data_6OC8 # _entry.id 6OC8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6OC8 pdb_00006oc8 10.2210/pdb6oc8/pdb WWPDB D_1000240315 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6OC8 _pdbx_database_status.recvd_initial_deposition_date 2019-03-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Carrion, F.' 1 ? 'Larrieux, N.' 2 ? 'Trajtenberg, F.' 3 0000-0003-0427-5549 'Buschiazzo, A.' 4 0000-0002-2509-6526 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'BLV capsid self-assembly inhibition by heavy chain antibodies' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Carrion, F.' 1 ? primary 'Larrieux, N.' 2 ? primary 'Trajtenberg, F.' 3 0000-0003-0427-5549 primary 'Gonzalez-Sapienza, G.' 4 ? primary 'Buschiazzo, A.' 5 0000-0002-2509-6526 primary 'Pritsch, O.' 6 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6OC8 _cell.details ? _cell.formula_units_Z ? _cell.length_a 120.560 _cell.length_a_esd ? _cell.length_b 120.720 _cell.length_b_esd ? _cell.length_c 69.941 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 32 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6OC8 _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man VHH8c 13137.548 4 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 9 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 4 water nat water 18.015 38 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMAEVQLVESGGGLVQAGGSLRLSCAASASIFRALNVGYYRQTPGRQRELIAGISGGGSTHYADPVKGRFTISRDNAK NRVDLQMNNLKPEDTAVYYCNAGPTLTTGDAGPYWGQGTQVTVSS ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMAEVQLVESGGGLVQAGGSLRLSCAASASIFRALNVGYYRQTPGRQRELIAGISGGGSTHYADPVKGRFTISRDNAK NRVDLQMNNLKPEDTAVYYCNAGPTLTTGDAGPYWGQGTQVTVSS ; _entity_poly.pdbx_strand_id A,B,C,D _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ALA n 1 6 GLU n 1 7 VAL n 1 8 GLN n 1 9 LEU n 1 10 VAL n 1 11 GLU n 1 12 SER n 1 13 GLY n 1 14 GLY n 1 15 GLY n 1 16 LEU n 1 17 VAL n 1 18 GLN n 1 19 ALA n 1 20 GLY n 1 21 GLY n 1 22 SER n 1 23 LEU n 1 24 ARG n 1 25 LEU n 1 26 SER n 1 27 CYS n 1 28 ALA n 1 29 ALA n 1 30 SER n 1 31 ALA n 1 32 SER n 1 33 ILE n 1 34 PHE n 1 35 ARG n 1 36 ALA n 1 37 LEU n 1 38 ASN n 1 39 VAL n 1 40 GLY n 1 41 TYR n 1 42 TYR n 1 43 ARG n 1 44 GLN n 1 45 THR n 1 46 PRO n 1 47 GLY n 1 48 ARG n 1 49 GLN n 1 50 ARG n 1 51 GLU n 1 52 LEU n 1 53 ILE n 1 54 ALA n 1 55 GLY n 1 56 ILE n 1 57 SER n 1 58 GLY n 1 59 GLY n 1 60 GLY n 1 61 SER n 1 62 THR n 1 63 HIS n 1 64 TYR n 1 65 ALA n 1 66 ASP n 1 67 PRO n 1 68 VAL n 1 69 LYS n 1 70 GLY n 1 71 ARG n 1 72 PHE n 1 73 THR n 1 74 ILE n 1 75 SER n 1 76 ARG n 1 77 ASP n 1 78 ASN n 1 79 ALA n 1 80 LYS n 1 81 ASN n 1 82 ARG n 1 83 VAL n 1 84 ASP n 1 85 LEU n 1 86 GLN n 1 87 MET n 1 88 ASN n 1 89 ASN n 1 90 LEU n 1 91 LYS n 1 92 PRO n 1 93 GLU n 1 94 ASP n 1 95 THR n 1 96 ALA n 1 97 VAL n 1 98 TYR n 1 99 TYR n 1 100 CYS n 1 101 ASN n 1 102 ALA n 1 103 GLY n 1 104 PRO n 1 105 THR n 1 106 LEU n 1 107 THR n 1 108 THR n 1 109 GLY n 1 110 ASP n 1 111 ALA n 1 112 GLY n 1 113 PRO n 1 114 TYR n 1 115 TRP n 1 116 GLY n 1 117 GLN n 1 118 GLY n 1 119 THR n 1 120 GLN n 1 121 VAL n 1 122 THR n 1 123 VAL n 1 124 SER n 1 125 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 125 _entity_src_gen.gene_src_common_name Llama _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lama glama' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9844 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6OC8 _struct_ref.pdbx_db_accession 6OC8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6OC8 A 1 ? 125 ? 6OC8 1 ? 125 ? 1 125 2 1 6OC8 B 1 ? 125 ? 6OC8 1 ? 125 ? 1 125 3 1 6OC8 C 1 ? 125 ? 6OC8 1 ? 125 ? 1 125 4 1 6OC8 D 1 ? 125 ? 6OC8 1 ? 125 ? 1 125 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6OC8 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.42 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.20 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.4 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.00 M ammonium sulfate, 7% isopropanol, 15% pentaerythritol ethoxylate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details 'Kirkpatrick-Baez pair of bi-morph mirrors' _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-07-17 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9801 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SOLEIL BEAMLINE PROXIMA 2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9801 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'PROXIMA 2' _diffrn_source.pdbx_synchrotron_site SOLEIL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6OC8 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.110 _reflns.d_resolution_low 60.360 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 29590 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.300 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.100 _reflns.pdbx_Rmerge_I_obs 0.138 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.700 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 6 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.153 _reflns.pdbx_Rpim_I_all 0.065 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 152335 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.110 2.220 ? ? 22554 ? ? ? 4280 99.900 ? ? ? ? 0.666 ? ? ? ? ? ? ? ? 5.300 ? ? ? 2.300 0.740 0.315 ? 1 1 0.762 ? 6.670 60.360 ? ? 4853 ? ? ? 1019 98.400 ? ? ? ? 0.056 ? ? ? ? ? ? ? ? 4.800 ? ? ? 20.200 0.063 0.027 ? 2 1 0.997 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 86.450 _refine.B_iso_mean 28.4875 _refine.B_iso_min 4.440 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6OC8 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1090 _refine.ls_d_res_low 60.3600 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 29584 _refine.ls_number_reflns_R_free 1567 _refine.ls_number_reflns_R_work 28008 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.1600 _refine.ls_percent_reflns_R_free 5.3000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2107 _refine.ls_R_factor_R_free 0.2407 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2053 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 34.480 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB entry 4XT1' _refine.pdbx_stereochemistry_target_values TWIN_LSQ_F _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.9000 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.1090 _refine_hist.d_res_low 60.3600 _refine_hist.number_atoms_solvent 38 _refine_hist.number_atoms_total 3602 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 486 _refine_hist.pdbx_B_iso_mean_ligand 48.33 _refine_hist.pdbx_B_iso_mean_solvent 17.45 _refine_hist.pdbx_number_atoms_protein 3513 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 51 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 1432 4.250 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 1432 4.250 ? 1 'X-RAY DIFFRACTION' 3 ? ? ? ? ? 3 TORSIONAL ? C 1432 4.250 ? 1 'X-RAY DIFFRACTION' 4 ? ? ? ? ? 4 TORSIONAL ? D 1432 4.250 ? 1 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.1085 2.1765 2680 . 126 2554 95.0000 . . . 0.2868 0.0000 0.2410 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 2.1765 2.2543 2682 . 138 2544 95.0000 . . . 0.2776 0.0000 0.2415 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 2.2543 2.3445 2657 . 