n 1 105 TYR n 1 106 LYS n 1 107 THR n 1 108 ARG n 1 109 ALA n 1 110 GLU n 1 111 VAL n 1 112 LYS n 1 113 PHE n 1 114 GLU n 1 115 GLY n 1 116 ASP n 1 117 THR n 1 118 LEU n 1 119 VAL n 1 120 ASN n 1 121 ARG n 1 122 ILE n 1 123 GLU n 1 124 LEU n 1 125 LYS n 1 126 GLY n 1 127 ILE n 1 128 ASP n 1 129 PHE n 1 130 LYS n 1 131 GLU n 1 132 ASP n 1 133 GLY n 1 134 ASN n 1 135 ILE n 1 136 LEU n 1 137 GLY n 1 138 HIS n 1 139 LYS n 1 140 LEU n 1 141 GLU n 1 142 TYR n 1 143 ASN n 1 144 PHE n 1 145 ASN n 1 146 SER n 1 147 HIS n 1 148 ASN n 1 149 VAL n 1 150 TYR n 1 151 ILE n 1 152 THR n 1 153 ALA n 1 154 ASP n 1 155 LYS n 1 156 GLN n 1 157 LYS n 1 158 ASN n 1 159 GLY n 1 160 ILE n 1 161 LYS n 1 162 ALA n 1 163 ASN n 1 164 PHE n 1 165 LYS n 1 166 ILE n 1 167 ARG n 1 168 HIS n 1 169 ASN n 1 170 VAL n 1 171 GLU n 1 172 ASP n 1 173 GLY n 1 174 SER n 1 175 VAL n 1 176 GLN n 1 177 LEU n 1 178 ALA n 1 179 ASP n 1 180 HIS n 1 181 TYR n 1 182 GLN n 1 183 GLN n 1 184 ASN n 1 185 THR n 1 186 PRO n 1 187 ILE n 1 188 GLY n 1 189 ASP n 1 190 GLY n 1 191 PRO n 1 192 VAL n 1 193 LEU n 1 194 LEU n 1 195 PRO n 1 196 ASP n 1 197 ASN n 1 198 HIS n 1 199 TYR n 1 200 LEU n 1 201 SER n 1 202 THR n 1 203 GLN n 1 204 SER n 1 205 VAL n 1 206 LEU n 1 207 SER n 1 208 LYS n 1 209 ASP n 1 210 PRO n 1 211 ASN n 1 212 GLU n 1 213 LYS n 1 214 ARG n 1 215 ASP n 1 216 HIS n 1 217 MET n 1 218 VAL n 1 219 LEU n 1 220 LEU n 1 221 GLU n 1 222 PHE n 1 223 VAL n 1 224 THR n 1 225 ALA n 1 226 ALA n 1 227 GLY n 1 228 ILE n 1 229 THR n 1 230 HIS n 1 231 GLY n 1 232 MET n 1 233 ASP n 1 234 GLU n 1 235 LEU n 1 236 TYR n 1 237 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 237 _entity_src_gen.gene_src_common_name Jellyfish _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene gfp _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Aequorea victoria' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6100 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli str. K-12 substr. DH10B' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 316385 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A059PIQ0_AEQVI _struct_ref.pdbx_db_accession A0A059PIQ0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFARYPDHMKQHD FFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIK ANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK ; _struct_ref.pdbx_align_begin 3 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6OA8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 237 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A059PIQ0 _struct_ref_seq.db_align_beg 3 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 238 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 238 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6OA8 MET A 1 ? UNP A0A059PIQ0 ? ? 'initiating methionine' 0 1 1 6OA8 VAL A 2 ? UNP A0A059PIQ0 ? ? 'expression tag' 1 2 1 6OA8 SER A 3 ? UNP A0A059PIQ0 ? ? 'expression tag' 2 3 1 6OA8 ARG A 31 ? UNP A0A059PIQ0 SER 30 conflict 30 4 1 6OA8 ? A ? ? UNP A0A059PIQ0 THR 65 deletion ? 5 1 6OA8 ? A ? ? UNP A0A059PIQ0 TYR 66 deletion ? 6 1 6OA8 M3V A 66 ? UNP A0A059PIQ0 GLY 67 conflict 66 7 1 6OA8 SER A 71 ? UNP A0A059PIQ0 ALA 72 conflict 72 8 1 6OA8 ARG A 79 ? UNP A0A059PIQ0 GLN 80 conflict 80 9 1 6OA8 VAL A 205 ? UNP A0A059PIQ0 ALA 206 conflict 206 10 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 M3V 'L-peptide linking' n '{(4Z)-2-[(1R,2R)-1-amino-2-hydroxypropyl]-4-[(4-cyanophenyl)methylidene]-5-oxo-4,5-dihydro-1H-imidazol-1-yl}acetic acid' ? 'C16 H16 N4 O4' 328.323 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6OA8 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.36 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.93 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Tris-HCl, 2.0 M ammonium sulfate, pH 8.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-12-10 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-E' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97918 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-E _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 14.45 _reflns.entry_id 6OA8 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.37 _reflns.d_resolution_low 165.76 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 55127 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.4 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 20.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.37 _reflns_shell.d_res_low 1.39 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.2 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2740 _reflns_shell.percent_possible_all 96.1 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 7.6 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.393 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 19.70 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6OA8 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.37 _refine.ls_d_res_low 52.45 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 54976 _refine.ls_number_reflns_R_free 2739 _refine.ls_number_reflns_R_work 52237 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.33 _refine.ls_percent_reflns_R_free 4.98 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1627 _refine.ls_R_factor_R_free 0.1885 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1613 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2B3P _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 17.8223 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1558 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.37 _refine_hist.d_res_low 52.45 _refine_hist.number_atoms_solvent 325 _refine_hist.number_atoms_total 2246 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1865 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 56 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0103 ? 2165 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.1299 ? 2960 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0872 ? 314 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0107 ? 391 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.1242 ? 800 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.37 1.39 . . 125 2400 92.97 . . . 0.3460 . 0.3196 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.39 1.42 . . 136 2577 98.87 . . . 0.3212 . 0.2709 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.42 1.45 . . 132 2529 99.03 . . . 0.2570 . 0.2492 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.45 1.48 . . 133 2553 99.15 . . . 0.2822 . 0.2324 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.48 1.51 . . 