data_6ODD # _entry.id 6ODD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6ODD pdb_00006odd 10.2210/pdb6odd/pdb WWPDB D_1000240430 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-11-27 2 'Structure model' 1 1 2019-12-04 3 'Structure model' 1 2 2023-10-11 4 'Structure model' 1 3 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model 7 3 'Structure model' pdbx_struct_conn_angle 8 3 'Structure model' struct_conn 9 4 'Structure model' pdbx_entry_details 10 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' 5 3 'Structure model' '_database_2.pdbx_DOI' 6 3 'Structure model' '_database_2.pdbx_database_accession' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 17 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 18 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 19 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 20 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 21 3 'Structure model' '_pdbx_struct_conn_angle.value' 22 3 'Structure model' '_struct_conn.pdbx_dist_value' 23 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 24 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 25 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 26 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 27 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 28 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 29 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 30 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 31 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 32 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 33 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 34 3 'Structure model' '_struct_conn.ptnr2_symmetry' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6ODD _pdbx_database_status.recvd_initial_deposition_date 2019-03-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Herrera, M.G.' 1 ? 'Noguera, M.E.' 2 ? 'Klinke, S.' 3 ? 'Santos, J.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 0006-2960 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 58 _citation.language ? _citation.page_first 4596 _citation.page_last 4609 _citation.title 'Structure of the Human ACP-ISD11 Heterodimer.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.9b00539 _citation.pdbx_database_id_PubMed 31664822 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Herrera, M.G.' 1 ? primary 'Noguera, M.E.' 2 ? primary 'Sewell, K.E.' 3 ? primary 'Agudelo Suarez, W.A.' 4 ? primary 'Capece, L.' 5 ? primary 'Klinke, S.' 6 ? primary 'Santos, J.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Acyl carrier protein, mitochondrial' 9845.247 1 ? ? ? ? 2 polymer man 'LYR motif-containing protein 4' 8833.209 1 ? ? ? ? 3 non-polymer syn 'S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate' 540.651 1 ? ? ? ? 4 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 5 water nat water 18.015 29 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ACP,CI-SDAP,NADH-ubiquinone oxidoreductase 9.6 kDa subunit' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;PPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADK KDVYE ; ;PPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADK KDVYE ; A ? 2 'polypeptide(L)' no no SRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYST SRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYST B ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate' 8Q1 4 'CALCIUM ION' CA 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 PRO n 1 3 LEU n 1 4 THR n 1 5 LEU n 1 6 GLU n 1 7 GLY n 1 8 ILE n 1 9 GLN n 1 10 ASP n 1 11 ARG n 1 12 VAL n 1 13 LEU n 1 14 TYR n 1 15 VAL n 1 16 LEU n 1 17 LYS n 1 18 LEU n 1 19 TYR n 1 20 ASP n 1 21 LYS n 1 22 ILE n 1 23 ASP n 1 24 PRO n 1 25 GLU n 1 26 LYS n 1 27 LEU n 1 28 SER n 1 29 VAL n 1 30 ASN n 1 31 SER n 1 32 HIS n 1 33 PHE n 1 34 MET n 1 35 LYS n 1 36 ASP n 1 37 LEU n 1 38 GLY n 1 39 LEU n 1 40 ASP n 1 41 SER n 1 42 LEU n 1 43 ASP n 1 44 GLN n 1 45 VAL n 1 46 GLU n 1 47 ILE n 1 48 ILE n 1 49 MET n 1 50 ALA n 1 51 MET n 1 52 GLU n 1 53 ASP n 1 54 GLU n 1 55 PHE n 1 56 GLY n 1 57 PHE n 1 58 GLU n 1 59 ILE n 1 60 PRO n 1 61 ASP n 1 62 ILE n 1 63 ASP n 1 64 ALA n 1 65 GLU n 1 66 LYS n 1 67 LEU n 1 68 MET n 1 69 CYS n 1 70 PRO n 1 71 GLN n 1 72 GLU n 1 73 ILE n 1 74 VAL n 1 75 ASP n 1 76 TYR n 1 77 ILE n 1 78 ALA n 1 79 ASP n 1 80 LYS n 1 81 LYS n 1 82 ASP n 1 83 VAL n 1 84 TYR n 1 85 GLU n 2 1 SER n 2 2 ARG n 2 3 ALA n 2 4 GLN n 2 5 VAL n 2 6 LEU n 2 7 SER n 2 8 LEU n 2 9 TYR n 2 10 ARG n 2 11 ALA n 2 12 MET n 2 13 LEU n 2 14 ARG n 2 15 GLU n 2 16 SER n 2 17 LYS n 2 18 ARG n 2 19 PHE n 2 20 SER n 2 21 ALA n 2 22 TYR n 2 23 ASN n 2 24 TYR n 2 25 ARG n 2 26 THR n 2 27 TYR n 2 28 ALA n 2 29 VAL n 2 30 ARG n 2 31 ARG n 2 32 ILE n 2 33 ARG n 2 34 ASP n 2 35 ALA n 2 36 PHE n 2 37 ARG n 2 38 GLU n 2 39 ASN n 2 40 LYS n 2 41 ASN n 2 42 VAL n 2 43 LYS n 2 44 ASP n 2 45 PRO n 2 46 VAL n 2 47 GLU n 2 48 ILE n 2 49 GLN n 2 50 THR n 2 51 LEU n 2 52 VAL n 2 53 ASN n 2 54 LYS n 2 55 ALA n 2 56 LYS n 2 57 ARG n 2 58 ASP n 2 59 LEU n 2 60 GLY n 2 61 VAL n 2 62 ILE n 2 63 ARG n 2 64 ARG n 2 65 GLN n 2 66 VAL n 2 67 HIS n 2 68 ILE n 2 69 GLY n 2 70 GLN n 2 71 LEU n 2 72 TYR n 2 73 SER n 2 74 THR n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 85 Human ? NDUFAB1 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 74 Human ? 'LYRM4, C6orf149, ISD11, CGI-203' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 8Q1 non-polymer . 