142 2515 95.0000 . . . 0.2698 0.0000 0.2380 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 2.3445 2.4511 2680 . 143 2537 94.0000 . . . 0.2802 0.0000 0.2386 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 2.4511 2.5803 2680 . 144 2536 94.0000 . . . 0.2566 0.0000 0.2287 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 2.5803 2.7418 2677 . 141 2536 94.0000 . . . 0.2822 0.0000 0.2197 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 2.7418 2.9532 2688 . 157 2531 94.0000 . . . 0.3195 0.0000 0.2225 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 2.9532 3.2500 2695 . 133 2562 95.0000 . . . 0.2412 0.0000 0.2089 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 3.2500 3.7192 2597 . 149 2448 90.0000 . . . 0.2477 0.0000 0.1943 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 3.7192 4.6818 2712 . 148 2564 93.0000 . . . 0.2079 0.0000 0.1766 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 4.6818 26.9888 2819 . 138 2681 94.0000 . . . 0.2048 0.0000 0.1984 . . . . . . 11 . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and (resid 4 through 5 or (resid 6 and (name N or name CA or name C or name O or name CB )) or resid 7 through 23 or resid 25 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB )) or resid 94 through 123)) ; 1 2 ;(chain B and (resid 4 through 7 or (resid 8 and (name N or name CA or name C or name O or name CB )) or resid 9 through 23 or resid 25 through 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 123)) ; 1 3 ;(chain C and (resid 4 through 23 or resid 25 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB )) or resid 94 through 123)) ; 1 4 ;(chain D and (resid 4 through 23 or resid 25 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB )) or resid 94 through 123)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A MET 4 . A ALA 5 . A MET 4 A ALA 5 ? ;(chain A and (resid 4 through 5 or (resid 6 and (name N or name CA or name C or name O or name CB )) or resid 7 through 23 or resid 25 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB )) or resid 94 through 123)) ; 1 1 2 A GLU 6 . A GLU 6 . A GLU 6 A GLU 6 ? ;(chain A and (resid 4 through 5 or (resid 6 and (name N or name CA or name C or name O or name CB )) or resid 7 through 23 or resid 25 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB )) or resid 94 through 123)) ; 1 1 3 A MET 4 . A SER 124 . A MET 4 A SER 124 ? ;(chain A and (resid 4 through 5 or (resid 6 and (name N or name CA or name C or name O or name CB )) or resid 7 through 23 or resid 25 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB )) or resid 94 through 123)) ; 1 1 4 A MET 4 . A SER 124 . A MET 4 A SER 124 ? ;(chain A and (resid 4 through 5 or (resid 6 and (name N or name CA or name C or name O or name CB )) or resid 7 through 23 or resid 25 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB )) or resid 94 through 123)) ; 1 1 5 A MET 4 . A SER 124 . A MET 4 A SER 124 ? ;(chain A and (resid 4 through 5 or (resid 6 and (name N or name CA or name C or name O or name CB )) or resid 7 through 23 or resid 25 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB )) or resid 94 through 123)) ; 1 1 6 A MET 4 . A SER 124 . A MET 4 A SER 124 ? ;(chain A and (resid 4 through 5 or (resid 6 and (name N or name CA or name C or name O or name CB )) or resid 7 through 23 or resid 25 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB )) or resid 94 through 123)) ; 1 2 1 B MET 4 . B VAL 7 . B MET 4 B VAL 7 ? ;(chain B and (resid 4 through 7 or (resid 8 and (name N or name CA or name C or name O or name CB )) or resid 9 through 23 or resid 25 through 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 123)) ; 1 2 2 B GLN 8 . B GLN 8 . B GLN 8 B GLN 8 ? ;(chain B and (resid 4 through 7 or (resid 8 and (name N or name CA or name C or name O or name CB )) or resid 9 through 23 or resid 25 through 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 123)) ; 1 2 3 B HIS 3 . B SER 125 . B HIS 3 B SER 125 ? ;(chain B and (resid 4 through 7 or (resid 8 and (name N or name CA or name C or name O or name CB )) or resid 9 through 23 or resid 25 through 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 123)) ; 1 2 4 B HIS 3 . B SER 125 . B HIS 3 B SER 125 ? ;(chain B and (resid 4 through 7 or (resid 8 and (name N or name CA or name C or name O or name CB )) or resid 9 through 23 or resid 25 through 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 123)) ; 1 2 5 B HIS 3 . B SER 125 . B HIS 3 B SER 125 ? ;(chain B and (resid 4 through 7 or (resid 8 and (name N or name CA or name C or name O or name CB )) or resid 9 through 23 or resid 25 through 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 123)) ; 1 3 1 C MET 4 . C LEU 23 . C MET 4 C LEU 23 ? ;(chain C and (resid 4 through 23 or resid 25 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB )) or resid 94 through 123)) ; 1 3 2 C LEU 25 . C GLN 44 . C LEU 25 C GLN 44 ? ;(chain C and (resid 4 through 23 or resid 25 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB )) or resid 94 through 123)) ; 1 3 3 C THR 45 . C THR 45 . C THR 45 C THR 45 ? ;(chain C and (resid 4 through 23 or resid 25 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB )) or resid 94 through 123)) ; 1 3 4 C MET 4 . C SER 125 . C MET 4 C SER 125 ? ;(chain C and (resid 4 through 23 or resid 25 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB )) or resid 94 through 123)) ; 1 3 5 C MET 4 . C SER 125 . C MET 4 C SER 125 ? ;(chain C and (resid 4 through 23 or resid 25 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB )) or resid 94 through 123)) ; 1 3 6 C MET 4 . C SER 125 . C MET 4 C SER 125 ? ;(chain C and (resid 4 through 23 or resid 25 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB )) or resid 94 through 123)) ; 1 3 7 C MET 4 . C SER 125 . C MET 4 C SER 125 ? ;(chain C and (resid 4 through 23 or resid 25 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB )) or resid 94 through 123)) ; 1 4 1 D MET 4 . D LEU 23 . D MET 4 D LEU 23 ? ;(chain D and (resid 4 through 23 or resid 25 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB )) or resid 94 through 123)) ; 1 4 2 D LEU 25 . D GLN 44 . D LEU 25 D GLN 44 ? ;(chain D and (resid 4 through 23 or resid 25 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB )) or resid 94 through 123)) ; 1 4 3 D MET 4 . D VAL 123 . D MET 4 D VAL 123 ? ;(chain D and (resid 4 through 23 or resid 25 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB )) or resid 94 through 123)) ; 1 4 4 D MET 4 . D VAL 123 . D MET 4 D VAL 123 ? ;(chain D and (resid 4 through 23 or resid 25 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB )) or resid 94 through 123)) ; 1 4 5 D MET 4 . D VAL 123 . D MET 4 D VAL 123 ? ;(chain D and (resid 4 through 23 or resid 25 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB )) or resid 94 through 123)) ; 1 4 6 D MET 4 . D VAL 123 . D MET 4 D VAL 123 ? ;(chain D and (resid 4 through 23 or resid 25 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB )) or resid 94 through 123)) ; 1 4 7 D MET 4 . D VAL 123 . D MET 4 D VAL 123 ? ;(chain D and (resid 4 through 23 or resid 25 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB )) or resid 94 through 123)) ; 1 4 8 D MET 4 . D VAL 123 . D MET 4 D VAL 123 ? ;(chain D and (resid 4 through 23 or resid 25 through 44 or (resid 45 and (name N or name CA or name C or name O or name CB )) or resid 46 through 48 or (resid 49 and (name N or name CA or name C or name O or name CB )) or resid 50 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 92 or (resid 93 and (name N or name CA or name C or name O or name CB )) or resid 94 through 123)) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 6OC8 _struct.title 'Crystal structure of a VHH against the capsid protein from BLV' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6OC8 _struct_keywords.text 'VHH heavy chain antibody, BLV capsid protein, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? I N N 2 ? J N N 2 ? K N N 2 ? L N N 3 ? M N N 2 ? N N N 2 ? O N N 4 ? P N N 4 ? Q N N 4 ? R N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 31 ? LEU A 37 ? ALA A 31 LEU A 37 5 ? 