136 2572 99.34 . . . 0.2268 . 0.2181 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.51 1.54 . . 134 2564 99.26 . . . 0.2136 . 0.2207 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.54 1.58 . . 136 2577 99.52 . . . 0.2493 . 0.2025 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.58 1.62 . . 135 2594 99.53 . . . 0.2312 . 0.1779 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.62 1.67 . . 137 2584 99.60 . . . 0.2311 . 0.1820 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.67 1.73 . . 134 2576 99.74 . . . 0.1818 . 0.1739 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.73 1.79 . . 138 2616 99.75 . . . 0.1725 . 0.1639 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.79 1.86 . . 133 2597 99.85 . . . 0.1762 . 0.1614 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.86 1.94 . . 136 2610 99.96 . . . 0.1952 . 0.1559 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.94 2.05 . . 145 2624 99.96 . . . 0.1937 . 0.1512 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.05 2.17 . . 155 2608 100.00 . . . 0.1743 . 0.1401 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.17 2.34 . . 135 2646 100.00 . . . 0.1505 . 0.1460 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.34 2.58 . . 132 2665 100.00 . . . 0.1760 . 0.1439 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.58 2.95 . . 134 2699 100.00 . . . 0.1743 . 0.1535 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.95 3.72 . . 149 2734 99.93 . . . 0.1628 . 0.1370 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.72 52.45 . . 144 2912 99.84 . . . 0.1845 . 0.1516 . . . . . . . . . . . # _struct.entry_id 6OA8 _struct.title 'Superfolder Green Fluorescent Protein with 4-cyano-L-phenylalanine at the chromophore (position 66)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6OA8 _struct_keywords.text 'Unnatural amino acid, chromophore, FLUORESCENT PROTEIN' _struct_keywords.pdbx_keywords 'FLUORESCENT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 3 ? G N N 3 ? H N N 3 ? I N N 3 ? J N N 3 ? K N N 3 ? L N N 3 ? M N N 4 ? N N N 4 ? O N N 4 ? P N N 4 ? Q N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 5 ? THR A 10 ? GLY A 4 THR A 9 5 ? 6 HELX_P HELX_P2 AA2 PRO A 57 ? THR A 60 ? PRO A 56 THR A 59 5 ? 4 HELX_P HELX_P3 AA3 LEU A 61 ? M3V A 66 ? LEU A 60 M3V A 66 1 ? 6 HELX_P HELX_P4 AA4 VAL A 67 ? SER A 71 ? VAL A 68 SER A 72 5 ? 5 HELX_P HELX_P5 AA5 PRO A 74 ? HIS A 80 ? PRO A 75 HIS A 81 5 ? 7 HELX_P HELX_P6 AA6 ASP A 81 ? ALA A 86 ? ASP A 82 ALA A 87 1 ? 6 HELX_P HELX_P7 AA7 MET A 232 ? TYR A 236 ? MET A 233 TYR A 237 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A LEU 65 C ? ? ? 1_555 A M3V 66 N1 ? ? A LEU 64 A M3V 66 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale2 covale both ? A M3V 66 C3 ? ? ? 1_555 A VAL 67 N ? ? A M3V 66 A VAL 68 1_555 ? ? ? ? ? ? ? 1.307 ? ? metalc1 metalc ? ? A PHE 144 O ? ? ? 1_555 N NA . NA ? ? A PHE 145 A NA 313 1_555 ? ? ? ? ? ? ? 3.185 ? ? metalc2 metalc ? ? A SER 146 OG A ? ? 1_555 N NA . NA ? ? A SER 147 A NA 313 1_555 ? ? ? ? ? ? ? 2.931 ? ? metalc3 metalc ? ? E SO4 . O3 ? ? ? 1_555 M NA . NA ? ? A SO4 304 A NA 312 1_555 ? ? ? ? ? ? ? 2.872 ? ? metalc4 metalc ? ? F SO4 . O3 ? ? ? 1_555 M NA . NA ? ? A SO4 305 A NA 312 1_555 ? ? ? ? ? ? ? 3.180 ? ? metalc5 metalc ? ? F SO4 . O4 ? ? ? 1_555 M NA . NA ? ? A SO4 305 A NA 312 1_555 ? ? ? ? ? ? ? 2.725 ? ? metalc6 metalc ? ? O NA . NA ? ? ? 1_555 Q HOH . O ? ? A NA 314 A HOH 493 1_555 ? ? ? ? ? ? ? 3.067 ? ? metalc7 metalc ? ? O NA . NA ? ? ? 1_555 Q HOH . O ? ? A NA 314 A HOH 521 1_555 ? ? ? ? ? ? ? 2.946 ? ? metalc8 metalc ? ? O NA . NA ? ? ? 1_555 Q HOH . O ? ? A NA 314 A HOH 569 1_555 ? ? ? ? ? ? ? 2.921 ? ? metalc9 metalc ? ? P NA . NA ? ? ? 1_555 Q HOH . O ? ? A NA 315 A HOH 681 1_555 ? ? ? ? ? ? ? 3.136 ? ? metalc10 metalc ? ? P NA . NA ? ? ? 1_555 Q HOH . O ? ? A NA 315 A HOH 681 5_755 ? ? ? ? ? ? ? 3.136 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id MET _struct_mon_prot_cis.label_seq_id 87 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id MET _struct_mon_prot_cis.auth_seq_id 88 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 88 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 89 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 8.90 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 12 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel AA1 10 11 ? anti-parallel AA1 11 12 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 12 ? VAL A 23 ? VAL A 11 VAL A 22 AA1 2 HIS A 26 ? ASP A 37 ? HIS A 25 ASP A 36 AA1 3 LYS A 42 ? CYS A 49 ? LYS A 41 CYS A 48 AA1 4 HIS A 216 ? ALA A 226 ? HIS A 217 ALA A 227 AA1 5 HIS A 198 ? SER A 207 ? HIS A 199 SER A 208 AA1 6 HIS A 147 ? ASP A 154 ? HIS A 148 ASP A 155 AA1 7 GLY A 159 ? ASN A 169 ? GLY A 160 ASN A 170 AA1 8 VAL A 175 ? PRO A 186 ? VAL A 176 PRO A 187 AA1 9 TYR A 91 ? PHE A 99 ? TYR A 92 PHE A 100 AA1 10 THR A 104 ? GLU A 114 ? THR A 105 GLU A 115 AA1 11 THR A 117 ? ILE A 127 ? THR A 118 ILE A 128 AA1 12 VAL A 12 ? VAL A 23 ? VAL A 11 VAL A 22 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 21 ? N GLY A 20 O PHE A 28 ? O PHE A 27 AA1 2 3 N ASP A 37 ? N ASP A 36 O LYS A 42 ? O LYS A 41 AA1 3 4 N LEU A 45 ? N LEU A 44 O LEU A 219 ? O LEU A 220 AA1 4 5 O THR A 224 ? O THR A 225 N SER A 201 ? N SER A 202 AA1 5 6 O HIS A 198 ? O HIS A 199 N ILE A 151 ? N ILE A 152 AA1 6 7 N ASP A 154 ? N ASP A 155 O GLY A 159 ? O GLY A 160 AA1 7 8 N PHE A 164 ? N PHE A 165 O HIS A 180 ? O HIS A 181 AA1 8 9 O THR A 185 ? O THR A 186 N VAL A 92 ? N VAL A 93 AA1 9 10 N ILE A 97 ? N ILE A 98 O TYR A 105 ? O TYR A 106 AA1 10 11 N ARG A 108 ? N ARG A 109 O GLU A 123 ? O GLU A 124 AA1 11 12 O GLY A 126 ? O GLY A 127 N ASP A 22 ? N ASP A 21 # _atom_sites.entry_id 6OA8 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.018094 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018094 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006007 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N NA O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 VAL 2 1 ? ? ? A . n A 1 3 SER 3 2 ? ? ? A . n A 1 4 LYS 4 3 ? ? ? A . n A 1 5 GLY 5 4 4 GLY GLY A . n A 1 6 GLU 6 5 5 GLU GLU A . n A 1 7 GLU 7 6 6 GLU GLU A . n A 1 8 LEU 8 7 7 LEU LEU A . n A 1 9 PHE 9 8 8 PHE PHE A . n A 1 10 THR 10 9 9 THR THR A . n A 1 11 GLY 11 10 10 GLY GLY A . n A 1 12 VAL 12 11 11 VAL VAL A . n A 1 13 VAL 13 12 12 VAL VAL A . n A 1 14 PRO 14 13 13 PRO PRO A . n A 1 15 ILE 15 14 14 ILE ILE A . n A 1 16 LEU 16 15 15 LEU LEU A . n A 1 17 VAL 17 16 16 VAL VAL A . n A 1 18 GLU 18 17 17 GLU GLU