'S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate' "S-dodecanoyl-4'-phosphopantetheine" 'C23 H45 N2 O8 P S' 540.651 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 5 5 PRO PRO A . n A 1 2 PRO 2 6 6 PRO PRO A . n A 1 3 LEU 3 7 7 LEU LEU A . n A 1 4 THR 4 8 8 THR THR A . n A 1 5 LEU 5 9 9 LEU LEU A . n A 1 6 GLU 6 10 10 GLU GLU A . n A 1 7 GLY 7 11 11 GLY GLY A . n A 1 8 ILE 8 12 12 ILE ILE A . n A 1 9 GLN 9 13 13 GLN GLN A . n A 1 10 ASP 10 14 14 ASP ASP A . n A 1 11 ARG 11 15 15 ARG ARG A . n A 1 12 VAL 12 16 16 VAL VAL A . n A 1 13 LEU 13 17 17 LEU LEU A . n A 1 14 TYR 14 18 18 TYR TYR A . n A 1 15 VAL 15 19 19 VAL VAL A . n A 1 16 LEU 16 20 20 LEU LEU A . n A 1 17 LYS 17 21 21 LYS LYS A . n A 1 18 LEU 18 22 22 LEU LEU A . n A 1 19 TYR 19 23 23 TYR TYR A . n A 1 20 ASP 20 24 24 ASP ASP A . n A 1 21 LYS 21 25 25 LYS LYS A . n A 1 22 ILE 22 26 26 ILE ILE A . n A 1 23 ASP 23 27 27 ASP ASP A . n A 1 24 PRO 24 28 28 PRO PRO A . n A 1 25 GLU 25 29 29 GLU GLU A . n A 1 26 LYS 26 30 30 LYS LYS A . n A 1 27 LEU 27 31 31 LEU LEU A . n A 1 28 SER 28 32 32 SER SER A . n A 1 29 VAL 29 33 33 VAL VAL A . n A 1 30 ASN 30 34 34 ASN ASN A . n A 1 31 SER 31 35 35 SER SER A . n A 1 32 HIS 32 36 36 HIS HIS A . n A 1 33 PHE 33 37 37 PHE PHE A . n A 1 34 MET 34 38 38 MET MET A . n A 1 35 LYS 35 39 39 LYS LYS A . n A 1 36 ASP 36 40 40 ASP ASP A . n A 1 37 LEU 37 41 41 LEU LEU A . n A 1 38 GLY 38 42 42 GLY GLY A . n A 1 39 LEU 39 43 43 LEU LEU A . n A 1 40 ASP 40 44 44 ASP ASP A . n A 1 41 SER 41 45 45 SER SER A . n A 1 42 LEU 42 46 46 LEU LEU A . n A 1 43 ASP 43 47 47 ASP ASP A . n A 1 44 GLN 44 48 48 GLN GLN A . n A 1 45 VAL 45 49 49 VAL VAL A . n A 1 46 GLU 46 50 50 GLU GLU A . n A 1 47 ILE 47 51 51 ILE ILE A . n A 1 48 ILE 48 52 52 ILE ILE A . n A 1 49 MET 49 53 53 MET MET A . n A 1 50 ALA 50 54 54 ALA ALA A . n A 1 51 MET 51 55 55 MET MET A . n A 1 52 GLU 52 56 56 GLU GLU A . n A 1 53 ASP 53 57 57 ASP ASP A . n A 1 54 GLU 54 58 58 GLU GLU A . n A 1 55 PHE 55 59 59 PHE PHE A . n A 1 56 GLY 56 60 60 GLY GLY A . n A 1 57 PHE 57 61 61 PHE PHE A . n A 1 58 GLU 58 62 62 GLU GLU A . n A 1 59 ILE 59 63 63 ILE ILE A . n A 1 60 PRO 60 64 64 PRO PRO A . n A 1 61 ASP 61 65 65 ASP ASP A . n A 1 62 ILE 62 66 66 ILE ILE A . n A 1 63 ASP 63 67 67 ASP ASP A . n A 1 64 ALA 64 68 68 ALA ALA A . n A 1 65 GLU 65 69 69 GLU GLU A . n A 1 66 LYS 66 70 70 LYS LYS A . n A 1 67 LEU 67 71 71 LEU LEU A . n A 1 68 MET 68 72 72 MET MET A . n A 1 69 CYS 69 73 73 CYS CYS A . n A 1 70 PRO 70 74 74 PRO PRO A . n A 1 71 GLN 71 75 75 GLN GLN A . n A 1 72 GLU 72 76 76 GLU GLU A . n A 1 73 ILE 73 77 77 ILE ILE A . n A 1 74 VAL 74 78 78 VAL VAL A . n A 1 75 ASP 75 79 79 ASP ASP A . n A 1 76 TYR 76 80 80 TYR TYR A . n A 1 77 ILE 77 81 81 ILE ILE A . n A 1 78 ALA 78 82 82 ALA ALA A . n A 1 79 ASP 79 83 83 ASP ASP A . n A 1 80 LYS 80 84 84 LYS LYS A . n A 1 81 LYS 81 85 85 LYS LYS A . n A 1 82 ASP 82 86 86 ASP ASP A . n A 1 83 VAL 83 87 87 VAL VAL A . n A 1 84 TYR 84 88 88 TYR TYR A . n A 1 85 GLU 85 89 89 GLU GLU A . n B 2 1 SER 1 18 18 SER SER B . n B 2 2 ARG 2 19 19 ARG ARG B . n B 2 3 ALA 3 20 20 ALA ALA B . n B 2 4 GLN 4 21 21 GLN GLN B . n B 2 5 VAL 5 22 22 VAL VAL B . n B 2 6 LEU 6 23 23 LEU LEU B . n B 2 7 SER 7 24 24 SER SER B . n B 2 8 LEU 8 25 25 LEU LEU B . n B 2 9 TYR 9 26 26 TYR TYR B . n B 2 10 ARG 10 27 27 ARG ARG B . n B 2 11 ALA 11 28 28 ALA ALA B . n B 2 12 MET 12 29 29 MET MET B . n B 2 13 LEU 13 30 30 LEU LEU B . n B 2 14 ARG 14 31 31 ARG ARG B . n B 2 15 GLU 15 32 32 GLU GLU B . n B 2 16 SER 16 33 33 SER SER B . n B 2 17 LYS 17 34 34 LYS LYS B . n B 2 18 ARG 18 35 35 ARG ARG B . n B 2 19 PHE 19 36 36 PHE PHE B . n B 2 20 SER 20 37 37 SER SER B . n B 2 21 ALA 21 38 38 ALA ALA B . n B 2 22 TYR 22 39 39 TYR TYR B . n B 2 23 ASN 23 40 40 ASN ASN B . n B 2 24 TYR 24 41 41 TYR TYR B . n B 2 25 ARG 25 42 42 ARG ARG B . n B 2 26 THR 26 43 43 THR THR B . n B 2 27 TYR 27 44 44 TYR TYR B . n B 2 28 ALA 28 45 45 ALA ALA B . n B 2 29 VAL 29 46 46 VAL VAL B . n B 2 30 ARG 30 47 47 ARG ARG B . n B 2 31 ARG 31 48 48 ARG ARG B . n B 2 32 ILE 32 49 49 ILE ILE B . n B 2 33 ARG 33 50 50 ARG ARG B . n B 2 34 ASP 34 51 51 ASP ASP B . n B 2 35 ALA 35 52 52 ALA ALA B . n B 2 36 PHE 36 53 53 PHE PHE B . n B 2 37 ARG 37 54 54 ARG ARG B . n B 2 38 GLU 38 55 55 GLU GLU B . n B 2 39 ASN 39 56 56 ASN ASN B . n B 2 40 LYS 40 57 57 LYS LYS B . n B 2 41 ASN 41 58 58 ASN ASN B . n B 2 42 VAL 42 59 59 VAL VAL B . n B 2 43 LYS 43 60 60 LYS LYS B . n B 2 44 ASP 44 61 61 ASP ASP B . n B 2 45 PRO 45 62 62 PRO PRO B . n B 2 46 VAL 46 63 63 VAL VAL B . n B 2 47 GLU 47 64 64 GLU GLU B . n B 2 48 ILE 48 65 65 ILE ILE B . n B 2 49 GLN 49 66 66 GLN GLN B . n B 2 50 THR 50 67 67 THR THR B . n B 2 51 LEU 51 68 68 LEU LEU B . n B 2 52 VAL 52 69 69 VAL VAL B . n B 2 53 ASN 53 70 70 ASN ASN B . n B 2 54 LYS 54 71 71 LYS LYS B . n B 2 55 ALA 55 72 72 ALA ALA B . n B 2 56 LYS 56 73 73 LYS LYS B . n B 2 57 ARG 57 74 74 ARG ARG B . n B 2 58 ASP 58 75 75 ASP ASP B . n B 2 59 LEU 59 76 76 LEU LEU B . n B 2 60 GLY 60 77 77 GLY GLY B . n B 2 61 VAL 61 78 78 VAL VAL B . n B 2 62 ILE 62 79 79 ILE ILE B . n B 2 63 ARG 63 80 80 ARG ARG B . n B 2 64 ARG 64 81 81 ARG ARG B . n B 2 65 GLN 65 82 82 GLN GLN B . n B 2 66 VAL 66 83 83 VAL VAL B . n B 2 67 HIS 67 84 84 HIS HIS B . n B 2 68 ILE 68 85 85 ILE ILE B . n B 2 69 GLY 69 86 86 GLY GLY B . n B 2 70 GLN 70 87 87 GLN GLN B . n B 2 71 LEU 71 88 88 LEU LEU B . n B 2 72 TYR 72 89 89 TYR