7 HELX_P HELX_P2 AA2 ASP A 66 ? LYS A 69 ? ASP A 66 LYS A 69 5 ? 4 HELX_P HELX_P3 AA3 ASN A 78 ? LYS A 80 ? ASN A 78 LYS A 80 5 ? 3 HELX_P HELX_P4 AA4 LYS A 91 ? THR A 95 ? LYS A 91 THR A 95 5 ? 5 HELX_P HELX_P5 AA5 ALA B 31 ? LEU B 37 ? ALA B 31 LEU B 37 5 ? 7 HELX_P HELX_P6 AA6 ASP B 66 ? LYS B 69 ? ASP B 66 LYS B 69 5 ? 4 HELX_P HELX_P7 AA7 ASN B 78 ? LYS B 80 ? ASN B 78 LYS B 80 5 ? 3 HELX_P HELX_P8 AA8 LYS B 91 ? THR B 95 ? LYS B 91 THR B 95 5 ? 5 HELX_P HELX_P9 AA9 ALA C 31 ? LEU C 37 ? ALA C 31 LEU C 37 5 ? 7 HELX_P HELX_P10 AB1 ASP C 66 ? LYS C 69 ? ASP C 66 LYS C 69 5 ? 4 HELX_P HELX_P11 AB2 ASN C 78 ? LYS C 80 ? ASN C 78 LYS C 80 5 ? 3 HELX_P HELX_P12 AB3 LYS C 91 ? THR C 95 ? LYS C 91 THR C 95 5 ? 5 HELX_P HELX_P13 AB4 ALA D 31 ? LEU D 37 ? ALA D 31 LEU D 37 5 ? 7 HELX_P HELX_P14 AB5 ASP D 66 ? LYS D 69 ? ASP D 66 LYS D 69 5 ? 4 HELX_P HELX_P15 AB6 ASN D 78 ? LYS D 80 ? ASN D 78 LYS D 80 5 ? 3 HELX_P HELX_P16 AB7 LYS D 91 ? THR D 95 ? LYS D 91 THR D 95 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 27 SG ? ? ? 1_555 A CYS 100 SG ? ? A CYS 27 A CYS 100 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf2 disulf ? ? B CYS 27 SG ? ? ? 1_555 B CYS 100 SG ? ? B CYS 27 B CYS 100 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf3 disulf ? ? C CYS 27 SG ? ? ? 1_555 C CYS 100 SG ? ? C CYS 27 C CYS 100 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf4 disulf ? ? D CYS 27 SG ? ? ? 1_555 D CYS 100 SG ? ? D CYS 27 D CYS 100 1_555 ? ? ? ? ? ? ? 2.019 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 6 ? AA3 ? 4 ? AA4 ? 4 ? AA5 ? 6 ? AA6 ? 4 ? AA7 ? 4 ? AA8 ? 6 ? AA9 ? 4 ? AB1 ? 4 ? AB2 ? 6 ? AB3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA5 1 2 ? parallel AA5 2 3 ? anti-parallel AA5 3 4 ? anti-parallel AA5 4 5 ? anti-parallel AA5 5 6 ? anti-parallel AA6 1 2 ? parallel AA6 2 3 ? anti-parallel AA6 3 4 ? anti-parallel AA7 1 2 ? anti-parallel AA7 2 3 ? anti-parallel AA7 3 4 ? anti-parallel AA8 1 2 ? parallel AA8 2 3 ? anti-parallel AA8 3 4 ? anti-parallel AA8 4 5 ? anti-parallel AA8 5 6 ? anti-parallel AA9 1 2 ? parallel AA9 2 3 ? anti-parallel AA9 3 4 ? anti-parallel AB1 1 2 ? anti-parallel AB1 2 3 ? anti-parallel AB1 3 4 ? anti-parallel AB2 1 2 ? parallel AB2 2 3 ? anti-parallel AB2 3 4 ? anti-parallel AB2 4 5 ? anti-parallel AB2 5 6 ? anti-parallel AB3 1 2 ? parallel AB3 2 3 ? anti-parallel AB3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 10 ? SER A 12 ? VAL A 10 SER A 12 AA1 2 LEU A 23 ? ALA A 28 ? LEU A 23 ALA A 28 AA1 3 ARG A 82 ? MET A 87 ? ARG A 82 MET A 87 AA1 4 PHE A 72 ? ASP A 77 ? PHE A 72 ASP A 77 AA2 1 GLY A 15 ? GLN A 18 ? GLY A 15 GLN A 18 AA2 2 THR A 119 ? SER A 124 ? THR A 119 SER A 124 AA2 3 ALA A 96 ? ALA A 102 ? ALA A 96 ALA A 102 AA2 4 VAL A 39 ? GLN A 44 ? VAL A 39 GLN A 44 AA2 5 GLU A 51 ? ILE A 56 ? GLU A 51 ILE A 56 AA2 6 THR A 62 ? TYR A 64 ? THR A 62 TYR A 64 AA3 1 GLY A 15 ? GLN A 18 ? GLY A 15 GLN A 18 AA3 2 THR A 119 ? SER A 124 ? THR A 119 SER A 124 AA3 3 ALA A 96 ? ALA A 102 ? ALA A 96 ALA A 102 AA3 4 TYR A 114 ? TRP A 115 ? TYR A 114 TRP A 115 AA4 1 VAL B 10 ? SER B 12 ? VAL B 10 SER B 12 AA4 2 LEU B 23 ? ALA B 28 ? LEU B 23 ALA B 28 AA4 3 ARG B 82 ? MET B 87 ? ARG B 82 MET B 87 AA4 4 PHE B 72 ? ASP B 77 ? PHE B 72 ASP B 77 AA5 1 GLY B 15 ? GLN B 18 ? GLY B 15 GLN B 18 AA5 2 THR B 119 ? SER B 124 ? THR B 119 SER B 124 AA5 3 ALA B 96 ? ALA B 102 ? ALA B 96 ALA B 102 AA5 4 VAL B 39 ? GLN B 44 ? VAL B 39 GLN B 44 AA5 5 GLU B 51 ? ILE B 56 ? GLU B 51 ILE B 56 AA5 6 THR B 62 ? TYR B 64 ? THR B 62 TYR B 64 AA6 1 GLY B 15 ? GLN B 18 ? GLY B 15 GLN B 18 AA6 2 THR B 119 ? SER B 124 ? THR B 119 SER B 124 AA6 3 ALA B 96 ? ALA B 102 ? ALA B 96 ALA B 102 AA6 4 TYR B 114 ? TRP B 115 ? TYR B 114 TRP B 115 AA7 1 VAL C 10 ? SER C 12 ? VAL C 10 SER C 12 AA7 2 LEU C 23 ? ALA C 28 ? LEU C 23 ALA C 28 AA7 3 ARG C 82 ? MET C 87 ? ARG C 82 MET C 87 AA7 4 PHE C 72 ? ASP C 77 ? PHE C 72 ASP C 77 AA8 1 GLY C 15 ? GLN C 18 ? GLY C 15 GLN C 18 AA8 2 THR C 119 ? SER C 124 ? THR C 119 SER C 124 AA8 3 ALA C 96 ? ALA C 102 ? ALA C 96 ALA C 102 AA8 4 VAL C 39 ? GLN C 44 ? VAL C 39 GLN C 44 AA8 5 GLU C 51 ? ILE C 56 ? GLU C 51 ILE C 56 AA8 6 THR C 62 ? TYR C 64 ? THR C 62 TYR C 64 AA9 1 GLY C 15 ? GLN C 18 ? GLY C 15 GLN C 18 AA9 2 THR C 119 ? SER C 124 ? THR C 119 SER C 124 AA9 3 ALA C 96 ? ALA C 102 ? ALA C 96 ALA C 102 AA9 4 TYR C 114 ? TRP C 115 ? TYR C 114 TRP C 115 AB1 1 VAL D 10 ? SER D 12 ? VAL D 10 SER D 12 AB1 2 LEU D 23 ? ALA D 28 ? LEU D 23 ALA D 28 AB1 3 ARG D 82 ? MET D 87 ? ARG D 82 MET D 87 AB1 4 PHE D 72 ? ASP D 77 ? PHE D 72 ASP D 77 AB2 1 GLY D 15 ? LEU D 16 ? GLY D 15 LEU D 16 AB2 2 THR D 119 ? THR D 122 ? THR D 119 THR D 122 AB2 3 ALA D 96 ? ALA D 102 ? ALA D 96 ALA D 102 AB2 4 VAL D 39 ? GLN D 44 ? VAL D 39 GLN D 44 AB2 5 GLU D 51 ? ILE D 56 ? GLU D 51 ILE D 56 AB2 6 THR D 62 ? TYR D 64 ? THR D 62 TYR D 64 AB3 1 GLY D 15 ? LEU D 16 ? GLY D 15 LEU D 16 AB3 2 THR D 119 ? THR D 122 ? THR D 119 THR D 122 AB3 3 ALA D 96 ? ALA D 102 ? ALA D 96 ALA D 102 AB3 4 TYR D 114 ? TRP D 115 ? TYR D 114 TRP D 115 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 10 ? N VAL A 10 O ALA A 28 ? O ALA A 28 AA1 2 3 N LEU A 23 ? N LEU A 23 O MET A 87 ? O MET A 87 AA1 3 4 O ASP A 84 ? O ASP A 84 N SER A 75 ? N SER A 75 AA2 1 2 N VAL A 17 ? N VAL A 17 O SER A 124 ? O SER A 124 AA2 2 3 O THR A 119 ? O THR A 119 N TYR A 98 ? N TYR A 98 AA2 3 4 O TYR A 99 ? O TYR A 99 N TYR A 42 ? N TYR A 42 AA2 4 5 N TYR A 41 ? N TYR A 41 O ALA A 54 ? O ALA A 54 AA2 5 6 N GLY A 55 ? N GLY A 55 O HIS A 63 ? O HIS A 63 AA3 1 2 N VAL A 17 ? N VAL A 17 O SER A 124 ? O SER A 124 AA3 2 3 O THR A 119 ? O THR A 119 N TYR A 98 ? N TYR A 98 AA3 3 4 N ALA A 102 ? N ALA A 102 O TYR A 114 ? O TYR A 114 AA4 1 2 N VAL B 10 ? N VAL B 10 O ALA B 28 ? O ALA B 28 AA4 2 3 N LEU B 23 ? N LEU B 23 O MET B 87 ? O MET B 87 AA4 3 4 O ASP B 84 ? O ASP B 84 N SER B 75 ? N SER B 75 AA5 1 2 N VAL B 17 ? N VAL B 17 O SER B 124 ? O SER B 124 AA5 2 3 O THR B 119 ? O THR B 119 N TYR B 98 ? N TYR B 98 AA5 3 4 O TYR B 99 ? O TYR B 99 N TYR B 42 ? N TYR B 42 AA5 4 5 N TYR B 41 ? N TYR B 41 O ALA B 54 ? O ALA B 54 AA5 5 6 N GLY B 55 ? N GLY B 55 O HIS B 63 ? O HIS B 63 AA6 1 2 N VAL B 17 ? N VAL B 17 O SER B 124 ? O SER B 124 AA6 2 3 O