A . n A 1 19 LEU 19 18 18 LEU LEU A . n A 1 20 ASP 20 19 19 ASP ASP A . n A 1 21 GLY 21 20 20 GLY GLY A . n A 1 22 ASP 22 21 21 ASP ASP A . n A 1 23 VAL 23 22 22 VAL VAL A . n A 1 24 ASN 24 23 23 ASN ASN A . n A 1 25 GLY 25 24 24 GLY GLY A . n A 1 26 HIS 26 25 25 HIS HIS A . n A 1 27 LYS 27 26 26 LYS LYS A . n A 1 28 PHE 28 27 27 PHE PHE A . n A 1 29 SER 29 28 28 SER SER A . n A 1 30 VAL 30 29 29 VAL VAL A . n A 1 31 ARG 31 30 30 ARG ARG A . n A 1 32 GLY 32 31 31 GLY GLY A . n A 1 33 GLU 33 32 32 GLU GLU A . n A 1 34 GLY 34 33 33 GLY GLY A . n A 1 35 GLU 35 34 34 GLU GLU A . n A 1 36 GLY 36 35 35 GLY GLY A . n A 1 37 ASP 37 36 36 ASP ASP A . n A 1 38 ALA 38 37 37 ALA ALA A . n A 1 39 THR 39 38 38 THR THR A . n A 1 40 ASN 40 39 39 ASN ASN A . n A 1 41 GLY 41 40 40 GLY GLY A . n A 1 42 LYS 42 41 41 LYS LYS A . n A 1 43 LEU 43 42 42 LEU LEU A . n A 1 44 THR 44 43 43 THR THR A . n A 1 45 LEU 45 44 44 LEU LEU A . n A 1 46 LYS 46 45 45 LYS LYS A . n A 1 47 PHE 47 46 46 PHE PHE A . n A 1 48 ILE 48 47 47 ILE ILE A . n A 1 49 CYS 49 48 48 CYS CYS A . n A 1 50 THR 50 49 49 THR THR A . n A 1 51 THR 51 50 50 THR THR A . n A 1 52 GLY 52 51 51 GLY GLY A . n A 1 53 LYS 53 52 52 LYS LYS A . n A 1 54 LEU 54 53 53 LEU LEU A . n A 1 55 PRO 55 54 54 PRO PRO A . n A 1 56 VAL 56 55 55 VAL VAL A . n A 1 57 PRO 57 56 56 PRO PRO A . n A 1 58 TRP 58 57 57 TRP TRP A . n A 1 59 PRO 59 58 58 PRO PRO A . n A 1 60 THR 60 59 59 THR THR A . n A 1 61 LEU 61 60 60 LEU LEU A . n A 1 62 VAL 62 61 61 VAL VAL A . n A 1 63 THR 63 62 62 THR THR A . n A 1 64 THR 64 63 63 THR THR A . n A 1 65 LEU 65 64 64 LEU LEU A . n A 1 66 M3V 66 66 66 M3V O9K A . n A 1 67 VAL 67 68 68 VAL VAL A . n A 1 68 GLN 68 69 69 GLN GLN A . n A 1 69 CYS 69 70 70 CYS CYS A . n A 1 70 PHE 70 71 71 PHE PHE A . n A 1 71 SER 71 72 72 SER SER A . n A 1 72 ARG 72 73 73 ARG ARG A . n A 1 73 TYR 73 74 74 TYR TYR A . n A 1 74 PRO 74 75 75 PRO PRO A . n A 1 75 ASP 75 76 76 ASP ASP A . n A 1 76 HIS 76 77 77 HIS HIS A . n A 1 77 MET 77 78 78 MET MET A . n A 1 78 LYS 78 79 79 LYS LYS A . n A 1 79 ARG 79 80 80 ARG ARG A . n A 1 80 HIS 80 81 81 HIS HIS A . n A 1 81 ASP 81 82 82 ASP ASP A . n A 1 82 PHE 82 83 83 PHE PHE A . n A 1 83 PHE 83 84 84 PHE PHE A . n A 1 84 LYS 84 85 85 LYS LYS A . n A 1 85 SER 85 86 86 SER SER A . n A 1 86 ALA 86 87 87 ALA ALA A . n A 1 87 MET 87 88 88 MET MET A . n A 1 88 PRO 88 89 89 PRO PRO A . n A 1 89 GLU 89 90 90 GLU GLU A . n A 1 90 GLY 90 91 91 GLY GLY A . n A 1 91 TYR 91 92 92 TYR TYR A . n A 1 92 VAL 92 93 93 VAL VAL A . n A 1 93 GLN 93 94 94 GLN GLN A . n A 1 94 GLU 94 95 95 GLU GLU A . n A 1 95 ARG 95 96 96 ARG ARG A . n A 1 96 THR 96 97 97 THR THR A . n A 1 97 ILE 97 98 98 ILE ILE A . n A 1 98 SER 98 99 99 SER SER A . n A 1 99 PHE 99 100 100 PHE PHE A . n A 1 100 LYS 100 101 101 LYS LYS A . n A 1 101 ASP 101 102 102 ASP ASP A . n A 1 102 ASP 102 103 103 ASP ASP A . n A 1 103 GLY 103 104 104 GLY GLY A . n A 1 104 THR 104 105 105 THR THR A . n A 1 105 TYR 105 106 106 TYR TYR A . n A 1 106 LYS 106 107 107 LYS LYS A . n A 1 107 THR 107 108 108 THR THR A . n A 1 108 ARG 108 109 109 ARG ARG A . n A 1 109 ALA 109 110 110 ALA ALA A . n A 1 110 GLU 110 111 111 GLU GLU A . n A 1 111 VAL 111 112 112 VAL VAL A . n A 1 112 LYS 112 113 113 LYS LYS A . n A 1 113 PHE 113 114 114 PHE PHE A . n A 1 114 GLU 114 115 115 GLU GLU A . n A 1 115 GLY 115 116 116 GLY GLY A . n A 1 116 ASP 116 117 117 ASP ASP A . n A 1 117 THR 117 118 118 THR THR A . n A 1 118 LEU 118 119 119 LEU LEU A . n A 1 119 VAL 119 120 120 VAL VAL A . n A 1 120 ASN 120 121 121 ASN ASN A . n A 1 121 ARG 121 122 122 ARG ARG A . n A 1 122 ILE 122 123 123 ILE ILE A . n A 1 123 GLU 123 124 124 GLU GLU A . n A 1 124 LEU 124 125 125 LEU LEU A . n A 1 125 LYS 125 126 126 LYS LYS A . n A 1 126 GLY 126 127 127 GLY GLY A . n A 1 127 ILE 127 128 128 ILE ILE A . n A 1 128 ASP 128 129 129 ASP ASP A . n A 1 129 PHE 129 130 130 PHE PHE A . n A 1 130 LYS 130 131 131 LYS LYS A . n A 1 131 GLU 131 132 132 GLU GLU A . n A 1 132 ASP 132 133 133 ASP ASP A . n A 1 133 GLY 133 134 134 GLY GLY A . n A 1 134 ASN 134 135 135 ASN ASN A . n A 1 135 ILE 135 136 136 ILE ILE A . n A 1 136 LEU 136 137 137 LEU LEU A . n A 1 137 GLY 137 138 138 GLY GLY A . n A 1 138 HIS 138 139 139 HIS HIS A . n A 1 139 LYS 139 140 140 LYS LYS A . n A 1 140 LEU 140 141 141 LEU LEU A . n A 1 141 GLU 141 142 142 GLU GLU A . n A 1 142 TYR 142 143 143 TYR TYR A . n A 1 143 ASN 143 144 144 ASN ASN A . n A 1 144 PHE 144 145 145 PHE PHE A . n A 1 145 ASN 145 146 146 ASN ASN A . n A 1 146 SER 146 147 147 SER SER A . n A 1 147 HIS 147 148 148 HIS HIS A . n A 1 148 ASN 148 149 149 ASN ASN A . n A 1 149 VAL 149 150 150 VAL VAL A . n A 1 150 TYR 150 151 151 TYR TYR A . n A 1 151 ILE 151 152 152 ILE ILE A . n A 1 152 THR 152 153 153 THR THR A . n A 1 153 ALA 153 154 154 ALA ALA A . n A 1 154 ASP 154 155 155 ASP ASP A . n A 1 155 LYS 155 156 156 LYS LYS A . n A 1 156 GLN 156 157 157 GLN GLN A . n A 1 157 LYS 157 158 158 LYS LYS A . n A 1 158 ASN 158 159 159 ASN ASN A . n A 1 159 GLY 159 160 160 GLY GLY A . n A 1 160 ILE 160 161 161 ILE ILE A . n A 1 161 LYS 161 162 162 LYS LYS A . n A 1 162 ALA 162 163 163 ALA ALA A . n A 1 163 ASN 163 164 164 ASN ASN A . n A 1 164 PHE 164 165 165 PHE PHE A . n A 1 165 LYS 165 166 166 LYS LYS A . n A 1 166 ILE 166 167 167 ILE ILE A . n A 1 167 ARG 167 168 168 ARG ARG A . n A 1 168 HIS 168 169 169 HIS HIS A . n A 1 169 ASN 169 170 170 ASN ASN A . n A 1 170 VAL 170 171 171 VAL VAL A . n A 1 171 GLU 171 172 172 GLU GLU A . n A 1 172 ASP 172 173 173 ASP ASP A . n A 1 173 GLY 173 174 174 GLY GLY A . n A 1 174 SER 174 175 175 SER SER A . n A 1 175 VAL 175 176 176 VAL VAL A . n A 1 176 GLN 176 177 177 GLN GLN A . n A 1 177 LEU 177 178 178 LEU LEU A . n A 1 178 ALA 178 179 179 ALA ALA A . n A 1 179 ASP 179 180 180 ASP ASP A . n A 1 180 HIS 180 181 181 HIS HIS A . n A 1 181 TYR 181 182 182 TYR TYR A . n A 1 182 GLN 182 183 183 GLN GLN A . n A 1 183 GLN 183 184 184 GLN GLN A . n A 1 184 ASN 184 185 185 ASN ASN A . n A 1 185 THR 185 186 186 THR THR A . n A 1 186 PRO 186 187 187 PRO PRO A . n A 1 187 ILE 187 188 188 ILE ILE A . n A 1 188 GLY 188 189 189 GLY GLY A . n A 1 189 ASP 189 190 190 ASP ASP A . n A 1 190 GLY 190 191 191 GLY GLY A . n A 1 191 PRO 191 192 192 PRO PRO A . n A 1 192 VAL 192 193 193 VAL VAL A . n A 1 193 LEU 193 194 194 LEU LEU A . n A 1 194 LEU 194 195 195 LEU LEU A . n A 1 195 PRO 195 196 196 PRO PRO A . n A 1 196 ASP 196 197 197 ASP ASP A . n A 1 197 ASN 197 198 198 ASN ASN A . n A 1 198 HIS 198 199 199 HIS HIS A . n A 1 199 TYR 199 200 200 