TYR B . n B 2 73 SER 73 90 90 SER SER B . n B 2 74 THR 74 91 91 THR THR B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 8Q1 1 301 301 8Q1 8Q1 A . D 4 CA 1 302 1 CA CA A . E 5 HOH 1 401 2 HOH HOH A . E 5 HOH 2 402 6 HOH HOH A . E 5 HOH 3 403 25 HOH HOH A . E 5 HOH 4 404 4 HOH HOH A . E 5 HOH 5 405 22 HOH HOH A . E 5 HOH 6 406 16 HOH HOH A . E 5 HOH 7 407 7 HOH HOH A . E 5 HOH 8 408 13 HOH HOH A . E 5 HOH 9 409 8 HOH HOH A . E 5 HOH 10 410 9 HOH HOH A . E 5 HOH 11 411 11 HOH HOH A . E 5 HOH 12 412 12 HOH HOH A . E 5 HOH 13 413 15 HOH HOH A . E 5 HOH 14 414 1 HOH HOH A . E 5 HOH 15 415 26 HOH HOH A . E 5 HOH 16 416 10 HOH HOH A . E 5 HOH 17 417 24 HOH HOH A . E 5 HOH 18 418 5 HOH HOH A . E 5 HOH 19 419 23 HOH HOH A . E 5 HOH 20 420 18 HOH HOH A . E 5 HOH 21 421 29 HOH HOH A . E 5 HOH 22 422 28 HOH HOH A . E 5 HOH 23 423 33 HOH HOH A . F 5 HOH 1 101 30 HOH HOH B . F 5 HOH 2 102 14 HOH HOH B . F 5 HOH 3 103 3 HOH HOH B . F 5 HOH 4 104 21 HOH HOH B . F 5 HOH 5 105 17 HOH HOH B . F 5 HOH 6 106 34 HOH HOH B . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14_3260 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MoRDa ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6ODD _cell.details ? _cell.formula_units_Z ? _cell.length_a 123.190 _cell.length_a_esd ? _cell.length_b 123.190 _cell.length_b_esd ? _cell.length_c 123.190 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6ODD _symmetry.cell_setting ? _symmetry.Int_Tables_number 199 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 21 3' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6ODD _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.17 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 64.05 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;The drop was a 1:1 mix of protein (in 10 mM Tris buffer, 25 mM NaCl, pH 7.5) and reservoir solution (0.1 M Tris pH 9.1, 0.1 M CaCl2, 23% tert-butanol) ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details 'CONVEX PREFOCUSSING MIRROR AND A KIRKPATRICK-BAEZ PAIR OF FOCUSSING MIRRORS' _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-02-17 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'CRYOGENICALLY COOLED CHANNEL CUT SI[111] CRYSTAL MONOCHROMATOR' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9801 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SOLEIL BEAMLINE PROXIMA 2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9801 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'PROXIMA 2' _diffrn_source.pdbx_synchrotron_site SOLEIL # _reflns.B_iso_Wilson_estimate 53.192 _reflns.entry_id 6ODD _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.000 _reflns.d_resolution_low 43.553 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 21240 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.700 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 39.695 _reflns.pdbx_Rmerge_I_obs 0.077 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 32.540 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.227 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.078 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 843114 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.000 2.120 ? 1.530 ? ? ? ? 3339 98.300 ? ? ? ? 1.804 ? ? ? ? ? ? ? ? 39.382 ? ? ? ? 1.827 ? ? 1 1 0.690 ? 2.120 2.260 ? 3.670 ? ? ? ? 3226 100.000 ? ? ? ? 0.983 ? ? ? ? ? ? ? ? 39.412 ? ? ? ? 0.996 ? ? 2 1 0.924 ? 2.260 2.440 ? 8.890 ? ? ? ? 2969 100.000 ? ? ? ? 0.485 ? ? ? ? ? ? ? ? 41.515 ? ? ? ? 0.491 ? ? 3 1 0.986 ? 2.440 2.680 ? 16.600 ? ? ? ? 2758 100.000 ? ? ? ? 0.260 ? ? ? ? ? ? ? ? 39.976 ? ? ? ? 0.264 ? ? 4 1 0.995 ? 2.680 2.990 ? 31.700 ? ? ? ? 2506 100.000 ? ? ? ? 0.141 ? ? ? ? ? ? ? ? 42.819 ? ? ? ? 0.142 ? ? 5 1 0.999 ? 2.990 3.450 ? 56.730 ? ? ? ? 2202 100.000 ? ? ? ? 0.078 ? ? ? ? ? ? ? ? 40.471 ? ? ? ? 0.079 ? ? 6 1 1.000 ? 3.450 4.220 ? 82.800 ? ? ? ? 1893 100.000 ? ? ? ? 0.053 ? ? ? ? ? ? ? ? 35.445 ? ? ? ? 0.053 ? ? 7 1 1.000 ? 4.220 5.940 ? 96.840 ? ? ? ? 1479 100.000 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? 36.394 ? ? ? ? 0.045 ? ? 8 1 1.000 ? 5.940 43.553 ? 112.510 ? ? ? ? 868 99.700 ? ? ? ? 0.033 ? ? ? ? ? ? ? ? 38.732 ? ? ? ? 0.034 ? ? 9 1 1.000 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 230.400 _refine.B_iso_mean 66.6292 _refine.B_iso_min 40.570 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6ODD _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.000 _refine.ls_d_res_low 43.5530 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 21226 _refine.ls_number_reflns_R_free 1061 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.6400 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1937 _refine.ls_R_factor_R_free 0.2158 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1925 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5WGB _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 'random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.7400 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.000 _refine_hist.d_res_low 43.5530 _refine_hist.number_atoms_solvent 29 _refine_hist.number_atoms_total 1417 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 159 _refine_hist.pdbx_B_iso_mean_ligand 67.17 _refine_hist.pdbx_B_iso_mean_solvent 56.03 _refine_hist.pdbx_number_atoms_protein 1310 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 78 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.9958 2.0866 2585 . 128 2457 98.0000 . . . 