THR B 119 ? O THR B 119 N TYR B 98 ? N TYR B 98 AA6 3 4 N ALA B 102 ? N ALA B 102 O TYR B 114 ? O TYR B 114 AA7 1 2 N VAL C 10 ? N VAL C 10 O ALA C 28 ? O ALA C 28 AA7 2 3 N LEU C 23 ? N LEU C 23 O MET C 87 ? O MET C 87 AA7 3 4 O ASP C 84 ? O ASP C 84 N SER C 75 ? N SER C 75 AA8 1 2 N VAL C 17 ? N VAL C 17 O SER C 124 ? O SER C 124 AA8 2 3 O THR C 119 ? O THR C 119 N TYR C 98 ? N TYR C 98 AA8 3 4 O TYR C 99 ? O TYR C 99 N TYR C 42 ? N TYR C 42 AA8 4 5 N VAL C 39 ? N VAL C 39 O ILE C 56 ? O ILE C 56 AA8 5 6 N GLY C 55 ? N GLY C 55 O HIS C 63 ? O HIS C 63 AA9 1 2 N VAL C 17 ? N VAL C 17 O SER C 124 ? O SER C 124 AA9 2 3 O THR C 119 ? O THR C 119 N TYR C 98 ? N TYR C 98 AA9 3 4 N ALA C 102 ? N ALA C 102 O TYR C 114 ? O TYR C 114 AB1 1 2 N VAL D 10 ? N VAL D 10 O ALA D 28 ? O ALA D 28 AB1 2 3 N LEU D 23 ? N LEU D 23 O MET D 87 ? O MET D 87 AB1 3 4 O ASP D 84 ? O ASP D 84 N SER D 75 ? N SER D 75 AB2 1 2 N GLY D 15 ? N GLY D 15 O THR D 122 ? O THR D 122 AB2 2 3 O THR D 119 ? O THR D 119 N TYR D 98 ? N TYR D 98 AB2 3 4 O TYR D 99 ? O TYR D 99 N TYR D 42 ? N TYR D 42 AB2 4 5 N TYR D 41 ? N TYR D 41 O ALA D 54 ? O ALA D 54 AB2 5 6 N GLY D 55 ? N GLY D 55 O HIS D 63 ? O HIS D 63 AB3 1 2 N GLY D 15 ? N GLY D 15 O THR D 122 ? O THR D 122 AB3 2 3 O THR D 119 ? O THR D 119 N TYR D 98 ? N TYR D 98 AB3 3 4 N ALA D 102 ? N ALA D 102 O TYR D 114 ? O TYR D 114 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 201 ? 2 'binding site for residue SO4 A 201' AC2 Software A SO4 202 ? 3 'binding site for residue SO4 A 202' AC3 Software A SO4 203 ? 3 'binding site for residue SO4 A 203' AC4 Software B SO4 201 ? 3 'binding site for residue SO4 B 201' AC5 Software B SO4 202 ? 2 'binding site for residue SO4 B 202' AC6 Software C SO4 201 ? 3 'binding site for residue SO4 C 201' AC7 Software C SO4 202 ? 3 'binding site for residue SO4 C 202' AC8 Software C GOL 203 ? 6 'binding site for residue GOL C 203' AC9 Software D SO4 201 ? 3 'binding site for residue SO4 D 201' AD1 Software D SO4 202 ? 4 'binding site for residue SO4 D 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 HIS A 63 ? HIS A 63 . ? 1_555 ? 2 AC1 2 TYR A 64 ? TYR A 64 . ? 1_555 ? 3 AC2 3 ARG A 24 ? ARG A 24 . ? 1_555 ? 4 AC2 3 ARG A 82 ? ARG A 82 . ? 1_555 ? 5 AC2 3 ASN A 88 ? ASN A 88 . ? 3_554 ? 6 AC3 3 ALA A 28 ? ALA A 28 . ? 1_555 ? 7 AC3 3 ALA A 29 ? ALA A 29 . ? 1_555 ? 8 AC3 3 SER A 30 ? SER A 30 . ? 1_555 ? 9 AC4 3 HIS B 63 ? HIS B 63 . ? 1_555 ? 10 AC4 3 TYR B 64 ? TYR B 64 . ? 1_555 ? 11 AC4 3 LYS B 69 ? LYS B 69 . ? 1_555 ? 12 AC5 2 ARG B 24 ? ARG B 24 . ? 1_555 ? 13 AC5 2 ARG B 82 ? ARG B 82 . ? 1_555 ? 14 AC6 3 HIS C 63 ? HIS C 63 . ? 1_555 ? 15 AC6 3 TYR C 64 ? TYR C 64 . ? 1_555 ? 16 AC6 3 LYS C 69 ? LYS C 69 . ? 1_555 ? 17 AC7 3 ASN B 88 ? ASN B 88 . ? 7_554 ? 18 AC7 3 ARG C 24 ? ARG C 24 . ? 1_555 ? 19 AC7 3 ARG C 82 ? ARG C 82 . ? 1_555 ? 20 AC8 6 ARG A 50 ? ARG A 50 . ? 1_555 ? 21 AC8 6 ALA A 111 ? ALA A 111 . ? 1_555 ? 22 AC8 6 TRP A 115 ? TRP A 115 . ? 1_555 ? 23 AC8 6 GLY C 59 ? GLY C 59 . ? 1_555 ? 24 AC8 6 GLY C 60 ? GLY C 60 . ? 1_555 ? 25 AC8 6 SER C 61 ? SER C 61 . ? 1_555 ? 26 AC9 3 HIS D 63 ? HIS D 63 . ? 1_555 ? 27 AC9 3 TYR D 64 ? TYR D 64 . ? 1_555 ? 28 AC9 3 LYS D 69 ? LYS D 69 . ? 1_555 ? 29 AD1 4 ARG D 24 ? ARG D 24 . ? 1_555 ? 30 AD1 4 THR D 73 ? THR D 73 . ? 3_654 ? 31 AD1 4 GLN D 86 ? GLN D 86 . ? 3_654 ? 32 AD1 4 ASN D 88 ? ASN D 88 . ? 3_654 ? # _atom_sites.entry_id 6OC8 _atom_sites.fract_transf_matrix[1][1] 0.008295 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008284 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014298 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 HIS 3 3 ? ? ? A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 MET 87 87 87 MET MET A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 TYR 98 98 98 TYR TYR A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 CYS 100 100 100 CYS CYS A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 PRO 104 104 104 PRO PRO A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 TYR 114 114 114 TYR TYR A . n A 1 115 TRP 115 115 115 TRP TRP A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 GLN 117 117 117 GLN GLN A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 SER 124 124 124 SER SER A . n A 1 125 SER 125 125 ? ? ? A . n B 1 1 GLY 1 1 ? ? ? B . n B 1 2 SER 2 2 ? ? ? B . n B 1 3 HIS 3 3 3 HIS HIS B . n B 1 4 MET 4 4 4 MET MET B . n B 1 5 ALA 5 5 5 ALA ALA B . n B 1 6 GLU 6 6 6 GLU GLU B . n B 1 7 VAL 7 7 7 VAL VAL B . n B 1 8 GLN 8 8 8 GLN GLN B . n B 1 9 LEU 9 9 9 LEU LEU B . n B 1 10 VAL 10 10 10 VAL VAL B . n B 1 11 GLU 11 11 11 GLU GLU B . n B 1 12 SER 12 12 12 SER SER B . n B 1 13 GLY 13 13 13 GLY GLY B . n B 1 14 GLY 14 14 14 GLY GLY B . n B 1 15 GLY 15 15 15 GLY GLY B . n B 1 16 LEU 16 16 16 LEU LEU B . n B 1 17 VAL 17 17 17 VAL VAL B . n B 1 18 GLN 18 18 18 GLN GLN B . n B 1 19 ALA 19 19 19 ALA ALA B . n B 1 20 GLY 20 20 20 GLY GLY B . n B 1 21 GLY 21 21 21 GLY GLY B . n B 1 22 SER 22 22 22 SER SER B . n B 1 23 LEU 23 23 23 LEU LEU B . n B 1 24 ARG 24 24 24 ARG ARG B . n B 1 25 LEU 25 25 25 LEU LEU B . n B 1 26 SER 26 26 26 SER SER B . n B 1 27 CYS 27 27 27 CYS CYS B . n B 1 28 ALA 28 28 28 ALA ALA B . n B 1 29 ALA 29 29 29 ALA ALA B . n B 1 30 SER 30 30 30 SER SER B . n B 1 31 ALA 31 31 31 ALA ALA B . n B 1 32 SER 32 32 32 SER SER B . n B 1 33 ILE 33 33 33 ILE ILE B . n B 1 34 PHE 34 34 34 PHE PHE B . n B 1 35 ARG 35 35 35 ARG ARG B . n B 1 36 ALA 36 36 36 ALA ALA B . n B 1 37 LEU 37 37 37 LEU LEU B . n B 1 38 ASN 38 38 38 ASN ASN B . n B 1 39 VAL 39 39 39 VAL VAL B . n B 1 40 GLY 40 40 40 GLY GLY B . n B 1 41 TYR 41 41 41 TYR TYR B . n B 1 42 TYR 42 42 42 TYR TYR B . n B 1 43 ARG 43 43 43 ARG ARG B . n B 1 44 GLN 44 44 44 GLN GLN B . n B 1 45 THR 45 45 45 THR THR B . n B 1 46 PRO 46 46 46 PRO PRO B . n B 1 47 GLY 47 47 47 GLY GLY B . n B 1 48 ARG 48 48 48 ARG ARG B . n B 1 49 GLN 49 49 49 GLN GLN B . n B 1 50 ARG 50 50 50 ARG ARG B . n B 1 51 GLU 51 51 51 GLU GLU B . n B 1 52 LEU 52 52 52 LEU LEU B . n B 1 53 ILE 53 53 53 ILE ILE B . n B 1 54 ALA 54 54 54 ALA ALA B . n B 1 55 GLY 55 55 55 GLY GLY B . n B 1 56 ILE 56 56 56 ILE ILE B . n B 1 57 SER 57 57 57 SER SER B . n B 1 58 GLY 58 58 58 GLY GLY B . n B 1 59 GLY 59 59 59 GLY GLY B . n B 1 60 GLY 60 60 60 GLY GLY B . n B 1 61 SER 61 61 61 SER SER B . n B 1 62 THR 62 62 62 THR THR B . n B 1 63 HIS 63 63 63 HIS HIS B . n B 1 64 TYR 64 64 64 TYR TYR B . n B 1 65 ALA 65 65 65 ALA ALA B . n B 1 66 ASP 66 66 66 ASP ASP B . n B 1 67 PRO 67 67 67 PRO PRO B . n B 1 68 VAL 68 68 68 VAL VAL B . n B 1 69 LYS 69 69 69 LYS LYS B . n B 1 70 GLY 70 70 70 GLY GLY B . n B 1 71 ARG 71 71 71 ARG ARG B . n B 1 72 PHE 72 72 72 PHE PHE B . n B 1 73 THR 73 73 73 THR THR B . n B 1 74 ILE 74 74 74 ILE ILE B . n B 1 75 SER 75 75 75 SER SER B . n B 1 76 ARG 76 76 76 ARG ARG B . n B 1 77 ASP 77 77 77 ASP ASP B . n B 1 78 ASN 78 78 78 ASN ASN B . n B 1 79 ALA 79 79 79 ALA ALA B . n B 1 80 LYS 80 80 80 LYS LYS B . n B 1 81 ASN 81 81 81 ASN ASN B . n B 1 82 ARG 82 82 82 ARG ARG B . n B 1 83 VAL 83 83 83 VAL VAL B . n B 1 84 ASP 84 84 84 ASP ASP B . n B 1 85 LEU 85 85 85 LEU LEU B . n B 1 86 GLN 86 86 86 GLN GLN B . n B 1 87 MET 87 87 87 MET MET B . n B 1 88 ASN 