TYR TYR A . n A 1 200 LEU 200 201 201 LEU LEU A . n A 1 201 SER 201 202 202 SER SER A . n A 1 202 THR 202 203 203 THR THR A . n A 1 203 GLN 203 204 204 GLN GLN A . n A 1 204 SER 204 205 205 SER SER A . n A 1 205 VAL 205 206 206 VAL VAL A . n A 1 206 LEU 206 207 207 LEU LEU A . n A 1 207 SER 207 208 208 SER SER A . n A 1 208 LYS 208 209 209 LYS LYS A . n A 1 209 ASP 209 210 210 ASP ASP A . n A 1 210 PRO 210 211 211 PRO PRO A . n A 1 211 ASN 211 212 212 ASN ASN A . n A 1 212 GLU 212 213 213 GLU GLU A . n A 1 213 LYS 213 214 214 LYS LYS A . n A 1 214 ARG 214 215 215 ARG ARG A . n A 1 215 ASP 215 216 216 ASP ASP A . n A 1 216 HIS 216 217 217 HIS HIS A . n A 1 217 MET 217 218 218 MET MET A . n A 1 218 VAL 218 219 219 VAL VAL A . n A 1 219 LEU 219 220 220 LEU LEU A . n A 1 220 LEU 220 221 221 LEU LEU A . n A 1 221 GLU 221 222 222 GLU GLU A . n A 1 222 PHE 222 223 223 PHE PHE A . n A 1 223 VAL 223 224 224 VAL VAL A . n A 1 224 THR 224 225 225 THR THR A . n A 1 225 ALA 225 226 226 ALA ALA A . n A 1 226 ALA 226 227 227 ALA ALA A . n A 1 227 GLY 227 228 228 GLY GLY A . n A 1 228 ILE 228 229 229 ILE ILE A . n A 1 229 THR 229 230 230 THR THR A . n A 1 230 HIS 230 231 231 HIS HIS A . n A 1 231 GLY 231 232 232 GLY GLY A . n A 1 232 MET 232 233 233 MET MET A . n A 1 233 ASP 233 234 234 ASP ASP A . n A 1 234 GLU 234 235 235 GLU GLU A . n A 1 235 LEU 235 236 236 LEU LEU A . n A 1 236 TYR 236 237 237 TYR TYR A . n A 1 237 LYS 237 238 238 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EDO 1 301 301 EDO EDO A . C 2 EDO 1 302 302 EDO EDO A . D 2 EDO 1 303 303 EDO EDO A . E 3 SO4 1 304 1 SO4 SO4 A . F 3 SO4 1 305 2 SO4 SO4 A . G 3 SO4 1 306 3 SO4 SO4 A . H 3 SO4 1 307 4 SO4 SO4 A . I 3 SO4 1 308 5 SO4 SO4 A . J 3 SO4 1 309 6 SO4 SO4 A . K 3 SO4 1 310 7 SO4 SO4 A . L 3 SO4 1 311 8 SO4 SO4 A . M 4 NA 1 312 1 NA NA A . N 4 NA 1 313 2 NA NA A . O 4 NA 1 314 3 NA NA A . P 4 NA 1 315 4 NA NA A . Q 5 HOH 1 401 314 HOH HOH A . Q 5 HOH 2 402 315 HOH HOH A . Q 5 HOH 3 403 247 HOH HOH A . Q 5 HOH 4 404 120 HOH HOH A . Q 5 HOH 5 405 255 HOH HOH A . Q 5 HOH 6 406 159 HOH HOH A . Q 5 HOH 7 407 123 HOH HOH A . Q 5 HOH 8 408 293 HOH HOH A . Q 5 HOH 9 409 133 HOH HOH A . Q 5 HOH 10 410 274 HOH HOH A . Q 5 HOH 11 411 234 HOH HOH A . Q 5 HOH 12 412 189 HOH HOH A . Q 5 HOH 13 413 90 HOH HOH A . Q 5 HOH 14 414 321 HOH HOH A . Q 5 HOH 15 415 142 HOH HOH A . Q 5 HOH 16 416 110 HOH HOH A . Q 5 HOH 17 417 7 HOH HOH A . Q 5 HOH 18 418 180 HOH HOH A . Q 5 HOH 19 419 197 HOH HOH A . Q 5 HOH 20 420 226 HOH HOH A . Q 5 HOH 21 421 328 HOH HOH A . Q 5 HOH 22 422 218 HOH HOH A . Q 5 HOH 23 423 333 HOH HOH A . Q 5 HOH 24 424 227 HOH HOH A . Q 5 HOH 25 425 45 HOH HOH A . Q 5 HOH 26 426 196 HOH HOH A . Q 5 HOH 27 427 44 HOH HOH A . Q 5 HOH 28 428 33 HOH HOH A . Q 5 HOH 29 429 134 HOH HOH A . Q 5 HOH 30 430 179 HOH HOH A . Q 5 HOH 31 431 20 HOH HOH A . Q 5 HOH 32 432 75 HOH HOH A . Q 5 HOH 33 433 57 HOH HOH A . Q 5 HOH 34 434 137 HOH HOH A . Q 5 HOH 35 435 233 HOH HOH A . Q 5 HOH 36 436 143 HOH HOH A . Q 5 HOH 37 437 64 HOH HOH A . Q 5 HOH 38 438 319 HOH HOH A . Q 5 HOH 39 439 329 HOH HOH A . Q 5 HOH 40 440 51 HOH HOH A . Q 5 HOH 41 441 130 HOH HOH A . Q 5 HOH 42 442 70 HOH HOH A . Q 5 HOH 43 443 146 HOH HOH A . Q 5 HOH 44 444 131 HOH HOH A . Q 5 HOH 45 445 236 HOH HOH A . Q 5 HOH 46 446 186 HOH HOH A . Q 5 HOH 47 447 330 HOH HOH A . Q 5 HOH 48 448 194 HOH HOH A . Q 5 HOH 49 449 105 HOH HOH A . Q 5 HOH 50 450 41 HOH HOH A . Q 5 HOH 51 451 10 HOH HOH A . Q 5 HOH 52 452 281 HOH HOH A . Q 5 HOH 53 453 34 HOH HOH A . Q 5 HOH 54 454 13 HOH HOH A . Q 5 HOH 55 455 224 HOH HOH A . Q 5 HOH 56 456 65 HOH HOH A . Q 5 HOH 57 457 12 HOH HOH A . Q 5 HOH 58 458 25 HOH HOH A . Q 5 HOH 59 459 98 HOH HOH A . Q 5 HOH 60 460 160 HOH HOH A . Q 5 HOH 61 461 112 HOH HOH A . Q 5 HOH 62 462 181 HOH HOH A . Q 5 HOH 63 463 225 HOH HOH A . Q 5 HOH 64 464 1 HOH HOH A . Q 5 HOH 65 465 253 HOH HOH A . Q 5 HOH 66 466 190 HOH HOH A . Q 5 HOH 67 467 103 HOH HOH A . Q 5 HOH 68 468 206 HOH HOH A . Q 5 HOH 69 469 153 HOH HOH A . Q 5 HOH 70 470 61 HOH HOH A . Q 5 HOH 71 471 26 HOH HOH A . Q 5 HOH 72 472 38 HOH HOH A . Q 5 HOH 73 473 79 HOH HOH A . Q 5 HOH 74 474 259 HOH HOH A . Q 5 HOH 75 475 35 HOH HOH A . Q 5 HOH 76 476 59 HOH HOH A . Q 5 HOH 77 477 62 HOH HOH A . Q 5 HOH 78 478 121 HOH HOH A . Q 5 HOH 79 479 5 HOH HOH A . Q 5 HOH 80 480 53 HOH HOH A . Q 5 HOH 81 481 167 HOH HOH A . Q 5 HOH 82 482 270 HOH HOH A . Q 5 HOH 83 483 291 HOH HOH A . Q 5 HOH 84 484 317 HOH HOH A . Q 5 HOH 85 485 55 HOH HOH A . Q 5 HOH 86 486 185 HOH HOH A . Q 5 HOH 87 487 52 HOH HOH A . Q 5 HOH 88 488 117 HOH HOH A . Q 5 HOH 89 489 31 HOH HOH A . Q 5 HOH 90 490 58 HOH HOH A . Q 5 HOH 91 491 84 HOH HOH A . Q 5 HOH 92 492 48 HOH HOH A . Q 5 HOH 93 493 166 HOH HOH A . Q 5 HOH 94 494 158 HOH HOH A . Q 5 HOH 95 495 2 HOH HOH A . Q 5 HOH 96 496 261 HOH HOH A . Q 5 HOH 97 497 295 HOH HOH A . Q 5 HOH 98 498 8 HOH HOH A . Q 5 HOH 99 499 43 HOH HOH A . Q 5 HOH 100 500 188 HOH HOH A . Q 5 HOH 101 501 298 HOH HOH A . Q 5 HOH 102 502 39 HOH HOH A . Q 5 HOH 103 503 217 HOH HOH A . Q 5 HOH 104 504 152 HOH HOH A . Q 5 HOH 105 505 37 HOH HOH A . Q 5 HOH 106 506 192 HOH HOH A . Q 5 HOH 107 507 201 HOH HOH A . Q 5 HOH 108 508 11 HOH HOH A . Q 5 HOH 109 509 230 HOH HOH A . Q 5 HOH 110 510 254 HOH HOH A . Q 5 HOH 111 511 67 HOH HOH A . Q 5 HOH 112 512 187 HOH HOH A . Q 5 HOH 113 513 322 HOH HOH A . Q 5 HOH 114 514 148 HOH HOH A . Q 5 HOH 115 515 3 HOH HOH A . Q 5 HOH 116 516 42 HOH HOH A . Q 5 HOH 117 517 107 HOH HOH A . Q 5 HOH 118 518 85 HOH HOH A . Q 5 HOH 119 519 128 HOH HOH A . Q 5 HOH 120 520 4 HOH HOH A . Q 5 HOH 121 521 24 HOH HOH A . Q 5 HOH 122 522 108 HOH HOH A . Q 5 HOH 123 523 6 HOH HOH A . Q 5 HOH 124 524 73 HOH HOH A . Q 5 HOH 125 525 279 HOH HOH A . Q 5 HOH 126 526 238 HOH HOH A . Q 5 HOH 127 527 114 HOH HOH A . Q 5 HOH 128 528 21 HOH HOH A . Q 5 HOH 129 529 182 HOH HOH A . Q 5 HOH 130 530 77 HOH HOH A . Q 5 HOH 131 531 127 HOH HOH A . Q 5 HOH 132 532 49 HOH HOH A . Q 5 HOH 133 533 56 HOH HOH A . Q 5 HOH 134 534 50 HOH HOH A . Q 5 HOH 135 535 97 HOH HOH A . Q 5 HOH 136 536 99 HOH HOH A . Q 5 HOH 137 537 54 HOH HOH A . Q 5 HOH 138 538 23 HOH HOH A . Q 5 HOH 139 539 30 HOH HOH A . Q 5 HOH 140 540 63 HOH HOH A . Q 5 HOH 141 541 93 HOH HOH A . Q 5 HOH 142 542 16 HOH HOH A . Q 5 HOH 143 543 151 HOH HOH A . Q 5 HOH 144 544 32 HOH HOH A . Q 5 HOH 145 545 111 HOH HOH A . Q 5 HOH 146 546 129 HOH HOH A . Q 5 HOH 147 547 17 HOH HOH A . Q 5 HOH 148 548 113 HOH HOH A . Q 5 HOH 149 549 83 HOH HOH A . Q 5 HOH 150 550 331 HOH HOH A . Q 5 HOH 151 551 71 