0.3431 0.0000 0.3030 . . . . . . 8 . . . 'X-RAY DIFFRACTION' 2.0866 2.1966 2634 . 132 2502 100.0000 . . . 0.2806 0.0000 0.2442 . . . . . . 8 . . . 'X-RAY DIFFRACTION' 2.1966 2.3342 2634 . 132 2502 100.0000 . . . 0.2569 0.0000 0.2223 . . . . . . 8 . . . 'X-RAY DIFFRACTION' 2.3342 2.5144 2636 . 132 2504 100.0000 . . . 0.2336 0.0000 0.2008 . . . . . . 8 . . . 'X-RAY DIFFRACTION' 2.5144 2.7674 2646 . 132 2514 100.0000 . . . 0.2571 0.0000 0.2165 . . . . . . 8 . . . 'X-RAY DIFFRACTION' 2.7674 3.1678 2657 . 133 2524 100.0000 . . . 0.2348 0.0000 0.2197 . . . . . . 8 . . . 'X-RAY DIFFRACTION' 3.1678 3.9907 2675 . 134 2541 100.0000 . . . 0.2024 0.0000 0.1845 . . . . . . 8 . . . 'X-RAY DIFFRACTION' 3.9907 43.5646 2759 . 138 2621 100.0000 . . . 0.1904 0.0000 0.1688 . . . . . . 8 . . . # _struct.entry_id 6ODD _struct.title 'Crystal structure of the human complex ACP-ISD11' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6ODD _struct_keywords.text 'Iron Sulfur Clusters, Cysteine desulfurase activity regulator, BIOSYNTHETIC PROTEIN' _struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 5 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP ACPM_HUMAN O14561 ? 1 ;PPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADK KDVYE ; 72 2 UNP LYRM4_HUMAN Q9HD34 ? 2 SRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYST 5 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6ODD A 1 ? 85 ? O14561 72 ? 156 ? 5 89 2 2 6ODD B 1 ? 74 ? Q9HD34 5 ? 78 ? 18 91 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA tetrameric 4 2 author_and_software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5250 ? 1 MORE -46 ? 1 'SSA (A^2)' 19000 ? 2 'ABSA (A^2)' 2300 ? 2 MORE -5 ? 2 'SSA (A^2)' 9740 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1,2 A,B,C,D,E,F 2 1 A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 16_565 x,-y+1,-z+1/2 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 123.1900000000 0.0000000000 0.0000000000 -1.0000000000 61.5950000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 4 ? LEU A 18 ? THR A 8 LEU A 22 1 ? 15 HELX_P HELX_P2 AA2 ASP A 23 ? LEU A 27 ? ASP A 27 LEU A 31 5 ? 5 HELX_P HELX_P3 AA3 ASP A 40 ? GLY A 56 ? ASP A 44 GLY A 60 1 ? 17 HELX_P HELX_P4 AA4 PRO A 60 ? GLU A 65 ? PRO A 64 GLU A 69 1 ? 6 HELX_P HELX_P5 AA5 CYS A 69 ? LYS A 81 ? CYS A 73 LYS A 85 1 ? 13 HELX_P HELX_P6 AA6 ARG B 2 ? LYS B 17 ? ARG B 19 LYS B 34 1 ? 16 HELX_P HELX_P7 AA7 ALA B 21 ? GLU B 38 ? ALA B 38 GLU B 55 1 ? 18 HELX_P HELX_P8 AA8 ASP B 44 ? TYR B 72 ? ASP B 61 TYR B 89 1 ? 29 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale one ? A SER 41 OG ? ? ? 1_555 C 8Q1 . P24 ? ? A SER 45 A 8Q1 301 1_555 ? ? ? ? ? ? ? 1.557 ? ? metalc1 metalc ? ? A ASP 79 O ? ? ? 1_555 D CA . CA ? ? A ASP 83 A CA 302 1_555 ? ? ? ? ? ? ? 2.402 ? ? metalc2 metalc ? ? A ASP 79 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 83 A CA 302 1_555 ? ? ? ? ? ? ? 2.465 ? ? metalc3 metalc ? ? A ASP 79 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 83 A CA 302 16_565 ? ? ? ? ? ? ? 2.590 ? ? metalc4 metalc ? ? A ASP 79 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 83 A CA 302 16_565 ? ? ? ? ? ? ? 2.600 ? ? metalc5 metalc ? ? A ASP 82 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 86 A CA 302 1_555 ? ? ? ? ? ? ? 2.351 ? ? metalc6 metalc ? ? D CA . CA ? ? ? 1_555 E HOH . O ? ? A CA 302 A HOH 417 16_565 ? ? ? ? ? ? ? 2.268 ? ? metalc7 metalc ? ? D CA . CA ? ? ? 1_555 E HOH . O ? ? A CA 302 A HOH 419 1_555 ? ? ? ? ? ? ? 2.321 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A ASP 79 ? A ASP 83 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 OD1 ? A ASP 79 ? A ASP 83 ? 1_555 74.8 ? 2 O ? A ASP 79 ? A ASP 83 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 OD1 ? A ASP 79 ? A ASP 83 ? 1_555 74.8 ? 3 OD1 ? A ASP 79 ? A ASP 83 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 OD1 ? A ASP 79 ? A ASP 83 ? 1_555 0.0 ? 4 O ? A ASP 79 ? A ASP 83 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 OD2 ? A ASP 79 ? A ASP 83 ? 1_555 76.4 ? 5 OD1 ? A ASP 79 ? A ASP 83 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 OD2 ? A ASP 79 ? A ASP 83 ? 1_555 12.3 ? 6 OD1 ? A ASP 79 ? A ASP 83 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 OD2 ? A ASP 79 ? A ASP 83 ? 1_555 12.3 ? 7 O ? A ASP 79 ? A ASP 83 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 OD1 ? A ASP 82 ? A ASP 86 ? 1_555 81.7 ? 8 OD1 ? A ASP 79 ? A ASP 83 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 OD1 ? A ASP 82 ? A ASP 86 ? 1_555 156.0 ? 9 OD1 ? A ASP 79 ? A ASP 83 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 OD1 ? A ASP 82 ? A ASP 86 ? 1_555 156.0 ? 10 OD2 ? A ASP 79 ? A ASP 83 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 OD1 ? A ASP 82 ? A ASP 86 ? 1_555 156.8 ? 11 O ? A ASP 79 ? A ASP 83 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O ? E HOH . ? A HOH 417 ? 16_565 85.2 ? 12 OD1 ? A ASP 79 ? A ASP 83 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O ? E HOH . ? A HOH 417 ? 16_565 90.4 ? 13 OD1 ? A ASP 79 ? A ASP 83 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O ? E HOH . ? A HOH 417 ? 16_565 90.4 ? 14 OD2 ? A ASP 79 ? A ASP 83 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O ? E HOH . ? A HOH 417 ? 16_565 78.4 ? 15 OD1 ? A ASP 82 ? A ASP 86 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O ? E HOH . ? A HOH 417 ? 16_565 92.3 ? 16 O ? A ASP 79 ? A ASP 83 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O ? E HOH . ? A HOH 419 ? 