88 88 88 ASN ASN B . n B 1 89 ASN 89 89 89 ASN ASN B . n B 1 90 LEU 90 90 90 LEU LEU B . n B 1 91 LYS 91 91 91 LYS LYS B . n B 1 92 PRO 92 92 92 PRO PRO B . n B 1 93 GLU 93 93 93 GLU GLU B . n B 1 94 ASP 94 94 94 ASP ASP B . n B 1 95 THR 95 95 95 THR THR B . n B 1 96 ALA 96 96 96 ALA ALA B . n B 1 97 VAL 97 97 97 VAL VAL B . n B 1 98 TYR 98 98 98 TYR TYR B . n B 1 99 TYR 99 99 99 TYR TYR B . n B 1 100 CYS 100 100 100 CYS CYS B . n B 1 101 ASN 101 101 101 ASN ASN B . n B 1 102 ALA 102 102 102 ALA ALA B . n B 1 103 GLY 103 103 103 GLY GLY B . n B 1 104 PRO 104 104 104 PRO PRO B . n B 1 105 THR 105 105 105 THR THR B . n B 1 106 LEU 106 106 106 LEU LEU B . n B 1 107 THR 107 107 107 THR THR B . n B 1 108 THR 108 108 108 THR THR B . n B 1 109 GLY 109 109 109 GLY GLY B . n B 1 110 ASP 110 110 110 ASP ASP B . n B 1 111 ALA 111 111 111 ALA ALA B . n B 1 112 GLY 112 112 112 GLY GLY B . n B 1 113 PRO 113 113 113 PRO PRO B . n B 1 114 TYR 114 114 114 TYR TYR B . n B 1 115 TRP 115 115 115 TRP TRP B . n B 1 116 GLY 116 116 116 GLY GLY B . n B 1 117 GLN 117 117 117 GLN GLN B . n B 1 118 GLY 118 118 118 GLY GLY B . n B 1 119 THR 119 119 119 THR THR B . n B 1 120 GLN 120 120 120 GLN GLN B . n B 1 121 VAL 121 121 121 VAL VAL B . n B 1 122 THR 122 122 122 THR THR B . n B 1 123 VAL 123 123 123 VAL VAL B . n B 1 124 SER 124 124 124 SER SER B . n B 1 125 SER 125 125 125 SER SER B . n C 1 1 GLY 1 1 ? ? ? C . n C 1 2 SER 2 2 ? ? ? C . n C 1 3 HIS 3 3 ? ? ? C . n C 1 4 MET 4 4 4 MET MET C . n C 1 5 ALA 5 5 5 ALA ALA C . n C 1 6 GLU 6 6 6 GLU GLU C . n C 1 7 VAL 7 7 7 VAL VAL C . n C 1 8 GLN 8 8 8 GLN GLN C . n C 1 9 LEU 9 9 9 LEU LEU C . n C 1 10 VAL 10 10 10 VAL VAL C . n C 1 11 GLU 11 11 11 GLU GLU C . n C 1 12 SER 12 12 12 SER SER C . n C 1 13 GLY 13 13 13 GLY GLY C . n C 1 14 GLY 14 14 14 GLY GLY C . n C 1 15 GLY 15 15 15 GLY GLY C . n C 1 16 LEU 16 16 16 LEU LEU C . n C 1 17 VAL 17 17 17 VAL VAL C . n C 1 18 GLN 18 18 18 GLN GLN C . n C 1 19 ALA 19 19 19 ALA ALA C . n C 1 20 GLY 20 20 20 GLY GLY C . n C 1 21 GLY 21 21 21 GLY GLY C . n C 1 22 SER 22 22 22 SER SER C . n C 1 23 LEU 23 23 23 LEU LEU C . n C 1 24 ARG 24 24 24 ARG ARG C . n C 1 25 LEU 25 25 25 LEU LEU C . n C 1 26 SER 26 26 26 SER SER C . n C 1 27 CYS 27 27 27 CYS CYS C . n C 1 28 ALA 28 28 28 ALA ALA C . n C 1 29 ALA 29 29 29 ALA ALA C . n C 1 30 SER 30 30 30 SER SER C . n C 1 31 ALA 31 31 31 ALA ALA C . n C 1 32 SER 32 32 32 SER SER C . n C 1 33 ILE 33 33 33 ILE ILE C . n C 1 34 PHE 34 34 34 PHE PHE C . n C 1 35 ARG 35 35 35 ARG ARG C . n C 1 36 ALA 36 36 36 ALA ALA C . n C 1 37 LEU 37 37 37 LEU LEU C . n C 1 38 ASN 38 38 38 ASN ASN C . n C 1 39 VAL 39 39 39 VAL VAL C . n C 1 40 GLY 40 40 40 GLY GLY C . n C 1 41 TYR 41 41 41 TYR TYR C . n C 1 42 TYR 42 42 42 TYR TYR C . n C 1 43 ARG 43 43 43 ARG ARG C . n C 1 44 GLN 44 44 44 GLN GLN C . n C 1 45 THR 45 45 45 THR THR C . n C 1 46 PRO 46 46 46 PRO PRO C . n C 1 47 GLY 47 47 47 GLY GLY C . n C 1 48 ARG 48 48 48 ARG ARG C . n C 1 49 GLN 49 49 49 GLN GLN C . n C 1 50 ARG 50 50 50 ARG ARG C . n C 1 51 GLU 51 51 51 GLU GLU C . n C 1 52 LEU 52 52 52 LEU LEU C . n C 1 53 ILE 53 53 53 ILE ILE C . n C 1 54 ALA 54 54 54 ALA ALA C . n C 1 55 GLY 55 55 55 GLY GLY C . n C 1 56 ILE 56 56 56 ILE ILE C . n C 1 57 SER 57 57 57 SER SER C . n C 1 58 GLY 58 58 58 GLY GLY C . n C 1 59 GLY 59 59 59 GLY GLY C . n C 1 60 GLY 60 60 60 GLY GLY C . n C 1 61 SER 61 61 61 SER SER C . n C 1 62 THR 62 62 62 THR THR C . n C 1 63 HIS 63 63 63 HIS HIS C . n C 1 64 TYR 64 64 64 TYR TYR C . n C 1 65 ALA 65 65 65 ALA ALA C . n C 1 66 ASP 66 66 66 ASP ASP C . n C 1 67 PRO 67 67 67 PRO PRO C . n C 1 68 VAL 68 68 68 VAL VAL C . n C 1 69 LYS 69 69 69 LYS LYS C . n C 1 70 GLY 70 70 70 GLY GLY C . n C 1 71 ARG 71 71 71 ARG ARG C . n C 1 72 PHE 72 72 72 PHE PHE C . n C 1 73 THR 73 73 73 THR THR C . n C 1 74 ILE 74 74 74 ILE ILE C . n C 1 75 SER 75 75 75 SER SER C . n C 1 76 ARG 76 76 76 ARG ARG C . n C 1 77 ASP 77 77 77 ASP ASP C . n C 1 78 ASN 78 78 78 ASN ASN C . n C 1 79 ALA 79 79 79 ALA ALA C . n C 1 80 LYS 80 80 80 LYS LYS C . n C 1 81 ASN 81 81 81 ASN ASN C . n C 1 82 ARG 82 82 82 ARG ARG C . n C 1 83 VAL 83 83 83 VAL VAL C . n C 1 84 ASP 84 84 84 ASP ASP C . n C 1 85 LEU 85 85 85 LEU LEU C . n C 1 86 GLN 86 86 86 GLN GLN C . n C 1 87 MET 87 87 87 MET MET C . n C 1 88 ASN 88 88 88 ASN ASN C . n C 1 89 ASN 89 89 89 ASN ASN C . n C 1 90 LEU 90 90 90 LEU LEU C . n C 1 91 LYS 91 91 91 LYS LYS C . n C 1 92 PRO 92 92 92 PRO PRO C . n C 1 93 GLU 93 93 93 GLU GLU C . n C 1 94 ASP 94 94 94 ASP ASP C . n C 1 95 THR 95 95 95 THR THR C . n C 1 96 ALA 96 96 96 ALA ALA C . n C 1 97 VAL 97 97 97 VAL VAL C . n C 1 98 TYR 98 98 98 TYR TYR C . n C 1 99 TYR 99 99 99 TYR TYR C . n C 1 100 CYS 100 100 100 CYS CYS C . n C 1 101 ASN 101 101 101 ASN ASN C . n C 1 102 ALA 102 102 102 ALA ALA C . n C 1 103 GLY 103 103 103 GLY GLY C . n C 1 104 PRO 104 104 104 PRO PRO C . n C 1 105 THR 105 105 105 THR THR C . n C 1 106 LEU 106 106 106 LEU LEU C . n C 1 107 THR 107 107 107 THR THR C . n C 1 108 THR 108 108 108 THR THR C . n C 1 109 GLY 109 109 109 GLY GLY C . n C 1 110 ASP 110 110 110 ASP ASP C . n C 1 111 ALA 111 111 111 ALA ALA C . n C 1 112 GLY 112 112 112 GLY GLY C . n C 1 113 PRO 113 113 113 PRO PRO C . n C 1 114 TYR 114 114 114 TYR TYR C . n C 1 115 TRP 115 115 115 TRP TRP C . n C 1 116 GLY 116 116 116 GLY GLY C . n C 1 117 GLN 117 117 117 GLN GLN C . n C 1 118 GLY 118 118 118 GLY GLY C . n C 1 119 THR 119 119 119 THR THR C . n C 1 120 GLN 120 120 120 GLN GLN C . n C 1 121 VAL 121 121 121 VAL VAL C . n C 1 122 THR 122 122 122 THR THR C . n C 1 123 VAL 123 123 123 VAL VAL C . n C 1 124 SER 124 124 124 SER SER C . n C 1 125 SER 125 125 125 SER SER C . n D 1 1 GLY 1 1 ? ? ? D . n D 1 2 SER 2 2 ? ? ? D . n D 1 3 HIS 3 3 ? ? ? D . n D 1 4 MET 4 4 4 MET MET D . n D 1 5 ALA 5 5 5 ALA ALA D . n D 1 6 GLU 6 6 6 GLU GLU D . n D 1 7 VAL 7 7 7 VAL VAL D . n D 1 8 GLN 8 8 8 GLN GLN D . n D 1 9 LEU 9 9 9 LEU LEU D . n D 1 10 VAL 10 10 10 VAL VAL D . n D 1 11 GLU 11 11 11 GLU GLU D . n D 1 12 SER 12 12 12 SER SER D . n D 1 13 GLY 13 13 13 GLY GLY D . n D 1 14 GLY 14 14 14 GLY GLY D . n D 1 15 GLY 15 15 15 GLY GLY D . n D 1 16 LEU 16 16 16 LEU LEU D . n D 1 17 VAL 17 17 17 VAL VAL D . n D 1 18 GLN 18 18 18 GLN GLN D . n D 1 19 ALA 19 19 19 ALA ALA D . n D 1 20 GLY 20 20 20 GLY GLY D . n D 1 21 GLY 21 21 21 GLY GLY D . n D 1 22 SER 22 22 22 SER SER D . n D 1 23 LEU 23 23 23 LEU LEU D . n D 1 24 ARG 24 24 24 ARG ARG D . n D 1 25 LEU 25 25 25 LEU LEU D . n D 1 26 SER 26 26 26 SER SER D . n D 1 27 CYS 27 27 27 CYS CYS D . n D 1 28 ALA 28 28 28 ALA ALA D . n D 1 29 ALA 29 29 29 ALA ALA D . n D 1 30 SER 30 30 30 SER SER D . n D 1 31 ALA 31 31 31 ALA ALA D . n D 1 32 SER 32 32 32 SER SER D . n D 1 33 ILE 33 33 33 ILE ILE D . n D 1 34 PHE 34 34 34 PHE PHE D . n D 1 35 ARG 35 35 35 ARG ARG D . n D 1 36 ALA 36 36 36 ALA ALA D . n D 1 37 LEU 37 37 37 LEU LEU D . n D 1 38 ASN 38 38 38 ASN ASN D . n D 1 39 VAL 39 39 39 VAL VAL D . n D 1 40 GLY 40 40 40 GLY GLY D . n D 1 41 TYR 41 41 41 TYR TYR D . n D 1 42 TYR 42 42 42 TYR TYR D . n D 1 43 ARG 43 43 43 ARG ARG D . n D 1 44 GLN 44 44 44 GLN GLN D . n D 1 45 THR 45 45 45 THR THR D . n D 1 46 PRO 46 46 46 PRO