HOH HOH A . Q 5 HOH 152 552 18 HOH HOH A . Q 5 HOH 153 553 29 HOH HOH A . Q 5 HOH 154 554 283 HOH HOH A . Q 5 HOH 155 555 72 HOH HOH A . Q 5 HOH 156 556 237 HOH HOH A . Q 5 HOH 157 557 149 HOH HOH A . Q 5 HOH 158 558 82 HOH HOH A . Q 5 HOH 159 559 19 HOH HOH A . Q 5 HOH 160 560 177 HOH HOH A . Q 5 HOH 161 561 163 HOH HOH A . Q 5 HOH 162 562 139 HOH HOH A . Q 5 HOH 163 563 208 HOH HOH A . Q 5 HOH 164 564 115 HOH HOH A . Q 5 HOH 165 565 242 HOH HOH A . Q 5 HOH 166 566 292 HOH HOH A . Q 5 HOH 167 567 199 HOH HOH A . Q 5 HOH 168 568 212 HOH HOH A . Q 5 HOH 169 569 80 HOH HOH A . Q 5 HOH 170 570 244 HOH HOH A . Q 5 HOH 171 571 126 HOH HOH A . Q 5 HOH 172 572 14 HOH HOH A . Q 5 HOH 173 573 141 HOH HOH A . Q 5 HOH 174 574 47 HOH HOH A . Q 5 HOH 175 575 74 HOH HOH A . Q 5 HOH 176 576 88 HOH HOH A . Q 5 HOH 177 577 161 HOH HOH A . Q 5 HOH 178 578 332 HOH HOH A . Q 5 HOH 179 579 193 HOH HOH A . Q 5 HOH 180 580 69 HOH HOH A . Q 5 HOH 181 581 223 HOH HOH A . Q 5 HOH 182 582 258 HOH HOH A . Q 5 HOH 183 583 9 HOH HOH A . Q 5 HOH 184 584 36 HOH HOH A . Q 5 HOH 185 585 175 HOH HOH A . Q 5 HOH 186 586 81 HOH HOH A . Q 5 HOH 187 587 287 HOH HOH A . Q 5 HOH 188 588 203 HOH HOH A . Q 5 HOH 189 589 40 HOH HOH A . Q 5 HOH 190 590 280 HOH HOH A . Q 5 HOH 191 591 96 HOH HOH A . Q 5 HOH 192 592 66 HOH HOH A . Q 5 HOH 193 593 122 HOH HOH A . Q 5 HOH 194 594 191 HOH HOH A . Q 5 HOH 195 595 106 HOH HOH A . Q 5 HOH 196 596 27 HOH HOH A . Q 5 HOH 197 597 46 HOH HOH A . Q 5 HOH 198 598 138 HOH HOH A . Q 5 HOH 199 599 22 HOH HOH A . Q 5 HOH 200 600 215 HOH HOH A . Q 5 HOH 201 601 211 HOH HOH A . Q 5 HOH 202 602 76 HOH HOH A . Q 5 HOH 203 603 183 HOH HOH A . Q 5 HOH 204 604 327 HOH HOH A . Q 5 HOH 205 605 100 HOH HOH A . Q 5 HOH 206 606 15 HOH HOH A . Q 5 HOH 207 607 28 HOH HOH A . Q 5 HOH 208 608 109 HOH HOH A . Q 5 HOH 209 609 68 HOH HOH A . Q 5 HOH 210 610 147 HOH HOH A . Q 5 HOH 211 611 150 HOH HOH A . Q 5 HOH 212 612 307 HOH HOH A . Q 5 HOH 213 613 257 HOH HOH A . Q 5 HOH 214 614 132 HOH HOH A . Q 5 HOH 215 615 116 HOH HOH A . Q 5 HOH 216 616 316 HOH HOH A . Q 5 HOH 217 617 302 HOH HOH A . Q 5 HOH 218 618 144 HOH HOH A . Q 5 HOH 219 619 165 HOH HOH A . Q 5 HOH 220 620 155 HOH HOH A . Q 5 HOH 221 621 78 HOH HOH A . Q 5 HOH 222 622 91 HOH HOH A . Q 5 HOH 223 623 87 HOH HOH A . Q 5 HOH 224 624 235 HOH HOH A . Q 5 HOH 225 625 173 HOH HOH A . Q 5 HOH 226 626 318 HOH HOH A . Q 5 HOH 227 627 289 HOH HOH A . Q 5 HOH 228 628 216 HOH HOH A . Q 5 HOH 229 629 195 HOH HOH A . Q 5 HOH 230 630 221 HOH HOH A . Q 5 HOH 231 631 174 HOH HOH A . Q 5 HOH 232 632 256 HOH HOH A . Q 5 HOH 233 633 89 HOH HOH A . Q 5 HOH 234 634 299 HOH HOH A . Q 5 HOH 235 635 312 HOH HOH A . Q 5 HOH 236 636 286 HOH HOH A . Q 5 HOH 237 637 310 HOH HOH A . Q 5 HOH 238 638 125 HOH HOH A . Q 5 HOH 239 639 296 HOH HOH A . Q 5 HOH 240 640 92 HOH HOH A . Q 5 HOH 241 641 124 HOH HOH A . Q 5 HOH 242 642 262 HOH HOH A . Q 5 HOH 243 643 102 HOH HOH A . Q 5 HOH 244 644 136 HOH HOH A . Q 5 HOH 245 645 249 HOH HOH A . Q 5 HOH 246 646 294 HOH HOH A . Q 5 HOH 247 647 324 HOH HOH A . Q 5 HOH 248 648 176 HOH HOH A . Q 5 HOH 249 649 184 HOH HOH A . Q 5 HOH 250 650 172 HOH HOH A . Q 5 HOH 251 651 140 HOH HOH A . Q 5 HOH 252 652 95 HOH HOH A . Q 5 HOH 253 653 320 HOH HOH A . Q 5 HOH 254 654 169 HOH HOH A . Q 5 HOH 255 655 228 HOH HOH A . Q 5 HOH 256 656 219 HOH HOH A . Q 5 HOH 257 657 222 HOH HOH A . Q 5 HOH 258 658 285 HOH HOH A . Q 5 HOH 259 659 267 HOH HOH A . Q 5 HOH 260 660 213 HOH HOH A . Q 5 HOH 261 661 309 HOH HOH A . Q 5 HOH 262 662 282 HOH HOH A . Q 5 HOH 263 663 94 HOH HOH A . Q 5 HOH 264 664 276 HOH HOH A . Q 5 HOH 265 665 308 HOH HOH A . Q 5 HOH 266 666 178 HOH HOH A . Q 5 HOH 267 667 232 HOH HOH A . Q 5 HOH 268 668 245 HOH HOH A . Q 5 HOH 269 669 214 HOH HOH A . Q 5 HOH 270 670 272 HOH HOH A . Q 5 HOH 271 671 243 HOH HOH A . Q 5 HOH 272 672 162 HOH HOH A . Q 5 HOH 273 673 210 HOH HOH A . Q 5 HOH 274 674 205 HOH HOH A . Q 5 HOH 275 675 290 HOH HOH A . Q 5 HOH 276 676 239 HOH HOH A . Q 5 HOH 277 677 271 HOH HOH A . Q 5 HOH 278 678 154 HOH HOH A . Q 5 HOH 279 679 200 HOH HOH A . Q 5 HOH 280 680 104 HOH HOH A . Q 5 HOH 281 681 118 HOH HOH A . Q 5 HOH 282 682 202 HOH HOH A . Q 5 HOH 283 683 251 HOH HOH A . Q 5 HOH 284 684 220 HOH HOH A . Q 5 HOH 285 685 252 HOH HOH A . Q 5 HOH 286 686 300 HOH HOH A . Q 5 HOH 287 687 157 HOH HOH A . Q 5 HOH 288 688 304 HOH HOH A . Q 5 HOH 289 689 288 HOH HOH A . Q 5 HOH 290 690 135 HOH HOH A . Q 5 HOH 291 691 303 HOH HOH A . Q 5 HOH 292 692 297 HOH HOH A . Q 5 HOH 293 693 145 HOH HOH A . Q 5 HOH 294 694 241 HOH HOH A . Q 5 HOH 295 695 209 HOH HOH A . Q 5 HOH 296 696 264 HOH HOH A . Q 5 HOH 297 697 168 HOH HOH A . Q 5 HOH 298 698 306 HOH HOH A . Q 5 HOH 299 699 119 HOH HOH A . Q 5 HOH 300 700 268 HOH HOH A . Q 5 HOH 301 701 171 HOH HOH A . Q 5 HOH 302 702 60 HOH HOH A . Q 5 HOH 303 703 277 HOH HOH A . Q 5 HOH 304 704 260 HOH HOH A . Q 5 HOH 305 705 266 HOH HOH A . Q 5 HOH 306 706 263 HOH HOH A . Q 5 HOH 307 707 198 HOH HOH A . Q 5 HOH 308 708 170 HOH HOH A . Q 5 HOH 309 709 204 HOH HOH A . Q 5 HOH 310 710 231 HOH HOH A . Q 5 HOH 311 711 326 HOH HOH A . Q 5 HOH 312 712 246 HOH HOH A . Q 5 HOH 313 713 323 HOH HOH A . Q 5 HOH 314 714 86 HOH HOH A . Q 5 HOH 315 715 101 HOH HOH A . Q 5 HOH 316 716 250 HOH HOH A . Q 5 HOH 317 717 284 HOH HOH A . Q 5 HOH 318 718 311 HOH HOH A . Q 5 HOH 319 719 273 HOH HOH A . Q 5 HOH 320 720 207 HOH HOH A . Q 5 HOH 321 721 269 HOH HOH A . Q 5 HOH 322 722 265 HOH HOH A . Q 5 HOH 323 723 156 HOH HOH A . Q 5 HOH 324 724 278 HOH HOH A . Q 5 HOH 325 725 325 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id ARG _pdbx_struct_mod_residue.label_seq_id 31 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id ARG _pdbx_struct_mod_residue.auth_seq_id 30 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id SER _pdbx_struct_mod_residue.details chromophore # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2360 ? 1 MORE -129 ? 1 'SSA (A^2)' 11540 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A NA 315 ? P NA . 2 1 A HOH 420 ? Q HOH . 3 1 A HOH 606 ? Q HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A PHE 144 ? A PHE 145 ? 1_555 NA ? N NA . ? A NA 313 ? 1_555 OG A A SER 146 ? A SER 147 ? 1_555 122.6 ? 2 O3 ? E SO4 . ? A SO4 304 ? 1_555 NA ? M NA . ? A NA 312 ? 1_555 O3 ? F SO4 . ? A SO4 305 ? 1_555 94.8 ? 3 O3 ? E SO4 . ? A SO4 304 ? 1_555 NA ? M NA . ? A NA 312 ? 1_555 O4 ? F SO4 . ? A SO4 305 ? 1_555 54.8 ? 4 O3 ? F SO4 . ? A SO4 305 ? 1_555 NA ? M NA . ? A NA 312 ? 1_555 O4 ? F SO4 . ? A SO4 305 ? 1_555 45.6 ? 5 O ? Q HOH . ? A HOH 493 ? 