1_555 94.9 ? 17 OD1 ? A ASP 79 ? A ASP 83 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O ? E HOH . ? A HOH 419 ? 1_555 87.1 ? 18 OD1 ? A ASP 79 ? A ASP 83 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O ? E HOH . ? A HOH 419 ? 1_555 87.1 ? 19 OD2 ? A ASP 79 ? A ASP 83 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O ? E HOH . ? A HOH 419 ? 1_555 99.1 ? 20 OD1 ? A ASP 82 ? A ASP 86 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O ? E HOH . ? A HOH 419 ? 1_555 90.4 ? 21 O ? E HOH . ? A HOH 417 ? 16_565 CA ? D CA . ? A CA 302 ? 1_555 O ? E HOH . ? A HOH 419 ? 1_555 177.3 ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id 8Q1 _pdbx_modification_feature.label_asym_id C _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id SER _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 41 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id 8Q1 _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 301 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id SER _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 45 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom P24 _pdbx_modification_feature.modified_residue_id_linking_atom OG _pdbx_modification_feature.modified_residue_id SER _pdbx_modification_feature.ref_pcm_id 2 _pdbx_modification_feature.ref_comp_id 8Q1 _pdbx_modification_feature.type None _pdbx_modification_feature.category Lipid/lipid-like # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A 8Q1 301 ? 13 'binding site for residue 8Q1 A 301' AC2 Software A CA 302 ? 5 'binding site for residue CA A 302' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 13 ASP A 40 ? ASP A 44 . ? 1_555 ? 2 AC1 13 SER A 41 ? SER A 45 . ? 1_555 ? 3 AC1 13 HOH E . ? HOH A 406 . ? 1_555 ? 4 AC1 13 ARG B 2 ? ARG B 19 . ? 1_555 ? 5 AC1 13 VAL B 5 ? VAL B 22 . ? 1_555 ? 6 AC1 13 MET B 12 ? MET B 29 . ? 1_555 ? 7 AC1 13 ALA B 35 ? ALA B 52 . ? 1_555 ? 8 AC1 13 ASN B 39 ? ASN B 56 . ? 1_555 ? 9 AC1 13 LYS B 40 ? LYS B 57 . ? 1_555 ? 10 AC1 13 VAL B 42 ? VAL B 59 . ? 1_555 ? 11 AC1 13 ILE B 48 ? ILE B 65 . ? 1_555 ? 12 AC1 13 LEU B 51 ? LEU B 68 . ? 1_555 ? 13 AC1 13 ASP B 58 ? ASP B 75 . ? 1_555 ? 14 AC2 5 ASP A 79 ? ASP A 83 . ? 1_555 ? 15 AC2 5 ASP A 79 ? ASP A 83 . ? 16_565 ? 16 AC2 5 ASP A 82 ? ASP A 86 . ? 1_555 ? 17 AC2 5 HOH E . ? HOH A 417 . ? 16_565 ? 18 AC2 5 HOH E . ? HOH A 419 . ? 1_555 ? # _pdbx_entry_details.entry_id 6ODD _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 417 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 417 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 16_565 _pdbx_validate_symm_contact.dist 2.03 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id B _pdbx_validate_torsion.auth_seq_id 61 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -48.76 _pdbx_validate_torsion.psi 106.93 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 422 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id E _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 17.6985 60.7183 14.3802 0.4490 0.4926 0.4813 0.0603 -0.0582 0.0606 2.7794 3.7546 4.2837 -0.5304 -1.1872 1.5541 0.0714 -0.0359 -0.1694 0.1181 -0.1278 0.0887 -0.2237 -0.4385 0.0185 'X-RAY DIFFRACTION' 2 ? refined 38.4392 51.4358 11.3056 0.3932 0.3817 0.5306 0.0307 -0.0819 0.0558 5.0686 2.2922 3.6733 -0.9168 1.6800 -0.0144 0.0897 0.0717 -0.4498 0.1270 0.0148 -0.2241 0.1348 0.2500 -0.1105 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;(chain 'A' and resid 5 through 89) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;(chain 'B' and resid 18 through 91) ; # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 8Q1 O4 O N N 1 8Q1 C16 C N N 2 8Q1 O3 O N N 3 8Q1 C15 C N N 4 8Q1 C14 C N N 5 8Q1 C13 C N N 6 8Q1 O2 O N N 7 8Q1 C12 C N N 8 8Q1 C11 C N N 9 8Q1 C10 C N N 10 8Q1 C9 C N N 11 8Q1 C8 C N N 12 8Q1 C7 C N N 13 8Q1 C6 C N N 14 8Q1 C1 C N N 15 8Q1 C28 C N N 16 8Q1 C29 C N N 17 8Q1 C30 C N N 18 8Q1 C31 C N N 19 8Q1 C32 C N R 20 8Q1 C34 C N N 21 8Q1 C37 C N N 22 8Q1 C38 C N N 23 8Q1 C39 C N N 24 8Q1 C42 C N N 25 8Q1 C43 C N N 26 8Q1 N36 N N N 27 8Q1 N41 N N N 28 8Q1 O27 O N N 29 8Q1 O33 O N N 30 8Q1 O35 O N N 31 8Q1 O40 O N N 32 8Q1 P24 P N N 33 8Q1 S44 S N N 34 8Q1 O1 O N N 35 8Q1 H1 H N N 36 8Q1 H2 H N N 37 8Q1 H3 H N N 38 8Q1 H4 H N N 39 8Q1 H5 H N N 40 8Q1 H6 H N N 41 8Q1 H7 H N N 42 8Q1 H8 H N N 43 8Q1 H9 H N N 44 8Q1 H10 H N N 45 8Q1 H11 H N N 46 8Q1 H12 H N N 47 8Q1 H13 H N N 48 8Q1 H14 H N N 49 8Q1 H15 H N N 50 8Q1 H16 H N N 51 8Q1 H17 H N N 52 8Q1 H18 H N N 53 8Q1 H19 H N N 54 8Q1 H20 H N N 55 8Q1 H21 H N N 56 8Q1 H22 H N N 57 8Q1 H23 H N N 58 8Q1 H24 H N N 59 8Q1 H25 H N N 60 8Q1 H26 H N N 61 8Q1 H27 H N N 62 8Q1 H28 H N N 63 8Q1 H29 H N N 64 8Q1 H30 H N N 65 8Q1 H31 H N N 66 8Q1 H32 H N N 67 8Q1 H33 H N N 68 8Q1 H34 H N N 69 8Q1 H35 H N N 70 8Q1 H36 H N N 71 8Q1 H37 H N N 72 8Q1 H38 H N N 73 8Q1 H39 H N N 74 8Q1 H40 H N N 75 8Q1 H41 H N N 76 8Q1 H42 H N N 77 8Q1 H43 H N N 78 8Q1 H44 H N N 79 8Q1 H45 H N N 80 ALA N N N N 81 ALA CA C N S 82 ALA C C N N 83 ALA O O N N 84 ALA CB C N N 85 ALA OXT O N N 86 ALA H H N N 87 ALA H2 H N N 88 ALA HA H N N 89 ALA HB1 H N N 90 ALA HB2 H N N 91 ALA HB3 H N N 92 ALA HXT H N N 93 ARG N N N N 94 ARG CA C N S 95 ARG C C N N 96 ARG O O N N 97 ARG CB C N N 98 ARG CG C N N 99 ARG CD C N N 100 ARG NE N N N 101 ARG CZ C N N 102 ARG NH1 N N N 103 ARG NH2 N N N 104 ARG OXT O N N 105 ARG H H N N 106 ARG H2 H N N 107 ARG HA H N N 108 ARG HB2 H N N 109 ARG