PRO D . n D 1 47 GLY 47 47 47 GLY GLY D . n D 1 48 ARG 48 48 48 ARG ARG D . n D 1 49 GLN 49 49 49 GLN GLN D . n D 1 50 ARG 50 50 50 ARG ARG D . n D 1 51 GLU 51 51 51 GLU GLU D . n D 1 52 LEU 52 52 52 LEU LEU D . n D 1 53 ILE 53 53 53 ILE ILE D . n D 1 54 ALA 54 54 54 ALA ALA D . n D 1 55 GLY 55 55 55 GLY GLY D . n D 1 56 ILE 56 56 56 ILE ILE D . n D 1 57 SER 57 57 57 SER SER D . n D 1 58 GLY 58 58 58 GLY GLY D . n D 1 59 GLY 59 59 59 GLY GLY D . n D 1 60 GLY 60 60 60 GLY GLY D . n D 1 61 SER 61 61 61 SER SER D . n D 1 62 THR 62 62 62 THR THR D . n D 1 63 HIS 63 63 63 HIS HIS D . n D 1 64 TYR 64 64 64 TYR TYR D . n D 1 65 ALA 65 65 65 ALA ALA D . n D 1 66 ASP 66 66 66 ASP ASP D . n D 1 67 PRO 67 67 67 PRO PRO D . n D 1 68 VAL 68 68 68 VAL VAL D . n D 1 69 LYS 69 69 69 LYS LYS D . n D 1 70 GLY 70 70 70 GLY GLY D . n D 1 71 ARG 71 71 71 ARG ARG D . n D 1 72 PHE 72 72 72 PHE PHE D . n D 1 73 THR 73 73 73 THR THR D . n D 1 74 ILE 74 74 74 ILE ILE D . n D 1 75 SER 75 75 75 SER SER D . n D 1 76 ARG 76 76 76 ARG ARG D . n D 1 77 ASP 77 77 77 ASP ASP D . n D 1 78 ASN 78 78 78 ASN ASN D . n D 1 79 ALA 79 79 79 ALA ALA D . n D 1 80 LYS 80 80 80 LYS LYS D . n D 1 81 ASN 81 81 81 ASN ASN D . n D 1 82 ARG 82 82 82 ARG ARG D . n D 1 83 VAL 83 83 83 VAL VAL D . n D 1 84 ASP 84 84 84 ASP ASP D . n D 1 85 LEU 85 85 85 LEU LEU D . n D 1 86 GLN 86 86 86 GLN GLN D . n D 1 87 MET 87 87 87 MET MET D . n D 1 88 ASN 88 88 88 ASN ASN D . n D 1 89 ASN 89 89 89 ASN ASN D . n D 1 90 LEU 90 90 90 LEU LEU D . n D 1 91 LYS 91 91 91 LYS LYS D . n D 1 92 PRO 92 92 92 PRO PRO D . n D 1 93 GLU 93 93 93 GLU GLU D . n D 1 94 ASP 94 94 94 ASP ASP D . n D 1 95 THR 95 95 95 THR THR D . n D 1 96 ALA 96 96 96 ALA ALA D . n D 1 97 VAL 97 97 97 VAL VAL D . n D 1 98 TYR 98 98 98 TYR TYR D . n D 1 99 TYR 99 99 99 TYR TYR D . n D 1 100 CYS 100 100 100 CYS CYS D . n D 1 101 ASN 101 101 101 ASN ASN D . n D 1 102 ALA 102 102 102 ALA ALA D . n D 1 103 GLY 103 103 103 GLY GLY D . n D 1 104 PRO 104 104 104 PRO PRO D . n D 1 105 THR 105 105 105 THR THR D . n D 1 106 LEU 106 106 106 LEU LEU D . n D 1 107 THR 107 107 107 THR THR D . n D 1 108 THR 108 108 108 THR THR D . n D 1 109 GLY 109 109 109 GLY GLY D . n D 1 110 ASP 110 110 110 ASP ASP D . n D 1 111 ALA 111 111 111 ALA ALA D . n D 1 112 GLY 112 112 112 GLY GLY D . n D 1 113 PRO 113 113 113 PRO PRO D . n D 1 114 TYR 114 114 114 TYR TYR D . n D 1 115 TRP 115 115 115 TRP TRP D . n D 1 116 GLY 116 116 116 GLY GLY D . n D 1 117 GLN 117 117 117 GLN GLN D . n D 1 118 GLY 118 118 118 GLY GLY D . n D 1 119 THR 119 119 119 THR THR D . n D 1 120 GLN 120 120 120 GLN GLN D . n D 1 121 VAL 121 121 121 VAL VAL D . n D 1 122 THR 122 122 122 THR THR D . n D 1 123 VAL 123 123 123 VAL VAL D . n D 1 124 SER 124 124 ? ? ? D . n D 1 125 SER 125 125 ? ? ? D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 2 SO4 1 201 4 SO4 SO4 A . F 2 SO4 1 202 6 SO4 SO4 A . G 2 SO4 1 203 9 SO4 SO4 A . H 2 SO4 1 201 2 SO4 SO4 B . I 2 SO4 1 202 5 SO4 SO4 B . J 2 SO4 1 201 1 SO4 SO4 C . K 2 SO4 1 202 7 SO4 SO4 C . L 3 GOL 1 203 1 GOL GOL C . M 2 SO4 1 201 3 SO4 SO4 D . N 2 SO4 1 202 8 SO4 SO4 D . O 4 HOH 1 301 9 HOH HOH A . O 4 HOH 2 302 2 HOH HOH A . O 4 HOH 3 303 6 HOH HOH A . O 4 HOH 4 304 47 HOH HOH A . O 4 HOH 5 305 20 HOH HOH A . O 4 HOH 6 306 17 HOH HOH A . O 4 HOH 7 307 42 HOH HOH A . O 4 HOH 8 308 48 HOH HOH A . O 4 HOH 9 309 15 HOH HOH A . O 4 HOH 10 310 23 HOH HOH A . O 4 HOH 11 311 40 HOH HOH A . P 4 HOH 1 301 31 HOH HOH B . P 4 HOH 2 302 8 HOH HOH B . P 4 HOH 3 303 34 HOH HOH B . P 4 HOH 4 304 51 HOH HOH B . P 4 HOH 5 305 3 HOH HOH B . P 4 HOH 6 306 46 HOH HOH B . P 4 HOH 7 307 19 HOH HOH B . P 4 HOH 8 308 16 HOH HOH B . P 4 HOH 9 309 13 HOH HOH B . P 4 HOH 10 310 49 HOH HOH B . P 4 HOH 11 311 24 HOH HOH B . P 4 HOH 12 312 21 HOH HOH B . Q 4 HOH 1 301 30 HOH HOH C . Q 4 HOH 2 302 43 HOH HOH C . Q 4 HOH 3 303 1 HOH HOH C . Q 4 HOH 4 304 12 HOH HOH C . Q 4 HOH 5 305 36 HOH HOH C . Q 4 HOH 6 306 10 HOH HOH C . Q 4 HOH 7 307 25 HOH HOH C . Q 4 HOH 8 308 4 HOH HOH C . R 4 HOH 1 301 32 HOH HOH D . R 4 HOH 2 302 38 HOH HOH D . R 4 HOH 3 303 11 HOH HOH D . R 4 HOH 4 304 26 HOH HOH D . R 4 HOH 5 305 18 HOH HOH D . R 4 HOH 6 306 27 HOH HOH D . R 4 HOH 7 307 7 HOH HOH D . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 author_defined_assembly ? monomeric 1 3 author_defined_assembly ? monomeric 1 4 author_defined_assembly ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,E,F,G,O 2 1 B,H,I,P 3 1 C,J,K,L,Q 4 1 D,M,N,R # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-03-25 2 'Structure model' 1 1 2023-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 2 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 4 2 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 5 2 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 6 2 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 7 2 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 8 2 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 9 2 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 10 2 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 13.6113 -19.6504 -18.2260 0.1539 ? 0.0034 ? -0.0943 ? 0.1021 ? -0.0225 ? 0.4551 ? 1.2113 ? -0.5306 ? -0.4245 ? 1.6215 ? -0.3388 ? 0.6353 ? -0.0343 ? -0.0487 ? 0.3453 ? -0.1905 ? 0.0301 ? 0.0725 ? -0.0387 ? 0.0041 ? -0.0110 ? 2 'X-RAY DIFFRACTION' ? refined 17.0262 -49.3594 -18.3948 0.1654 ? 0.0115 ? 0.0387 ? 0.0881 ? -0.0238 ? 0.3304 ? 0.9860 ? 0.1759 ? 0.3692 ? 1.9887 ? -0.5993 ? 1.1651 ? 0.0099 ? -0.0307 ? 0.0249 ? -0.0420 ? 0.0250 ? 0.4379 ? -0.0724 ? -0.0436 ? -0.0117 ? 3 'X-RAY DIFFRACTION' ? refined 43.3756 -16.1532 -17.4686 0.1640 ? 0.0082 ? 0.0180 ? 0.0692 ? 0.0252 ? 0.2675 ? 1.1676 ? 0.6390 ? 0.2377 ? 2.8668 ? 1.4483 ? 2.0403 ? -0.0075 ? 0.0597 ? 0.0551 ? -0.0896 ? 0.0376 ? -0.2345 ? -0.0250 ? 0.0816 ? -0.0197 ? 4 'X-RAY DIFFRACTION' ? refined 46.8803 -45.8695 -18.0496 0.1891 ? -0.0124 ? 0.0298 ? 0.1085 ? 0.0116 ? 0.4292 ? 1.3405 ? -0.4444 ? 0.6924 ? 1.7918 ? -0.3328 ? 1.2692 ? 0.0890 ? 0.0635 ? -0.1755 ? 0.0131 ? -0.1648 ? -0.2447 ? 0.2609 ? 0.0607 ? 0.0285 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 4 ? ? A 124 ? '(chain A and resseq 4:124)' 2 'X-RAY DIFFRACTION' 2 ? ? B 3 ? ? B 125 ? '(chain B and resseq 3:125)' 3 'X-RAY DIFFRACTION' 3 ? ? C 4 ? ? C 125 ? '(chain C and resseq 4:125)' 4 'X-RAY DIFFRACTION' 4 ? ? D 4 ? ? D 123 ? '(chain D and resseq 4:123)' # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14_3260 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 5 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 8 ? CG ? A GLN 8 CG 2 1 Y 1 A GLN 8 ? CD ? A GLN 8 CD 3 1 Y 1 A GLN 8 ? OE1 ? A GLN 8 OE1 4 1 Y 1 A GLN 8 ? NE2 ? A GLN 8 NE2 5 1 Y 1 A GLN 49 ? CG ? A GLN 49 CG 6 1 Y 1 A GLN 49 ? CD ? A GLN 49 CD 7 1 Y 1 A GLN 49 ? OE1 ? A GLN 49 OE1 8 1 Y 1 A GLN 49 ? NE2 ? A GLN 49 NE2 9 1 Y 1 A LYS 69 ? CG ? A LYS 69 CG 10 1 Y 1 A LYS 69 ? CD ? A LYS 69 CD 11 1 Y 1 A LYS 69 ? CE ? A LYS 69 CE 12 1 Y 1 A LYS 69 ? NZ ? A LYS 69 NZ 13 1 Y 1 A LYS 80 ? CG ? A LYS 80 CG 14 1 Y 1 A LYS 80 ? CD ? A LYS 80 CD 15 1 Y 1 A LYS 80 ? CE ? A LYS 80 CE 16 1 Y 1 A LYS 80 ? NZ ? A LYS 80 NZ 17 1 Y 1 A GLN 117 ? CG ? A GLN 117 CG 18 1 Y 1 A GLN 117 ? CD ? A GLN 117 CD 