1_555 NA ? O NA . ? A NA 314 ? 1_555 O ? Q HOH . ? A HOH 521 ? 1_555 113.2 ? 6 O ? Q HOH . ? A HOH 493 ? 1_555 NA ? O NA . ? A NA 314 ? 1_555 O ? Q HOH . ? A HOH 569 ? 1_555 84.5 ? 7 O ? Q HOH . ? A HOH 521 ? 1_555 NA ? O NA . ? A NA 314 ? 1_555 O ? Q HOH . ? A HOH 569 ? 1_555 105.1 ? 8 O ? Q HOH . ? A HOH 681 ? 1_555 NA ? P NA . ? A NA 315 ? 1_555 O ? Q HOH . ? A HOH 681 ? 5_755 58.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-08-05 2 'Structure model' 2 0 2021-07-14 3 'Structure model' 2 1 2021-08-11 4 'Structure model' 2 2 2023-10-11 5 'Structure model' 3 0 2023-11-15 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'Structure model' author 'Coordinate replacement' 'Model completeness' ;Since the earlier submission we have added a number of solvent molecules, riding hydrogens atoms, and a few alternate conformations of side chains upon the suggestion of the editor of our manuscript currently under review at Acta cryst D. ; # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Atomic model' 3 2 'Structure model' 'Data collection' 4 2 'Structure model' 'Database references' 5 2 'Structure model' 'Derived calculations' 6 2 'Structure model' 'Non-polymer description' 7 2 'Structure model' Other 8 2 'Structure model' 'Refinement description' 9 2 'Structure model' 'Structure summary' 10 3 'Structure model' 'Database references' 11 4 'Structure model' 'Data collection' 12 4 'Structure model' 'Refinement description' 13 5 'Structure model' 'Atomic model' 14 5 'Structure model' 'Data collection' 15 5 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' atom_type 3 2 'Structure model' cell 4 2 'Structure model' chem_comp 5 2 'Structure model' entity 6 2 'Structure model' pdbx_distant_solvent_atoms 7 2 'Structure model' pdbx_entity_nonpoly 8 2 'Structure model' pdbx_entry_details 9 2 'Structure model' pdbx_nonpoly_scheme 10 2 'Structure model' pdbx_struct_assembly_gen 11 2 'Structure model' pdbx_struct_assembly_prop 12 2 'Structure model' pdbx_struct_conn_angle 13 2 'Structure model' pdbx_struct_special_symmetry 14 2 'Structure model' pdbx_validate_close_contact 15 2 'Structure model' pdbx_validate_main_chain_plane 16 2 'Structure model' pdbx_validate_peptide_omega 17 2 'Structure model' pdbx_validate_rmsd_angle 18 2 'Structure model' pdbx_validate_symm_contact 19 2 'Structure model' pdbx_validate_torsion 20 2 'Structure model' refine 21 2 'Structure model' refine_hist 22 2 'Structure model' refine_ls_restr 23 2 'Structure model' refine_ls_shell 24 2 'Structure model' reflns 25 2 'Structure model' software 26 2 'Structure model' struct_asym 27 2 'Structure model' struct_conf 28 2 'Structure model' struct_conn 29 2 'Structure model' struct_conn_type 30 2 'Structure model' struct_mon_prot_cis 31 2 'Structure model' struct_ref_seq_dif 32 2 'Structure model' struct_sheet_range 33 2 'Structure model' symmetry 34 3 'Structure model' citation 35 3 'Structure model' citation_author 36 3 'Structure model' database_2 37 4 'Structure model' chem_comp_atom 38 4 'Structure model' chem_comp_bond 39 4 'Structure model' pdbx_initial_refinement_model 40 5 'Structure model' atom_site 41 5 'Structure model' chem_comp_atom 42 5 'Structure model' chem_comp_bond 43 5 'Structure model' pdbx_validate_rmsd_angle 44 5 'Structure model' pdbx_validate_torsion 45 5 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_cell.volume' 2 2 'Structure model' '_chem_comp.formula' 3 2 'Structure model' '_chem_comp.formula_weight' 4 2 'Structure model' '_chem_comp.id' 5 2 'Structure model' '_chem_comp.mon_nstd_flag' 6 2 'Structure model' '_chem_comp.name' 7 2 'Structure model' '_chem_comp.pdbx_synonyms' 8 2 'Structure model' '_chem_comp.type' 9 2 'Structure model' '_pdbx_entry_details.has_ligand_of_interest' 10 2 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 11 2 'Structure model' '_pdbx_struct_assembly_prop.value' 12 2 'Structure model' '_pdbx_validate_rmsd_angle.angle_deviation' 13 2 'Structure model' '_pdbx_validate_rmsd_angle.angle_value' 14 2 'Structure model' '_pdbx_validate_symm_contact.auth_seq_id_1' 15 2 'Structure model' '_pdbx_validate_symm_contact.auth_seq_id_2' 16 2 'Structure model' '_pdbx_validate_symm_contact.dist' 17 2 'Structure model' '_refine.B_iso_mean' 18 2 'Structure model' '_refine.ls_R_factor_R_free' 19 2 'Structure model' '_refine.ls_R_factor_R_work' 20 2 'Structure model' '_refine.ls_R_factor_obs' 21 2 'Structure model' '_refine.ls_d_res_low' 22 2 'Structure model' '_refine.ls_number_reflns_R_free' 23 2 'Structure model' '_refine.ls_number_reflns_R_work' 24 2 'Structure model' '_refine.ls_number_reflns_obs' 25 2 'Structure model' '_refine.ls_percent_reflns_obs' 26 2 'Structure model' '_refine.overall_SU_ML' 27 2 'Structure model' '_refine.pdbx_overall_phase_error' 28 2 'Structure model' '_refine.pdbx_stereochemistry_target_values' 29 2 'Structure model' '_refine.solvent_model_details' 30 2 'Structure model' '_refine_hist.d_res_low' 31 2 'Structure model' '_refine_hist.number_atoms_solvent' 32 2 'Structure model' '_refine_hist.number_atoms_total' 33 2 'Structure model' '_refine_hist.pdbx_number_atoms_ligand' 34 2 'Structure model' '_refine_hist.pdbx_number_atoms_protein' 35 2 'Structure model' '_refine_ls_restr.dev_ideal' 36 2 'Structure model' '_refine_ls_restr.number' 37 2 'Structure model' '_refine_ls_restr.type' 38 2 'Structure model' '_reflns.B_iso_Wilson_estimate' 39 2 'Structure model' '_software.version' 40 2 'Structure model' '_struct_mon_prot_cis.pdbx_omega_angle' 41 2 'Structure model' '_struct_sheet_range.beg_auth_seq_id' 42 2 'Structure model' '_struct_sheet_range.beg_label_seq_id' 43 2 'Structure model' '_symmetry.space_group_name_Hall' 44 3 'Structure model' '_citation.country' 45 3 'Structure model' '_citation.journal_abbrev' 46 3 'Structure model' '_citation.journal_id_ASTM' 47 3 'Structure model' '_citation.journal_id_CSD' 48 3 'Structure model' '_citation.journal_id_ISSN' 49 3 'Structure model' '_citation.pdbx_database_id_DOI' 50 3 'Structure model' '_citation.title' 51 3 'Structure model' '_citation.year' 52 3 'Structure model' '_database_2.pdbx_DOI' 53 3 'Structure model' '_database_2.pdbx_database_accession' 54 5 'Structure model' '_atom_site.auth_atom_id' 55 5 'Structure model' '_atom_site.label_atom_id' 56 5 'Structure model' '_chem_comp_atom.atom_id' 57 5 'Structure model' '_chem_comp_bond.atom_id_1' 58 5 'Structure model' '_chem_comp_bond.atom_id_2' 59 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 60 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 61 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19_4092 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 6OA8 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details 'R30/S72/R80/V206 sequence differences are due to the super folder GFP sequence' _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HZ2 A LYS 166 ? ? OD1 A ASP 180 ? ? 