HB3 H N N 110 ARG HG2 H N N 111 ARG HG3 H N N 112 ARG HD2 H N N 113 ARG HD3 H N N 114 ARG HE H N N 115 ARG HH11 H N N 116 ARG HH12 H N N 117 ARG HH21 H N N 118 ARG HH22 H N N 119 ARG HXT H N N 120 ASN N N N N 121 ASN CA C N S 122 ASN C C N N 123 ASN O O N N 124 ASN CB C N N 125 ASN CG C N N 126 ASN OD1 O N N 127 ASN ND2 N N N 128 ASN OXT O N N 129 ASN H H N N 130 ASN H2 H N N 131 ASN HA H N N 132 ASN HB2 H N N 133 ASN HB3 H N N 134 ASN HD21 H N N 135 ASN HD22 H N N 136 ASN HXT H N N 137 ASP N N N N 138 ASP CA C N S 139 ASP C C N N 140 ASP O O N N 141 ASP CB C N N 142 ASP CG C N N 143 ASP OD1 O N N 144 ASP OD2 O N N 145 ASP OXT O N N 146 ASP H H N N 147 ASP H2 H N N 148 ASP HA H N N 149 ASP HB2 H N N 150 ASP HB3 H N N 151 ASP HD2 H N N 152 ASP HXT H N N 153 CA CA CA N N 154 CYS N N N N 155 CYS CA C N R 156 CYS C C N N 157 CYS O O N N 158 CYS CB C N N 159 CYS SG S N N 160 CYS OXT O N N 161 CYS H H N N 162 CYS H2 H N N 163 CYS HA H N N 164 CYS HB2 H N N 165 CYS HB3 H N N 166 CYS HG H N N 167 CYS HXT H N N 168 GLN N N N N 169 GLN CA C N S 170 GLN C C N N 171 GLN O O N N 172 GLN CB C N N 173 GLN CG C N N 174 GLN CD C N N 175 GLN OE1 O N N 176 GLN NE2 N N N 177 GLN OXT O N N 178 GLN H H N N 179 GLN H2 H N N 180 GLN HA H N N 181 GLN HB2 H N N 182 GLN HB3 H N N 183 GLN HG2 H N N 184 GLN HG3 H N N 185 GLN HE21 H N N 186 GLN HE22 H N N 187 GLN HXT H N N 188 GLU N N N N 189 GLU CA C N S 190 GLU C C N N 191 GLU O O N N 192 GLU CB C N N 193 GLU CG C N N 194 GLU CD C N N 195 GLU OE1 O N N 196 GLU OE2 O N N 197 GLU OXT O N N 198 GLU H H N N 199 GLU H2 H N N 200 GLU HA H N N 201 GLU HB2 H N N 202 GLU HB3 H N N 203 GLU HG2 H N N 204 GLU HG3 H N N 205 GLU HE2 H N N 206 GLU HXT H N N 207 GLY N N N N 208 GLY CA C N N 209 GLY C C N N 210 GLY O O N N 211 GLY OXT O N N 212 GLY H H N N 213 GLY H2 H N N 214 GLY HA2 H N N 215 GLY HA3 H N N 216 GLY HXT H N N 217 HIS N N N N 218 HIS CA C N S 219 HIS C C N N 220 HIS O O N N 221 HIS CB C N N 222 HIS CG C Y N 223 HIS ND1 N Y N 224 HIS CD2 C Y N 225 HIS CE1 C Y N 226 HIS NE2 N Y N 227 HIS OXT O N N 228 HIS H H N N 229 HIS H2 H N N 230 HIS HA H N N 231 HIS HB2 H N N 232 HIS HB3 H N N 233 HIS HD1 H N N 234 HIS HD2 H N N 235 HIS HE1 H N N 236 HIS HE2 H N N 237 HIS HXT H N N 238 HOH O O N N 239 HOH H1 H N N 240 HOH H2 H N N 241 ILE N N N N 242 ILE CA C N S 243 ILE C C N N 244 ILE O O N N 245 ILE CB C N S 246 ILE CG1 C N N 247 ILE CG2 C N N 248 ILE CD1 C N N 249 ILE OXT O N N 250 ILE H H N N 251 ILE H2 H N N 252 ILE HA H N N 253 ILE HB H N N 254 ILE HG12 H N N 255 ILE HG13 H N N 256 ILE HG21 H N N 257 ILE HG22 H N N 258 ILE HG23 H N N 259 ILE HD11 H N N 260 ILE HD12 H N N 261 ILE HD13 H N N 262 ILE HXT H N N 263 LEU N N N N 264 LEU CA C N S 265 LEU C C N N 266 LEU O O N N 267 LEU CB C N N 268 LEU CG C N N 269 LEU CD1 C N N 270 LEU CD2 C N N 271 LEU OXT O N N 272 LEU H H N N 273 LEU H2 H N N 274 LEU HA H N N 275 LEU HB2 H N N 276 LEU HB3 H N N 277 LEU HG H N N 278 LEU HD11 H N N 279 LEU HD12 H N N 280 LEU HD13 H N N 281 LEU HD21 H N N 282 LEU HD22 H N N 283 LEU HD23 H N N 284 LEU HXT H N N 285 LYS N N N N 286 LYS CA C N S 287 LYS C C N N 288 LYS O O N N 289 LYS CB C N N 290 LYS CG C N N 291 LYS CD C N N 292 LYS CE C N N 293 LYS NZ N N N 294 LYS OXT O N N 295 LYS H H N N 296 LYS H2 H N N 297 LYS HA H N N 298 LYS HB2 H N N 299 LYS HB3 H N N 300 LYS HG2 H N N 301 LYS HG3 H N N 302 LYS HD2 H N N 303 LYS HD3 H N N 304 LYS HE2 H N N 305 LYS HE3 H N N 306 LYS HZ1 H N N 307 LYS HZ2 H N N 308 LYS HZ3 H N N 309 LYS HXT H N N 310 MET N N N N 311 MET CA C N S 312 MET C C N N 313 MET O O N N 314 MET CB C N N 315 MET CG C N N 316 MET SD S N N 317 MET CE C N N 318 MET OXT O N N 319 MET H H N N 320 MET H2 H N N 321 MET HA H N N 322 MET HB2 H N N 323 MET HB3 H N N 324 MET HG2 H N N 325 MET HG3 H N N 326 MET HE1 H N N 327 MET HE2 H N N 328 MET HE3 H N N 329 MET HXT H N N 330 PHE N N N N 331 PHE CA C N S 332 PHE C C N N 333 PHE O O N N 334 PHE CB C N N 335 PHE CG C Y N 336 PHE CD1 C Y N 337 PHE CD2 C Y N 338 PHE CE1 C Y N 339 PHE CE2 C Y N 340 PHE CZ C Y N 341 PHE OXT O N N 342 PHE H H N N 343 PHE H2 H N N 344 PHE HA H N N 345 PHE HB2 H N N 346 PHE HB3 H N N 347 PHE HD1 H N N 348 PHE HD2 H N N 349 PHE HE1 H N N 350 PHE HE2 H N N 351 PHE HZ H N N 352 PHE HXT H N N 353 PRO N N N N 354 PRO CA C N S 355 PRO C C N N 356 PRO O O N N 357 PRO CB C N N 358 PRO CG C N N 359 PRO CD C N N 360 PRO OXT O N N 361 PRO H H N N 362 PRO HA H N N 363 PRO HB2 H N N 364 PRO HB3 H N N 365 PRO HG2 H N N 366 PRO HG3 H N N 367 PRO HD2 H N N 368 PRO HD3 H N N 369 PRO HXT H N N 370 SER N N N N 371 SER CA C N S 372 SER C C N N 373 SER O O N N 374 SER CB C N N 375 SER OG O N N 376 SER OXT O N N 377 SER H H N N 378 SER H2 H N N 379 SER HA H N N 380 SER HB2 H N N 381 SER HB3 H N N 382 SER HG H N N 383 SER HXT H N N 384 THR N N N N 385 THR CA C N S 386 THR C C N N 387 THR O O N N 388 THR CB C N R 389 THR OG1 O N N 390 THR CG2 C N N 391 THR OXT O N N 392 THR H H N N 393 THR H2 H N N 394 THR HA H N N 395 THR HB H N N 396 THR HG1 H N N 397 THR HG21 H N N 398 THR HG22 H N N 399 THR HG23 H N N 400 THR HXT H N N 401 TYR N N N N 402 TYR CA C N S 403 TYR C C N N 404 TYR O O N N 405 TYR CB C N N 406 TYR CG C Y N 407 TYR CD1 C Y N 408 TYR CD2 C Y N 409 TYR CE1 C Y N 410 TYR CE2 C Y N 411 TYR CZ C Y N 412 TYR OH O N N 413 TYR OXT O N N 414 TYR H H N N 415 TYR H2 H N N 416 TYR HA H N N 417 TYR HB2 H N N 418 TYR HB3 H N N 419 TYR HD1 H N N 420 TYR HD2 H N N 421 TYR HE1 H N N 422 TYR HE2 H N N 423 TYR HH H N N 424 TYR HXT H N N 425 VAL N N N N 426 VAL CA C N S 427 VAL C C N N 428 VAL O O N N 429 VAL CB C N N 430 VAL CG1 C N N 431 VAL CG2 C N N 432 VAL OXT O N N 433 VAL H H N N 434 VAL H2 H N N 435 VAL HA H N N 436 VAL HB H N N 437 VAL HG11 H N N 438 VAL HG12 H N N 439 VAL HG13 H N N 440 VAL HG21 H N N 441 VAL HG22 H N N 442 VAL HG23 H N N 443 VAL HXT H N N 444 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 8Q1 O3 P24 doub N N 1 8Q1 O2 P24 sing N N 2 8Q1 P24 O27 sing N N 3 8Q1 O27 C28 sing N N 4 8Q1 C28 C29 sing N N 5 8Q1 O33 C32 sing N N 6 8Q1 C30 C29 sing N N 7 8Q1 C29 C32 sing N N 8 8Q1 C29 C31 sing N N 9 8Q1 C32 C34 sing N N 10 8Q1 O35 C34 doub N N 11 8Q1 C34 N36 sing N N 12 8Q1 N36 C37 sing N N 13 8Q1 C16 C15 sing N N 14 8Q1 C14 C15 sing N N 15 8Q1 C14 C13 sing N N 16 8Q1 C42 N41 sing N N 17 8Q1 C42 C43 sing N N 18 8Q1 C37 C38 sing N N 19 8Q1 S44 C43 sing N N 20 8Q1 S44 C1 sing N N 21 8Q1 O40 C39 doub N N 22 8Q1 C12 C13 sing N N 23 8Q1 C12 C11 sing N N 24 8Q1 N41 C39 sing N N 25 8Q1 C39 C38 sing N N 26 8Q1 C10 C11 sing N N 27 8Q1 C10 C9 sing N N 28 8Q1 C8 C7 sing N N 29 8Q1 C8 C9 sing N N 30 8Q1 C1 C6 sing N N 31 8Q1 C1 O4 doub N N 32 8Q1 C7 C6 sing N N 33 8Q1 P24 O1 sing N N 34 8Q1 C16 H1 sing N N 35 8Q1 C16 H2 sing N N 36 8Q1 C16 H3 sing N N 37 8Q1 C15 H4 sing N N 38 8Q1 C15 H5 sing N N 39 8Q1 C14 H6 sing N N 40 8Q1 C14 H7 sing N N 41 8Q1 C13 H8 sing N N 42 8Q1 C13 H9 sing N N 43 8Q1 O2 H10 sing N N 44 8Q1 C12 H11 sing N N 45 8Q1 C12 H12 sing N N 46 8Q1 C11 H13 sing N N 47 8Q1 C11 H14 sing N N 48 8Q1 C10 H15 sing N N 49 8Q1 C10 H16 sing N N 50 8Q1 C9 H17 sing N N 51 8Q1 C9 H18 sing N N 52 8Q1 C8 H19 sing N N 53 8Q1 C8 H20 sing N N 54 8Q1 C7 H21 sing N N 55 8Q1 C7 H22 sing N N 56 8Q1 C6 H23 sing N N 57 8Q1 C6 H24 sing N N 58 8Q1 C28 H25 sing N N 59 8Q1 C28 H26 sing N N 60 8Q1 C30 H27 sing N N 61 8Q1 C30 H28 sing N N 62 8Q1 C30 H29 sing N N 63 8Q1 C31 H30 sing N N 64 8Q1 C31 H31 sing N N 65 8Q1 C31 H32 sing N N 66 8Q1 C32 H33 sing N N 67 8Q1 C37 H34 sing N N 68 8Q1 C37 H35 sing N N 69 8Q1 C38 H36 sing N N 70 8Q1 C38 H37 sing N N 71 8Q1 C42 H38 sing N N 72 8Q1 C42 H39 sing N N 73 8Q1 C43 H40 sing N N 74 8Q1 C43 H41 sing N N 75 8Q1 N36 H42 sing N N 76 8Q1 N41 H43 sing N N 77 8Q1 O33 H44 sing N N 78 8Q1 O1 H45 sing N N 79 ALA N CA sing N N 80 ALA N H sing N N 81 ALA N H2 sing N N 82 ALA CA C sing N N 83 ALA CA CB sing N N 84 ALA CA HA sing N N 85 ALA C O doub N N 86 ALA C OXT sing N N 87 ALA CB HB1 sing N N 88 ALA CB HB2 sing N N 89 ALA CB HB3 sing N N 90 ALA OXT HXT sing N N 91 ARG N CA sing N N 92 ARG N H sing N N 93 ARG N H2 sing N N 94 ARG CA C sing N N 95 ARG CA CB sing N N 96 ARG CA HA sing N N 97 ARG C O doub N N 98 ARG C OXT sing N N 99 ARG CB CG sing N N 100 ARG CB HB2 sing N N 101 ARG CB HB3 sing N N 102 ARG CG CD sing N N 103 ARG CG HG2 sing N N 104 ARG CG HG3 sing N N 105 ARG CD NE sing N N 106 ARG CD HD2 sing N N 107 ARG CD HD3 sing N N 108 ARG NE CZ sing N N 109 ARG NE HE sing N N 110 ARG CZ NH1 sing N N 111 ARG CZ NH2 doub N N 112 ARG NH1 HH11 sing N N 113 ARG NH1 HH12 sing N N 114 ARG NH2 HH21 sing N N 115 ARG NH2 HH22 sing N N 116 ARG OXT HXT sing N N 117 ASN N CA sing N N 118 ASN N H sing N N 119 ASN N H2 sing N N 120 ASN CA C sing N N 121 ASN CA CB sing N N 122 ASN CA HA sing N N 123 ASN C O doub N N 124 ASN C OXT sing N N 125 ASN CB CG sing N N 126 ASN CB HB2 sing N N 127 ASN CB HB3 sing N N 128 ASN CG OD1 doub N N 129 ASN CG ND2 sing N N 130 ASN ND2 HD21 sing N N 131 ASN ND2 HD22 sing N N 132 ASN OXT HXT sing N N 133 ASP N CA sing N N 134 ASP N H sing N N 135 ASP N H2 sing N N 136 ASP CA C sing N N 137 ASP CA CB sing N N 138 ASP CA HA sing N N 139 ASP C O doub N N 140 ASP C OXT sing N N 141 ASP CB CG sing N N 142 ASP CB HB2 sing N N 143 ASP CB HB3 sing N N 144 ASP CG OD1 doub N N 145 ASP CG OD2 sing N N 146 ASP OD2 HD2 sing N N 147 ASP OXT HXT sing N N 148 CYS N CA sing N N 149 CYS N H sing N N 150 CYS N H2 sing N N 151 CYS CA C sing N N 152 CYS CA CB sing N N 153 CYS CA HA sing N N 154 CYS C O doub N N 155 CYS C OXT sing N N 156 CYS CB SG sing N N 157 CYS CB HB2 sing N N 158 CYS CB HB3 sing N N 159 CYS SG HG sing N N 160 CYS OXT HXT sing N N 161 GLN N CA sing N N 162 GLN N H sing N N 163 GLN N H2 sing N N 164 GLN CA C sing N N 165 GLN CA CB sing N N 166 GLN CA HA sing N N 167 GLN C O doub N N 168 GLN C OXT sing N N 169 GLN CB CG sing N N 170 GLN CB HB2 sing N N 171 GLN CB HB3 sing N N 172 GLN CG CD sing N N 173 GLN CG HG2 sing N N 174 GLN CG HG3 sing N N 175 GLN CD OE1 doub N N 176 GLN CD NE2 sing N N 177 GLN NE2 HE21 sing N N 178 GLN NE2 HE22 sing N N 179 GLN OXT HXT sing N N 180 GLU N CA sing N N 181 GLU N H sing N N 182 GLU N H2 sing N N 183 GLU CA C sing N N 184 GLU CA CB sing N N 185 GLU CA HA sing N N 186 GLU C O doub N N 187 GLU C OXT sing N N 188 GLU CB CG sing N N 189 GLU CB HB2 sing N N 190 GLU CB HB3 sing N N 191 GLU CG CD sing N N 192 GLU CG HG2 sing N N 193 GLU CG HG3 sing N N 194 GLU CD OE1 doub N N 195 GLU CD OE2 sing N N 196 GLU OE2 HE2 sing N N 197 GLU OXT HXT sing N N 198 GLY N CA sing N N 199 GLY N H sing N N 200 GLY N H2 sing N N 201 GLY CA C sing N N 202 GLY CA HA2 sing N N 203 GLY CA HA3 sing N N 204 GLY C O doub N N 205 GLY C OXT sing N N 206 GLY OXT HXT sing N N 207 HIS N CA sing N N 208 HIS N H sing N N 209 HIS N H2 sing N N 210 HIS CA C sing N N 211 HIS CA CB sing N N 212 HIS CA HA sing N N 213 HIS C O doub N N 214 HIS C OXT sing N N 215 HIS CB CG sing N N 216 HIS CB HB2 sing N N 217 HIS CB HB3 sing N N 218 HIS CG ND1 sing Y N 219 HIS CG CD2 doub Y N 220 HIS ND1 CE1 doub Y N 221 HIS ND1 HD1 sing N N 222 HIS CD2 NE2 sing Y N 223 HIS CD2 HD2 sing N N 224 HIS CE1 NE2 sing Y N 225 HIS CE1 HE1 sing N N 226 HIS NE2 HE2 sing N N 227 HIS OXT HXT sing N N 228 HOH O H1 sing N N 229 HOH O H2 sing N N 230 ILE N CA sing N N 231 ILE N H sing N N 232 ILE N H2 sing N N 233 ILE CA C sing N N 234 ILE CA CB sing N N 235 ILE CA HA sing N N 236 ILE C O doub N N 237 ILE C OXT sing N N 238 ILE CB CG1 sing N N 239 ILE CB CG2 sing N N 240 ILE CB HB sing N N 241 ILE CG1 CD1 sing N N 242 ILE CG1 HG12 sing N N 243 ILE CG1 HG13 sing N N 244 ILE CG2 HG21 sing N N 245 ILE CG2 HG22 sing N N 246 ILE CG2 HG23 sing N N 247 ILE CD1 HD11 sing N N 248 ILE CD1 HD12 sing N N 249 ILE CD1 HD13 sing N N 250 ILE OXT HXT sing N N 251 LEU N CA sing N N 252 LEU N H sing N N 253 LEU N H2 sing N N 254 LEU CA C sing N N 255 LEU CA CB sing N N 256 LEU CA HA sing N N 257 LEU C O doub N N 258 LEU C OXT sing N N 259 LEU CB CG sing N N 260 LEU CB HB2 sing N N 261 LEU CB HB3 sing N N 262 LEU CG CD1 sing N N 263 LEU CG CD2 sing N N 264 LEU CG HG sing N N 265 LEU CD1 HD11 sing N N 266 LEU CD1 HD12 sing N N 267 LEU CD1 HD13 sing N N 268 LEU CD2 HD21 sing N N 269 LEU CD2 HD22 sing N N 270 LEU CD2 HD23 sing N N 271 LEU OXT HXT sing N N 272 LYS N CA sing N N 273 LYS N H sing N N 274 LYS N H2 sing N N 275 LYS CA C sing N N 276 LYS CA CB sing N N 277 LYS CA HA sing N N 278 LYS C O doub N N 279 LYS C OXT sing N N 280 LYS CB CG sing N N 281 LYS CB HB2 sing N N 282 LYS CB HB3 sing N N 283 LYS CG CD sing N N 284 LYS CG HG2 sing N N 285 LYS CG HG3 sing N N 286 LYS CD CE sing N N 287 LYS CD HD2 sing N N 288 LYS CD HD3 sing N N 289 LYS CE NZ sing N N 290 LYS CE HE2 sing N N 291 LYS CE HE3 sing N N 292 LYS NZ HZ1 sing N N 293 LYS NZ HZ2 sing N N 294 LYS NZ HZ3 sing N N 295 LYS OXT HXT sing N N 296 MET N CA sing N N 297 MET N H sing N N 298 MET N H2 sing N N 299 MET CA C sing N N 300 MET CA CB sing N N 301 MET CA HA sing N N 302 MET C O doub N N 303 MET C OXT sing N N 304 MET CB CG sing N N 305 MET CB HB2 sing N N 306 MET CB HB3 sing N N 307 MET CG SD sing N N 308 MET CG HG2 sing N N 309 MET CG HG3 sing N N 310 MET SD CE sing N N 311 MET CE HE1 sing N N 312 MET CE HE2 sing N N 313 MET CE HE3 sing N N 314 MET OXT HXT sing N N 315 PHE N CA sing N N 316 PHE N H sing N N 317 PHE N H2 sing N N 318 PHE CA C sing N N 319 PHE CA CB sing N N 320 PHE CA HA sing N N 321 PHE C O doub N N 322 PHE C OXT sing N N 323 PHE CB CG sing N N 324 PHE CB HB2 sing N N 325 PHE CB HB3 sing N N 326 PHE CG CD1 doub Y N 327 PHE CG CD2 sing Y N 328 PHE CD1 CE1 sing Y N 329 PHE CD1 HD1 sing N N 330 PHE CD2 CE2 doub Y N 331 PHE CD2 HD2 sing N N 332 PHE CE1 CZ doub Y N 333 PHE CE1 HE1 sing N N 334 PHE CE2 CZ sing Y N 335 PHE CE2 HE2 sing N N 336 PHE CZ HZ sing N N 337 PHE OXT HXT sing N N 338 PRO N CA sing N N 339 PRO N CD sing N N 340 PRO N H sing N N 341 PRO CA C sing N N 342 PRO CA CB sing N N 343 PRO CA HA sing N N 344 PRO C O doub N N 345 PRO C OXT sing N N 346 PRO CB CG sing N N 347 PRO CB HB2 sing N N 348 PRO CB HB3 sing N N 349 PRO CG CD sing N N 350 PRO CG HG2 sing N N 351 PRO CG HG3 sing N N 352 PRO CD HD2 sing N N 353 PRO CD HD3 sing N N 354 PRO OXT HXT sing N N 355 SER N CA sing N N 356 SER N H sing N N 357 SER N H2 sing N N 358 SER CA C sing N N 359 SER CA CB sing N N 360 SER CA HA sing N N 361 SER C O doub N N 362 SER C OXT sing N N 363 SER CB OG sing N N 364 SER CB HB2 sing N N 365 SER CB HB3 sing N N 366 SER OG HG sing N N 367 SER OXT HXT sing N N 368 THR N CA sing N N 369 THR N H sing N N 370 THR N H2 sing N N 371 THR CA C sing N N 372 THR CA CB sing N N 373 THR CA HA sing N N 374 THR C O doub N N 375 THR C OXT sing N N 376 THR CB OG1 sing N N 377 THR CB CG2 sing N N 378 THR CB HB sing N N 379 THR OG1 HG1 sing N N 380 THR CG2 HG21 sing N N 381 THR CG2 HG22 sing N N 382 THR CG2 HG23 sing N N 383 THR OXT HXT sing N N 384 TYR N CA sing N N 385 TYR N H sing N N 386 TYR N H2 sing N N 387 TYR CA C sing N N 388 TYR CA CB sing N N 389 TYR CA HA sing N N 390 TYR C O doub N N 391 TYR C OXT sing N N 392 TYR CB CG sing N N 393 TYR CB HB2 sing N N 394 TYR CB HB3 sing N N 395 TYR CG CD1 doub Y N 396 TYR CG CD2 sing Y N 397 TYR CD1 CE1 sing Y N 398 TYR CD1 HD1 sing N N 399 TYR CD2 CE2 doub Y N 400 TYR CD2 HD2 sing N N 401 TYR CE1 CZ doub Y N 402 TYR CE1 HE1 sing N N 403 TYR CE2 CZ sing Y N 404 TYR CE2 HE2 sing N N 405 TYR CZ OH sing N N 406 TYR OH HH sing N N 407 TYR OXT HXT sing N N 408 VAL N CA sing N N 409 VAL N H sing N N 410 VAL N H2 sing N N 411 VAL CA C sing N N 412 VAL CA CB sing N N 413 VAL CA HA sing N N 414 VAL C O doub N N 415 VAL C OXT sing N N 416 VAL CB CG1 sing N N 417 VAL CB CG2 sing N N 418 VAL CB HB sing N N 419 VAL CG1 HG11 sing N N 420 VAL CG1 HG12 sing N N 421 VAL CG1 HG13 sing N N 422 VAL CG2 HG21 sing N N 423 VAL CG2 HG22 sing N N 424 VAL CG2 HG23 sing N N 425 VAL OXT HXT sing N N 426 # _pdbx_audit_support.country 'United States' _pdbx_audit_support.funding_organization 'Friedreichs Ataxia Research Alliance (FARA)' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5WGB _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6ODD _atom_sites.fract_transf_matrix[1][1] 0.008118 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008118 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008118 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CA H N O P S # loop_ # loop_ #