19 1 Y 1 A GLN 117 ? OE1 ? A GLN 117 OE1 20 1 Y 1 A GLN 117 ? NE2 ? A GLN 117 NE2 21 1 Y 1 B HIS 3 ? CG ? B HIS 3 CG 22 1 Y 1 B HIS 3 ? ND1 ? B HIS 3 ND1 23 1 Y 1 B HIS 3 ? CD2 ? B HIS 3 CD2 24 1 Y 1 B HIS 3 ? CE1 ? B HIS 3 CE1 25 1 Y 1 B HIS 3 ? NE2 ? B HIS 3 NE2 26 1 Y 1 B GLU 6 ? CG ? B GLU 6 CG 27 1 Y 1 B GLU 6 ? CD ? B GLU 6 CD 28 1 Y 1 B GLU 6 ? OE1 ? B GLU 6 OE1 29 1 Y 1 B GLU 6 ? OE2 ? B GLU 6 OE2 30 1 Y 1 B THR 45 ? OG1 ? B THR 45 OG1 31 1 Y 1 B THR 45 ? CG2 ? B THR 45 CG2 32 1 Y 1 B GLN 49 ? CG ? B GLN 49 CG 33 1 Y 1 B GLN 49 ? CD ? B GLN 49 CD 34 1 Y 1 B GLN 49 ? OE1 ? B GLN 49 OE1 35 1 Y 1 B GLN 49 ? NE2 ? B GLN 49 NE2 36 1 Y 1 B LYS 80 ? CG ? B LYS 80 CG 37 1 Y 1 B LYS 80 ? CD ? B LYS 80 CD 38 1 Y 1 B LYS 80 ? CE ? B LYS 80 CE 39 1 Y 1 B LYS 80 ? NZ ? B LYS 80 NZ 40 1 Y 1 B GLU 93 ? CG ? B GLU 93 CG 41 1 Y 1 B GLU 93 ? CD ? B GLU 93 CD 42 1 Y 1 B GLU 93 ? OE1 ? B GLU 93 OE1 43 1 Y 1 B GLU 93 ? OE2 ? B GLU 93 OE2 44 1 Y 1 B GLN 117 ? CG ? B GLN 117 CG 45 1 Y 1 B GLN 117 ? CD ? B GLN 117 CD 46 1 Y 1 B GLN 117 ? OE1 ? B GLN 117 OE1 47 1 Y 1 B GLN 117 ? NE2 ? B GLN 117 NE2 48 1 Y 1 C GLU 6 ? CG ? C GLU 6 CG 49 1 Y 1 C GLU 6 ? CD ? C GLU 6 CD 50 1 Y 1 C GLU 6 ? OE1 ? C GLU 6 OE1 51 1 Y 1 C GLU 6 ? OE2 ? C GLU 6 OE2 52 1 Y 1 C GLN 8 ? CG ? C GLN 8 CG 53 1 Y 1 C GLN 8 ? CD ? C GLN 8 CD 54 1 Y 1 C GLN 8 ? OE1 ? C GLN 8 OE1 55 1 Y 1 C GLN 8 ? NE2 ? C GLN 8 NE2 56 1 Y 1 C LYS 80 ? CG ? C LYS 80 CG 57 1 Y 1 C LYS 80 ? CD ? C LYS 80 CD 58 1 Y 1 C LYS 80 ? CE ? C LYS 80 CE 59 1 Y 1 C LYS 80 ? NZ ? C LYS 80 NZ 60 1 Y 1 C GLN 117 ? CG ? C GLN 117 CG 61 1 Y 1 C GLN 117 ? CD ? C GLN 117 CD 62 1 Y 1 C GLN 117 ? OE1 ? C GLN 117 OE1 63 1 Y 1 C GLN 117 ? NE2 ? C GLN 117 NE2 64 1 Y 1 D GLU 6 ? CG ? D GLU 6 CG 65 1 Y 1 D GLU 6 ? CD ? D GLU 6 CD 66 1 Y 1 D GLU 6 ? OE1 ? D GLU 6 OE1 67 1 Y 1 D GLU 6 ? OE2 ? D GLU 6 OE2 68 1 Y 1 D GLN 8 ? CG ? D GLN 8 CG 69 1 Y 1 D GLN 8 ? CD ? D GLN 8 CD 70 1 Y 1 D GLN 8 ? OE1 ? D GLN 8 OE1 71 1 Y 1 D GLN 8 ? NE2 ? D GLN 8 NE2 72 1 Y 1 D GLU 51 ? CG ? D GLU 51 CG 73 1 Y 1 D GLU 51 ? CD ? D GLU 51 CD 74 1 Y 1 D GLU 51 ? OE1 ? D GLU 51 OE1 75 1 Y 1 D GLU 51 ? OE2 ? D GLU 51 OE2 76 1 Y 1 D LYS 80 ? CG ? D LYS 80 CG 77 1 Y 1 D LYS 80 ? CD ? D LYS 80 CD 78 1 Y 1 D LYS 80 ? CE ? D LYS 80 CE 79 1 Y 1 D LYS 80 ? NZ ? D LYS 80 NZ 80 1 Y 1 D GLN 117 ? CG ? D GLN 117 CG 81 1 Y 1 D GLN 117 ? CD ? D GLN 117 CD 82 1 Y 1 D GLN 117 ? OE1 ? D GLN 117 OE1 83 1 Y 1 D GLN 117 ? NE2 ? D GLN 117 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A HIS 3 ? A HIS 3 4 1 Y 1 A SER 125 ? A SER 125 5 1 Y 1 B GLY 1 ? B GLY 1 6 1 Y 1 B SER 2 ? B SER 2 7 1 Y 1 C GLY 1 ? C GLY 1 8 1 Y 1 C SER 2 ? C SER 2 9 1 Y 1 C HIS 3 ? C HIS 3 10 1 Y 1 D GLY 1 ? D GLY 1 11 1 Y 1 D SER 2 ? D SER 2 12 1 Y 1 D HIS 3 ? D HIS 3 13 1 Y 1 D SER 124 ? D SER 124 14 1 Y 1 D SER 125 ? D SER 125 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 GOL C1 C N N 137 GOL O1 O N N 138 GOL C2 C N N 139 GOL O2 O N N 140 GOL C3 C N N 141 GOL O3 O N N 142 GOL H11 H N N 143 GOL H12 H N N 144 GOL HO1 H N N 145 GOL H2 H N N 146 GOL HO2 H N N 147 GOL H31 H N N 148 GOL H32 H N N 149 GOL HO3 H N N 150 HIS N N N N 151 HIS CA C N S 152 HIS C C N N 153 HIS O O N N 154 HIS CB C N N 155 HIS CG C Y N 156 HIS ND1 N Y N 157 HIS CD2 C Y N 158 HIS CE1 C Y N 159 HIS NE2 N Y N 160 HIS OXT O N N 161 HIS H H N N 162 HIS H2 H N N 163 HIS HA H N N 164 HIS HB2 H N N 165 HIS HB3 H N N 166 HIS HD1 H N N 167 HIS HD2 H N N 168 HIS HE1 H N N 169 HIS HE2 H N N 170 HIS HXT H N N 171 HOH O O N N 172 HOH H1 H N N 173 HOH H2 H N N 174 ILE N N N N 175 ILE CA C N S 176 ILE C C N N 177 ILE O O N N 178 ILE CB C N S 179 ILE CG1 C N N 180 ILE CG2 C N N 181 ILE CD1 C N N 182 ILE OXT O N N 183 ILE H H N N 184 ILE H2 H N N 185 ILE HA H N N 186 ILE HB H N N 187 ILE HG12 H N N 188 ILE HG13 H N N 189 ILE HG21 H N N 190 ILE HG22 H N N 191 ILE HG23 H N N 192 ILE HD11 H N N 193 ILE HD12 H N N 194 ILE HD13 H N N 195 ILE HXT H N N 196 LEU N N N N 197 LEU CA C N S 198 LEU C C N N 199 LEU O O N N 200 LEU CB C N N 201 LEU CG C N N 202 LEU CD1 C N N 203 LEU CD2 C N N 204 LEU OXT O N N 205 LEU H H N N 206 LEU H2 H N N 207 LEU HA H N N 208 LEU HB2 H N N 209 LEU HB3 H N N 210 LEU HG H N N 211 LEU HD11 H N N 212 LEU HD12 H N N 213 LEU HD13 H N N 214 LEU HD21 H N N 215 LEU HD22 H N N 216 LEU HD23 H N N 217 LEU HXT H N N 218 LYS N N N N 219 LYS CA C N S 220 LYS C C N N 221 LYS O O N N 222 LYS CB C N N 223 LYS CG C N N 224 LYS CD C N N 225 LYS CE C N N 226 LYS NZ N N N 227 LYS OXT O N N 228 LYS H H N N 229 LYS H2 H N N 230 LYS HA H N N 231 LYS HB2 H N N 232 LYS HB3 H N N 233 LYS HG2 H N N 234 LYS HG3 H N N 235 LYS HD2 H N N 236 LYS HD3 H N N 237 LYS HE2 H N N 238 LYS HE3 H N N 239 LYS HZ1 H N N 240 LYS HZ2 H N N 241 LYS HZ3 H N N 242 LYS HXT H N N 243 MET N N N N 244 MET CA C N S 245 MET C C N N 246 MET O O N N 247 MET CB C N N 248 MET CG C N N 249 MET SD S N N 250 MET CE C N N 251 MET OXT O N N 252 MET H H N N 253 MET H2 H N N 254 MET HA H N N 255 MET HB2 H N N 256 MET HB3 H N N 257 MET HG2 H N N 258 MET HG3 H N N 259 MET HE1 H N N 260 MET HE2 H N N 261 MET HE3 H N N 262 MET HXT H N N 263 PHE N N N N 264 PHE CA C N S 265 PHE C C N N 266 PHE O O N N 267 PHE CB C N N 268 PHE CG C Y N 269 PHE CD1 C Y N 270 PHE CD2 C Y N 271 PHE CE1 C Y N 272 PHE CE2 C Y N 273 PHE CZ C Y N 274 PHE OXT O N N 275 PHE H H N N 276 PHE H2 H N N 277 PHE HA H N N 278 PHE HB2 H N N 279 PHE HB3 H N N 280 PHE HD1 H N N 281 PHE HD2 H N N 282 PHE HE1 H N N 283 PHE HE2 H N N 284 PHE HZ H N N 285 PHE HXT H N N 286 PRO N N N N 287 PRO CA C N S 288 PRO C C N N 289 PRO O O N N 290 PRO CB C N N 291 PRO CG C N N 292 PRO CD C N N 293 PRO OXT O N N 294 PRO H H N N 295 PRO HA H N N 296 PRO HB2 H N N 297 PRO HB3 H N N 298 PRO HG2 H N N 299 PRO HG3 H N N 300 PRO HD2 H N N 301 PRO HD3 H N N 302 PRO HXT H N N 303 SER N N N N 304 SER CA C N S 305 SER C C N N 306 SER O O N N 307 SER CB C N N 308 SER OG O N N 309 SER OXT O N N 310 SER H H N N 311 SER H2 H N N 312 SER HA H N N 313 SER HB2 H N N 314 SER HB3 H N N 315 SER HG H N N 316 SER HXT H N N 317 SO4 S S N N 318 SO4 O1 O N N 319 SO4 O2 O N N 320 SO4 O3 O N N 321 SO4 O4 O N N 322 THR N N N N 323 THR CA C N S 324 THR C C N N 325 THR O O N N 326 THR CB C N R 327 THR OG1 O N N 328 THR CG2 C N N 329 THR OXT O N N 330 THR H H N N 331 THR H2 H N N 332 THR HA H N N 333 THR HB H N N 334 THR HG1 H N N 335 THR HG21 H N N 336 THR HG22 H N N 337 THR HG23 H N N 338 THR HXT H N N 339 TRP N N N N 340 TRP CA C N S 341 TRP C C N N 342 TRP O O N N 343 TRP CB C N N 344 TRP CG C Y N 345 TRP CD1 C Y N 346 TRP CD2 C Y N 347 TRP NE1 N Y N 348 TRP CE2 C Y N 349 TRP CE3 C Y N 350 TRP CZ2 C Y N 351 TRP CZ3 C Y N 352 TRP CH2 C Y N 353 TRP OXT O N N 354 TRP H H N N 355 TRP H2 H N N 356 TRP HA H N N 357 TRP HB2 H N N 358 TRP HB3 H N N 359 TRP HD1 H N N 360 TRP HE1 H N N 361 TRP HE3 H N N 362 TRP HZ2 H N N 363 TRP HZ3 H N N 364 TRP HH2 H N N 365 TRP HXT H N N 366 TYR N N N N 367 TYR CA C N S 368 TYR C C N N 369 TYR O O N N 370 TYR CB C N N 371 TYR CG C Y N 372 TYR CD1 C Y N 373 TYR CD2 C Y N 374 TYR CE1 C Y N 375 TYR CE2 C Y N 376 TYR CZ C Y N 377 TYR OH O N N 378 TYR OXT O N N 379 TYR H H N N 380 TYR H2 H N N 381 TYR HA H N N 382 TYR HB2 H N N 383 TYR HB3 H N N 384 TYR HD1 H N N 385 