1.56 2 1 HZ3 A LYS 238 ? ? O A HOH 413 ? ? 1.59 3 1 HD22 A ASN 159 ? ? O A HOH 404 ? ? 1.60 4 1 O A HOH 641 ? ? O A HOH 657 ? ? 2.01 5 1 O A HOH 620 ? ? O A HOH 627 ? ? 2.05 6 1 OE2 A GLU 17 ? ? NH1 A ARG 30 ? B 2.09 7 1 O A HOH 474 ? ? O A HOH 632 ? ? 2.11 8 1 O2 A SO4 310 ? ? O A HOH 403 ? ? 2.14 9 1 O A HOH 526 ? ? O A HOH 600 ? ? 2.14 10 1 O A HOH 410 ? ? O A HOH 634 ? ? 2.15 11 1 O A HOH 409 ? ? O A HOH 644 ? ? 2.16 12 1 O A HOH 486 ? ? O A HOH 668 ? ? 2.19 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 409 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 416 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 5_755 _pdbx_validate_symm_contact.dist 2.11 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 103 ? ? -152.57 -157.64 2 1 ILE A 136 ? ? -90.35 -67.22 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id GLN _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 204 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id B _pdbx_validate_main_chain_plane.improper_torsion_angle 10.59 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 725 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.09 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A VAL 1 ? A VAL 2 3 1 Y 1 A SER 2 ? A SER 3 4 1 Y 1 A LYS 3 ? A LYS 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EDO C1 C N N 88 EDO O1 O N N 89 EDO C2 C N N 90 EDO O2 O N N 91 EDO H11 H N N 92 EDO H12 H N N 93 EDO HO1 H N N 94 EDO H21 H N N 95 EDO H22 H N N 96 EDO HO2 H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 HIS N N N N 147 HIS CA C N S 148 HIS C C N N 149 HIS O O N N 150 HIS CB C N N 151 HIS CG C Y N 152 HIS ND1 N Y N 153 HIS CD2 C Y N 154 HIS CE1 C Y N 155 HIS NE2 N Y N 156 HIS OXT O N N 157 HIS H H N N 158 HIS H2 H N N 159 HIS HA H N N 160 HIS HB2 H N N 161 HIS HB3 H N N 162 HIS HD1 H N N 163 HIS HD2 H N N 164 HIS HE1 H N N 165 HIS HE2 H N N 166 HIS HXT H N N 167 HOH O O N N 168 HOH H1 H N N 169 HOH H2 H N N 170 ILE N N N N 171 ILE CA C N S 172 ILE C C N N 173 ILE O O N N 174 ILE CB C N S 175 ILE CG1 C N N 176 ILE CG2 C N N 177 ILE CD1 C N N 178 ILE OXT O N N 179 ILE H H N N 180 ILE H2 H N N 181 ILE HA H N N 182 ILE HB H N N 183 ILE HG12 H N N 184 ILE HG13 H N N 185 ILE HG21 H N N 186 ILE HG22 H N N 187 ILE HG23 H N N 188 ILE HD11 H N N 189 ILE HD12 H N N 190 ILE HD13 H N N 191 ILE HXT H N N 192 LEU N N N N 193 LEU CA C N S 194 LEU C C N N 195 LEU O O N N 196 LEU CB C N N 197 LEU CG C N N 198 LEU CD1 C N N 199 LEU CD2 C N N 200 LEU OXT O N N 201 LEU H H N N 202 LEU H2 H N N 203 LEU HA H N N 204 LEU HB2 H N N 205 LEU HB3 H N N 206 LEU HG H N N 207 LEU HD11 H N N 208 LEU HD12 H N N 209 LEU HD13 H N N 210 LEU HD21 H N N 211 LEU HD22 H N N 212 LEU HD23 H N N 213 LEU HXT H N N 214 LYS N N N N 215 LYS CA C N S 216 LYS C C N N 217 LYS O O N N 218 LYS CB C N N 219 LYS CG C N N 220 LYS CD C N N 221 LYS CE C N N 222 LYS NZ N N N 223 LYS OXT O N N 224 LYS H H N N 225 LYS H2 H N N 226 LYS HA H N N 227 LYS HB2 H N N 228 LYS HB3 H N N 229 LYS HG2 H N N 230 LYS HG3 H N N 231 LYS HD2 H N N 232 LYS HD3 H N N 233 LYS HE2 H N N 234 LYS HE3 H N N 235 LYS HZ1 H N N 236 LYS HZ2 H N N 237 LYS HZ3 H N N 238 LYS HXT H N N 239 M3V N1 N N N 240 M3V CA1 C N R 241 M3V C3 C N N 242 M3V O3 O N N 243 M3V CB1 C N R 244 M3V CB2 C N N 245 M3V CG1 C N N 246 M3V OG1 O N N 247 M3V CG2 C Y N 248 M3V CD1 C Y N 249 M3V CD2 C Y N 250 M3V CE1 C Y N 251 M3V CE2 C Y N 252 M3V CZ C Y N 253 M3V C1 C N N 254 M3V C2 C N N 255 M3V CA2 C N N 256 M3V CA3 C N N 257 M3V CN C N N 258 M3V N2 N N N 259 M3V N3 N N N 260 M3V N40 N N N 261 M3V O2 O N N 262 M3V H H N N 263 M3V H2 H N N 264 M3V HA1 H N N 265 M3V H8 H N N 266 M3V H9 H N N 267 M3V HG21 H N N 268 M3V HG22 H N N 269 M3V HG23 H N N 270 M3V HG1 H N N 271 M3V H14 H N N 272 M3V H15 H N N 273 M3V H16 H N N 274 M3V H17 H N N 275 M3V HA31 H N N 276 M3V HA32 H N N 277 M3V OXT O N N 278 M3V HXT H N N 279 MET N N N N 280 MET CA C N S 281 MET C C N N 282 MET O O N N 283 MET CB C N N 284 MET CG C N N 285 MET SD S N N 286 MET CE C N N 287 MET OXT O N N 288 MET H H N N 289 MET H2 H N N 290 MET HA H N N 291 MET HB2 H N N 292 MET HB3 H N N 293 MET HG2 H N N 294 MET HG3 H N N 295 MET HE1 H N N 296 MET HE2 H N N 297 MET HE3 H N N 298 MET HXT H N N 299 NA NA NA N N 300 PHE N N N N 301 PHE CA C N S 302 PHE C C N N 303 PHE O O N N 304 PHE CB C N N 305 PHE CG C Y N 306 PHE CD1 C Y N 307 PHE CD2 C Y N 308 PHE CE1 C Y N 309 PHE CE2 C Y N 310 PHE CZ C Y N 311 PHE OXT O N N 312 PHE H H N N 313 PHE H2 H N N 314 PHE HA H N N 315 PHE HB2 H N N 316 PHE HB3 H N N 317 PHE HD1 H N N 318 PHE HD2 H N N 319 PHE HE1 H N N 320 PHE HE2 H N N 321 PHE HZ H N N 322 PHE HXT H N N 323 PRO N N N N 324 PRO CA C N S 325 PRO C C N N 326 PRO O O N N 327 PRO CB C N N 328 PRO CG C N N 329 PRO CD C N N 330 PRO OXT O N N 331 PRO H H N N 332 PRO HA H N N 333 PRO HB2 H N N 334 PRO HB3 H N N 335 PRO HG2 H N N 336 PRO HG3 H N N 337 PRO HD2 H N N 338 PRO HD3 H N N 339 PRO HXT H N N 340 SER N N N N 341 SER CA C N S 342 SER C C N N 343 SER O O N N 344 SER CB C N N 345 SER OG O N N 346 SER OXT O N N 347 SER H H N N 348 SER H2 H N N 349 SER HA H N N 350 SER HB2 H N N 351 SER HB3 H N N 352 SER HG H N N 353 SER HXT H N N 354 SO4 S S N N 355 SO4 O1 O N N 356 SO4 O2 O N N 357 SO4 O3 O N N 358 SO4 O4 O N N 359 THR N N N N 360 THR CA C N S 361 THR C C N N 362 THR O O N N 363 THR CB C N R 364 THR OG1 O N N 365 THR CG2 C N N 366 THR OXT O N N 367 THR H H N N 368 THR H2 H N N 369 THR HA H N N 370 THR HB H N N 371 THR HG1 H N N 372 THR HG21 H N N 373 THR HG22 H N N 374 THR HG23 H N N 375 THR HXT H N N 376 TRP N N N N 377 TRP CA C N S 378 TRP C C N N 379 TRP O O N N 380 TRP CB C N N 381 TRP CG C Y N 382 TRP CD1 C Y N 383 TRP CD2 C Y N 384 TRP NE1 N Y N 385 TRP CE2 C Y N 386 TRP CE3 C Y N 387 TRP CZ2 C Y N 388 TRP CZ3 C Y N 389 TRP CH2 C Y N 390 TRP OXT O N N 391 TRP H H N N 392 TRP H2 H N N 393 TRP HA H N N 394 TRP HB2 H N N 395 TRP HB3 H N N 396 TRP HD1 H N N 397 TRP HE1 H N N 398 TRP HE3 H N N 399 TRP HZ2 H N N 400 TRP HZ3 H N N 401 TRP HH2 H N N 402 TRP HXT H N N 403 TYR N N N N 404 TYR CA C N S 405 TYR C C N N 406 TYR O O N N 407 TYR CB C N N 408 TYR CG C Y N 409 TYR CD1 C Y N 410 TYR CD2 C Y N 411 TYR CE1 C Y N 412 TYR CE2 C Y N 413 TYR CZ C Y N 414 TYR OH O N N 415 TYR OXT O N N 416 TYR H H N N 417 TYR H2 H N N 418 TYR HA H N N 419 TYR HB2 H N N 420 TYR HB3 H N N 421 TYR HD1 H N N 422 TYR HD2 H N N 423 TYR HE1 H N N 424 TYR HE2 H N N 425 TYR HH H N N 426 TYR HXT H N N 427 VAL N N N N 428 VAL CA C N S 429 VAL C C N N 430 VAL O O N N 431 VAL CB C N N 432 VAL CG1 C N N 433 VAL CG2 C N N 434 VAL OXT O N N 435 VAL H H N N 436 VAL H2 H N N 437 VAL HA H N N 438 VAL HB H N N 439 VAL HG11 H N N 440 VAL HG12 H N N 441 VAL HG13 H N N 442 VAL HG21 H N N 443 VAL HG22 H N N 444 VAL HG23 H N N 445 VAL HXT H N N 446 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LYS N CA sing N N 203 LYS N H sing N N 204 LYS N H2 sing N N 205 LYS CA C sing N N 206 LYS CA CB sing N N 207 LYS CA HA sing N N 208 LYS C O doub N N 209 LYS C OXT sing N N 210 LYS CB CG sing N N 211 LYS CB HB2 sing N N 212 LYS CB HB3 sing N N 213 LYS CG CD sing N N 214 LYS CG HG2 sing N N 215 LYS CG HG3 sing N N 216 LYS CD CE sing N N 217 LYS CD HD2 sing N N 218 LYS CD HD3 sing N N 219 LYS CE NZ sing N N 220 LYS CE HE2 sing N N 221 LYS CE HE3 sing N N 222 LYS NZ HZ1 sing N N 223 LYS NZ HZ2 sing N N 224 LYS NZ HZ3 sing N N 225 LYS OXT HXT sing N N 226 M3V O3 C3 doub N N 227 M3V C3 CA3 sing N N 228 M3V CA3 N3 sing N N 229 M3V N3 C2 sing N N 230 M3V N3 C1 sing N N 231 M3V O2 C2 doub N N 232 M3V CA1 N1 sing N N 233 M3V CA1 C1 sing N N 234 M3V CA1 CB1 sing N N 235 M3V C2 CA2 sing N N 236 M3V CG1 CB1 sing N N 237 M3V C1 N2 doub N N 238 M3V CB1 OG1 sing N N 239 M3V CA2 N2 sing N N 240 M3V CA2 CB2 doub N Z 241 M3V CB2 CG2 sing N N 242 M3V CG2 CD1 doub Y N 243 M3V CG2 CD2 sing Y N 244 M3V CD1 CE1 sing Y N 245 M3V CD2 CE2 doub Y N 246 M3V CE1 CZ doub Y N 247 M3V CE2 CZ sing Y N 248 M3V CZ CN sing N N 249 M3V CN N40 trip N N 250 M3V N1 H sing N N 251 M3V N1 H2 sing N N 252 M3V CA1 HA1 sing N N 253 M3V CB1 H8 sing N N 254 M3V CB2 H9 sing N N 255 M3V CG1 HG21 sing N N 256 M3V CG1 HG22 sing N N 257 M3V CG1 HG23 sing N N 258 M3V OG1 HG1 sing N N 259 M3V CD1 H14 sing N N 260 M3V CD2 H15 sing N N 261 M3V CE1 H16 sing N N 262 M3V CE2 H17 sing N N 263 M3V CA3 HA31 sing N N 264 M3V CA3 HA32 sing N N 265 M3V C3 OXT sing N N 266 M3V OXT HXT sing N N 267 MET N CA sing N N 268 MET N H sing N N 269 MET N H2 sing N N 270 MET CA C sing N N 271 MET CA CB sing N N 272 MET CA HA sing N N 273 MET C O doub N N 274 MET C OXT sing N N 275 MET CB CG sing N N 276 MET CB HB2 sing N N 277 MET CB HB3 sing N N 278 MET CG SD sing N N 279 MET CG HG2 sing N N 280 MET CG HG3 sing N N 281 MET SD CE sing N N 282 MET CE HE1 sing N N 283 MET CE HE2 sing N N 284 MET CE HE3 sing N N 285 MET OXT HXT sing N N 286 PHE N CA sing N N 287 PHE N H sing N N 288 PHE N H2 sing N N 289 PHE CA C sing N N 290 PHE CA CB sing N N 291 PHE CA HA sing N N 292 PHE C O doub N N 293 PHE C OXT sing N N 294 PHE CB CG sing N N 295 PHE CB HB2 sing N N 296 PHE CB HB3 sing N N 297 PHE CG CD1 doub Y N 298 PHE CG CD2 sing Y N 299 PHE CD1 CE1 sing Y N 300 PHE CD1 HD1 sing N N 301 PHE CD2 CE2 doub Y N 302 PHE CD2 HD2 sing N N 303 PHE CE1 CZ doub Y N 304 PHE CE1 HE1 sing N N 305 PHE CE2 CZ sing Y N 306 PHE CE2 HE2 sing N N 307 PHE CZ HZ sing N N 308 PHE OXT HXT sing N N 309 PRO N CA sing N N 310 PRO N CD sing N N 311 PRO N H sing N N 312 PRO CA C sing N N 313 PRO CA CB sing N N 314 PRO CA HA sing N N 315 PRO C O doub N N 316 PRO C OXT sing N N 317 PRO CB CG sing N N 318 PRO CB HB2 sing N N 319 PRO CB HB3 sing N N 320 PRO CG CD sing N N 321 PRO CG HG2 sing N N 322 PRO CG HG3 sing N N 323 PRO CD HD2 sing N N 324 PRO CD HD3 sing N N 325 PRO OXT HXT sing N N 326 SER N CA sing N N 327 SER N H sing N N 328 SER N H2 sing N N 329 SER CA C sing N N 330 SER CA CB sing N N 331 SER CA HA sing N N 332 SER C O doub N N 333 SER C OXT sing N N 334 SER CB OG sing N N 335 SER CB HB2 sing N N 336 SER CB HB3 sing N N 337 SER OG HG sing N N 338 SER OXT HXT sing N N 339 SO4 S O1 doub N N 340 SO4 S O2 doub N N 341 SO4 S O3 sing N N 342 SO4 S O4 sing N N 343 THR N CA sing N N 344 THR N H sing N N 345 THR N H2 sing N N 346 THR CA C sing N N 347 THR CA CB sing N N 348 THR CA HA sing N N 349 THR C O doub N N 350 THR C OXT sing N N 351 THR CB OG1 sing N N 352 THR CB CG2 sing N N 353 THR CB HB sing N N 354 THR OG1 HG1 sing N N 355 THR CG2 HG21 sing N N 356 THR CG2 HG22 sing N N 357 THR CG2 HG23 sing N N 358 THR OXT HXT sing N N 359 TRP N CA sing N N 360 TRP N H sing N N 361 TRP N H2 sing N N 362 TRP CA C sing N N 363 TRP CA CB sing N N 364 TRP CA HA sing N N 365 TRP C O doub N N 366 TRP C OXT sing N N 367 TRP CB CG sing N N 368 TRP CB HB2 sing N N 369 TRP CB HB3 sing N N 370 TRP CG CD1 doub Y N 371 TRP CG CD2 sing Y N 372 TRP CD1 NE1 sing Y N 373 TRP CD1 HD1 sing N N 374 TRP CD2 CE2 doub Y N 375 TRP CD2 CE3 sing Y N 376 TRP NE1 CE2 sing Y N 377 TRP NE1 HE1 sing N N 378 TRP CE2 CZ2 sing Y N 379 TRP CE3 CZ3 doub Y N 380 TRP CE3 HE3 sing N N 381 TRP CZ2 CH2 doub Y N 382 TRP CZ2 HZ2 sing N N 383 TRP CZ3 CH2 sing Y N 384 TRP CZ3 HZ3 sing N N 385 TRP CH2 HH2 sing N N 386 TRP OXT HXT sing N N 387 TYR N CA sing N N 388 TYR N H sing N N 389 TYR N H2 sing N N 390 TYR CA C sing N N 391 TYR CA CB sing N N 392 TYR CA HA sing N N 393 TYR C O doub N N 394 TYR C OXT sing N N 395 TYR CB CG sing N N 396 TYR CB HB2 sing N N 397 TYR CB HB3 sing N N 398 TYR CG CD1 doub Y N 399 TYR CG CD2 sing Y N 400 TYR CD1 CE1 sing Y N 401 TYR CD1 HD1 sing N N 402 TYR CD2 CE2 doub Y N 403 TYR CD2 HD2 sing N N 404 TYR CE1 CZ doub Y N 405 TYR CE1 HE1 sing N N 406 TYR CE2 CZ sing Y N 407 TYR CE2 HE2 sing N N 408 TYR CZ OH sing N N 409 TYR OH HH sing N N 410 TYR OXT HXT sing N N 411 VAL N CA sing N N 412 VAL N H sing N N 413 VAL N H2 sing N N 414 VAL CA C sing N N 415 VAL CA CB sing N N 416 VAL CA HA sing N N 417 VAL C O doub N N 418 VAL C OXT sing N N 419 VAL CB CG1 sing N N 420 VAL CB CG2 sing N N 421 VAL CB HB sing N N 422 VAL CG1 HG11 sing N N 423 VAL CG1 HG12 sing N N 424 VAL CG1 HG13 sing N N 425 VAL CG2 HG21 sing N N 426 VAL CG2 HG22 sing N N 427 VAL CG2 HG23 sing N N 428 VAL OXT HXT sing N N 429 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' R15GM121984 1 'National Science Foundation (NSF, United States)' 'United States' CHE-1053946 2 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id M3V _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id M3V _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,2-ETHANEDIOL EDO 3 'SULFATE ION' SO4 4 'SODIUM ION' NA 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2B3P _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details 'sfGFP is a known monomeric protein and our mutation at the chromophore did not change that.' #