TYR HD2 H N N 386 TYR HE1 H N N 387 TYR HE2 H N N 388 TYR HH H N N 389 TYR HXT H N N 390 VAL N N N N 391 VAL CA C N S 392 VAL C C N N 393 VAL O O N N 394 VAL CB C N N 395 VAL CG1 C N N 396 VAL CG2 C N N 397 VAL OXT O N N 398 VAL H H N N 399 VAL H2 H N N 400 VAL HA H N N 401 VAL HB H N N 402 VAL HG11 H N N 403 VAL HG12 H N N 404 VAL HG13 H N N 405 VAL HG21 H N N 406 VAL HG22 H N N 407 VAL HG23 H N N 408 VAL HXT H N N 409 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 GOL C1 O1 sing N N 129 GOL C1 C2 sing N N 130 GOL C1 H11 sing N N 131 GOL C1 H12 sing N N 132 GOL O1 HO1 sing N N 133 GOL C2 O2 sing N N 134 GOL C2 C3 sing N N 135 GOL C2 H2 sing N N 136 GOL O2 HO2 sing N N 137 GOL C3 O3 sing N N 138 GOL C3 H31 sing N N 139 GOL C3 H32 sing N N 140 GOL O3 HO3 sing N N 141 HIS N CA sing N N 142 HIS N H sing N N 143 HIS N H2 sing N N 144 HIS CA C sing N N 145 HIS CA CB sing N N 146 HIS CA HA sing N N 147 HIS C O doub N N 148 HIS C OXT sing N N 149 HIS CB CG sing N N 150 HIS CB HB2 sing N N 151 HIS CB HB3 sing N N 152 HIS CG ND1 sing Y N 153 HIS CG CD2 doub Y N 154 HIS ND1 CE1 doub Y N 155 HIS ND1 HD1 sing N N 156 HIS CD2 NE2 sing Y N 157 HIS CD2 HD2 sing N N 158 HIS CE1 NE2 sing Y N 159 HIS CE1 HE1 sing N N 160 HIS NE2 HE2 sing N N 161 HIS OXT HXT sing N N 162 HOH O H1 sing N N 163 HOH O H2 sing N N 164 ILE N CA sing N N 165 ILE N H sing N N 166 ILE N H2 sing N N 167 ILE CA C sing N N 168 ILE CA CB sing N N 169 ILE CA HA sing N N 170 ILE C O doub N N 171 ILE C OXT sing N N 172 ILE CB CG1 sing N N 173 ILE CB CG2 sing N N 174 ILE CB HB sing N N 175 ILE CG1 CD1 sing N N 176 ILE CG1 HG12 sing N N 177 ILE CG1 HG13 sing N N 178 ILE CG2 HG21 sing N N 179 ILE CG2 HG22 sing N N 180 ILE CG2 HG23 sing N N 181 ILE CD1 HD11 sing N N 182 ILE CD1 HD12 sing N N 183 ILE CD1 HD13 sing N N 184 ILE OXT HXT sing N N 185 LEU N CA sing N N 186 LEU N H sing N N 187 LEU N H2 sing N N 188 LEU CA C sing N N 189 LEU CA CB sing N N 190 LEU CA HA sing N N 191 LEU C O doub N N 192 LEU C OXT sing N N 193 LEU CB CG sing N N 194 LEU CB HB2 sing N N 195 LEU CB HB3 sing N N 196 LEU CG CD1 sing N N 197 LEU CG CD2 sing N N 198 LEU CG HG sing N N 199 LEU CD1 HD11 sing N N 200 LEU CD1 HD12 sing N N 201 LEU CD1 HD13 sing N N 202 LEU CD2 HD21 sing N N 203 LEU CD2 HD22 sing N N 204 LEU CD2 HD23 sing N N 205 LEU OXT HXT sing N N 206 LYS N CA sing N N 207 LYS N H sing N N 208 LYS N H2 sing N N 209 LYS CA C sing N N 210 LYS CA CB sing N N 211 LYS CA HA sing N N 212 LYS C O doub N N 213 LYS C OXT sing N N 214 LYS CB CG sing N N 215 LYS CB HB2 sing N N 216 LYS CB HB3 sing N N 217 LYS CG CD sing N N 218 LYS CG HG2 sing N N 219 LYS CG HG3 sing N N 220 LYS CD CE sing N N 221 LYS CD HD2 sing N N 222 LYS CD HD3 sing N N 223 LYS CE NZ sing N N 224 LYS CE HE2 sing N N 225 LYS CE HE3 sing N N 226 LYS NZ HZ1 sing N N 227 LYS NZ HZ2 sing N N 228 LYS NZ HZ3 sing N N 229 LYS OXT HXT sing N N 230 MET N CA sing N N 231 MET N H sing N N 232 MET N H2 sing N N 233 MET CA C sing N N 234 MET CA CB sing N N 235 MET CA HA sing N N 236 MET C O doub N N 237 MET C OXT sing N N 238 MET CB CG sing N N 239 MET CB HB2 sing N N 240 MET CB HB3 sing N N 241 MET CG SD sing N N 242 MET CG HG2 sing N N 243 MET CG HG3 sing N N 244 MET SD CE sing N N 245 MET CE HE1 sing N N 246 MET CE HE2 sing N N 247 MET CE HE3 sing N N 248 MET OXT HXT sing N N 249 PHE N CA sing N N 250 PHE N H sing N N 251 PHE N H2 sing N N 252 PHE CA C sing N N 253 PHE CA CB sing N N 254 PHE CA HA sing N N 255 PHE C O doub N N 256 PHE C OXT sing N N 257 PHE CB CG sing N N 258 PHE CB HB2 sing N N 259 PHE CB HB3 sing N N 260 PHE CG CD1 doub Y N 261 PHE CG CD2 sing Y N 262 PHE CD1 CE1 sing Y N 263 PHE CD1 HD1 sing N N 264 PHE CD2 CE2 doub Y N 265 PHE CD2 HD2 sing N N 266 PHE CE1 CZ doub Y N 267 PHE CE1 HE1 sing N N 268 PHE CE2 CZ sing Y N 269 PHE CE2 HE2 sing N N 270 PHE CZ HZ sing N N 271 PHE OXT HXT sing N N 272 PRO N CA sing N N 273 PRO N CD sing N N 274 PRO N H sing N N 275 PRO CA C sing N N 276 PRO CA CB sing N N 277 PRO CA HA sing N N 278 PRO C O doub N N 279 PRO C OXT sing N N 280 PRO CB CG sing N N 281 PRO CB HB2 sing N N 282 PRO CB HB3 sing N N 283 PRO CG CD sing N N 284 PRO CG HG2 sing N N 285 PRO CG HG3 sing N N 286 PRO CD HD2 sing N N 287 PRO CD HD3 sing N N 288 PRO OXT HXT sing N N 289 SER N CA sing N N 290 SER N H sing N N 291 SER N H2 sing N N 292 SER CA C sing N N 293 SER CA CB sing N N 294 SER CA HA sing N N 295 SER C O doub N N 296 SER C OXT sing N N 297 SER CB OG sing N N 298 SER CB HB2 sing N N 299 SER CB HB3 sing N N 300 SER OG HG sing N N 301 SER OXT HXT sing N N 302 SO4 S O1 doub N N 303 SO4 S O2 doub N N 304 SO4 S O3 sing N N 305 SO4 S O4 sing N N 306 THR N CA sing N N 307 THR N H sing N N 308 THR N H2 sing N N 309 THR CA C sing N N 310 THR CA CB sing N N 311 THR CA HA sing N N 312 THR C O doub N N 313 THR C OXT sing N N 314 THR CB OG1 sing N N 315 THR CB CG2 sing N N 316 THR CB HB sing N N 317 THR OG1 HG1 sing N N 318 THR CG2 HG21 sing N N 319 THR CG2 HG22 sing N N 320 THR CG2 HG23 sing N N 321 THR OXT HXT sing N N 322 TRP N CA sing N N 323 TRP N H sing N N 324 TRP N H2 sing N N 325 TRP CA C sing N N 326 TRP CA CB sing N N 327 TRP CA HA sing N N 328 TRP C O doub N N 329 TRP C OXT sing N N 330 TRP CB CG sing N N 331 TRP CB HB2 sing N N 332 TRP CB HB3 sing N N 333 TRP CG CD1 doub Y N 334 TRP CG CD2 sing Y N 335 TRP CD1 NE1 sing Y N 336 TRP CD1 HD1 sing N N 337 TRP CD2 CE2 doub Y N 338 TRP CD2 CE3 sing Y N 339 TRP NE1 CE2 sing Y N 340 TRP NE1 HE1 sing N N 341 TRP CE2 CZ2 sing Y N 342 TRP CE3 CZ3 doub Y N 343 TRP CE3 HE3 sing N N 344 TRP CZ2 CH2 doub Y N 345 TRP CZ2 HZ2 sing N N 346 TRP CZ3 CH2 sing Y N 347 TRP CZ3 HZ3 sing N N 348 TRP CH2 HH2 sing N N 349 TRP OXT HXT sing N N 350 TYR N CA sing N N 351 TYR N H sing N N 352 TYR N H2 sing N N 353 TYR CA C sing N N 354 TYR CA CB sing N N 355 TYR CA HA sing N N 356 TYR C O doub N N 357 TYR C OXT sing N N 358 TYR CB CG sing N N 359 TYR CB HB2 sing N N 360 TYR CB HB3 sing N N 361 TYR CG CD1 doub Y N 362 TYR CG CD2 sing Y N 363 TYR CD1 CE1 sing Y N 364 TYR CD1 HD1 sing N N 365 TYR CD2 CE2 doub Y N 366 TYR CD2 HD2 sing N N 367 TYR CE1 CZ doub Y N 368 TYR CE1 HE1 sing N N 369 TYR CE2 CZ sing Y N 370 TYR CE2 HE2 sing N N 371 TYR CZ OH sing N N 372 TYR OH HH sing N N 373 TYR OXT HXT sing N N 374 VAL N CA sing N N 375 VAL N H sing N N 376 VAL N H2 sing N N 377 VAL CA C sing N N 378 VAL CA CB sing N N 379 VAL CA HA sing N N 380 VAL C O doub N N 381 VAL C OXT sing N N 382 VAL CB CG1 sing N N 383 VAL CB CG2 sing N N 384 VAL CB HB sing N N 385 VAL CG1 HG11 sing N N 386 VAL CG1 HG12 sing N N 387 VAL CG1 HG13 sing N N 388 VAL CG2 HG21 sing N N 389 VAL CG2 HG22 sing N N 390 VAL CG2 HG23 sing N N 391 VAL OXT HXT sing N N 392 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 GLYCEROL GOL 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4XT1 _pdbx_initial_refinement_model.details 'PDB entry 4XT1' # _pdbx_reflns_twin.domain_id 1 _pdbx_reflns_twin.crystal_id 1 _pdbx_reflns_twin.diffrn_id 1 _pdbx_reflns_twin.fraction 0.480 _pdbx_reflns_twin.operator -k,h,l _pdbx_reflns_twin.type ? _pdbx_reflns_twin.mean_F_square_over_mean_F2 ? _pdbx_reflns_twin.mean_I2_over_mean_I_square ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #