data_6OHX # _entry.id 6OHX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6OHX pdb_00006ohx 10.2210/pdb6ohx/pdb WWPDB D_1000240726 ? ? BMRB 30598 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of scorpion Hottentotta jayakari venom toxin Hj1a' _pdbx_database_related.db_id 30598 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6OHX _pdbx_database_status.recvd_initial_deposition_date 2019-04-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chin, Y.K.-Y.' 1 0000-0002-3367-6897 'Chow, C.Y.' 2 0000-0003-2861-5843 'King, G.F.' 3 0000-0002-2308-2200 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Pharmacol Transl Sci' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2575-910 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 3 _citation.language ? _citation.page_first 119 _citation.page_last 134 _citation.title ;Venom Peptides with Dual Modulatory Activity on the Voltage-Gated Sodium Channel NaV1.1 Provide Novel Leads for Development of Antiepileptic Drugs. ; _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsptsci.9b00079 _citation.pdbx_database_id_PubMed 32259093 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chow, C.Y.' 1 ? primary 'Chin, Y.K.' 2 ? primary 'Walker, A.A.' 3 ? primary 'Guo, S.' 4 ? primary 'Blomster, L.V.' 5 ? primary 'Ward, M.J.' 6 ? primary 'Herzig, V.' 7 ? primary 'Rokyta, D.R.' 8 ? primary 'King, G.F.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Venom toxin Hj1a' _entity.formula_weight 7559.603 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GEEVRDAYIAQPHNCVYHCFRDSYCNDLCIKHGAESGECKWFTSSGNACWCVKLPKSEPIKVPGKCH _entity_poly.pdbx_seq_one_letter_code_can GEEVRDAYIAQPHNCVYHCFRDSYCNDLCIKHGAESGECKWFTSSGNACWCVKLPKSEPIKVPGKCH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLU n 1 3 GLU n 1 4 VAL n 1 5 ARG n 1 6 ASP n 1 7 ALA n 1 8 TYR n 1 9 ILE n 1 10 ALA n 1 11 GLN n 1 12 PRO n 1 13 HIS n 1 14 ASN n 1 15 CYS n 1 16 VAL n 1 17 TYR n 1 18 HIS n 1 19 CYS n 1 20 PHE n 1 21 ARG n 1 22 ASP n 1 23 SER n 1 24 TYR n 1 25 CYS n 1 26 ASN n 1 27 ASP n 1 28 LEU n 1 29 CYS n 1 30 ILE n 1 31 LYS n 1 32 HIS n 1 33 GLY n 1 34 ALA n 1 35 GLU n 1 36 SER n 1 37 GLY n 1 38 GLU n 1 39 CYS n 1 40 LYS n 1 41 TRP n 1 42 PHE n 1 43 THR n 1 44 SER n 1 45 SER n 1 46 GLY n 1 47 ASN n 1 48 ALA n 1 49 CYS n 1 50 TRP n 1 51 CYS n 1 52 VAL n 1 53 LYS n 1 54 LEU n 1 55 PRO n 1 56 LYS n 1 57 SER n 1 58 GLU n 1 59 PRO n 1 60 ILE n 1 61 LYS n 1 62 VAL n 1 63 PRO n 1 64 GLY n 1 65 LYS n 1 66 CYS n 1 67 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 67 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Hottentotta jayakari' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 224597 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6OHX _struct_ref.pdbx_db_accession 6OHX _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6OHX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 67 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 6OHX _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 67 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 67 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC' 1 isotropic 3 1 1 '3D CBCA(CO)NH' 1 isotropic 4 1 1 '3D HNCO' 1 isotropic 5 1 1 '3D HNCACB' 1 isotropic 6 1 1 '3D HBHA(CO)NH' 1 isotropic 7 1 1 '3D 1H-15N NOESY' 1 isotropic 8 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 9 1 1 '3D 1H-13C NOESY aromatic' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '663 uM [U-13C; U-15N] Hj1a, 20 mM MES, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label Hj1a-CN _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 900 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 6OHX _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 6OHX _pdbx_nmr_ensemble.conformers_calculated_total_number 30 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6OHX _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CYANA ? 'Guntert, Mumenthaler and Wuthrich' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 4 'peak picking' 'CcpNmr Analysis' ? CCPN 5 'geometry optimization' TALOS ? 'Cornilescu, Delaglio and Bax' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6OHX _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6OHX _struct.title 'Solution structure of scorpion Hottentotta jayakari venom toxin Hj1a' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6OHX _struct_keywords.text 'Sodium-gated ion channel, TOXIN' _struct_keywords.pdbx_keywords TOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ARG _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 21 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 33 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ARG _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 21 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 33 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 66 SG ? ? A CYS 15 A CYS 66 1_555 ? ? ? ? ? ? ? 1.982 ? ? disulf2 disulf ? ? A CYS 19 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 19 A CYS 39 1_555 ? ? ? ? ? ? ? 2.000 ? ? disulf3 disulf ? ? A CYS 25 SG ? ? ? 1_555 A CYS 49 SG ? ? A CYS 25 A CYS 49 1_555 ? ? ? ? ? ? ? 1.994 ? ? disulf4 disulf ? ? A CYS 29 SG ? ? ? 1_555 A CYS 51 SG ? ? A CYS 29 A CYS 51 1_555 ? ? ? ? ? ? ? 1.978 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 4 ? ARG A 5 ? VAL A 4 ARG A 5 AA1 2 LEU A 54 ? PRO A 55 ? LEU A 54 PRO A 55 AA2 1 ALA A 10 ? GLN A 11 ? ALA A 10 GLN A 11 AA2 2 CYS A 15 ? VAL A 16 ? CYS A 15 VAL A 16 AA3 1 GLY A 37 ? LYS A 40 ? GLY A 37 LYS A 40 AA3 2 ALA A 48 ? CYS A 51 ? ALA A 48 CYS A 51 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 5 ? N ARG A 5 O LEU A 54 ? O LEU A 54 AA2 1 2 N GLN A 11 ? N GLN A 11 O CYS A 15 ? O CYS A 15 AA3 1 2 N GLU A 38 ? N GLU A 38 O TRP A 50 ? O TRP A 50 # _atom_sites.entry_id 6OHX _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 TRP 41 41 41 TRP TRP A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 TRP 50 50 50 TRP TRP A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 HIS 67 67 67 HIS HIS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 4830 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-02-12 2 'Structure model' 1 1 2020-04-22 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 2 'Structure model' '_citation.year' 7 2 'Structure model' '_citation_author.identifier_ORCID' 8 2 'Structure model' '_citation_author.name' 9 3 'Structure model' '_database_2.pdbx_DOI' 10 3 'Structure model' '_database_2.pdbx_database_accession' 11 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 Hj1a 663 ? uM '[U-13C; U-15N]' 1 MES 20 ? mM 'natural abundance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 13 ? ? -94.95 33.39 2 1 ASN A 14 ? ? 49.96 74.05 3 1 TYR A 17 ? ? -52.77 103.82 4 1 SER A 44 ? ? -88.10 30.75 5 1 LYS A 53 ? ? 38.86 42.32 6 2 HIS A 13 ? ? -94.91 33.49 7 2 ASN A 14 ? ? 50.13 73.73 8 2 TYR A 17 ? ? -57.41 101.71 9 2 LYS A 53 ? ? 38.80 42.45 10 2 LYS A 65 ? ? -176.48 132.81 11 3 HIS A 13 ? ? -95.02 33.62 12 3 ASN A 14 ? ? 50.16 74.24 13 3 TYR A 17 ? ? -59.93 106.86 14 3 SER A 44 ? ? -88.05 30.83 15 3 LYS A 53 ? ? 39.39 43.32 16 3 LYS A 65 ? ? -175.02 117.17 17 4 HIS A 13 ? ? -94.90 33.46 18 4 ASN A 14 ? ? 50.07 74.08 19 4 LYS A 53 ? ? 39.60 42.34 20 5 HIS A 13 ? ? -94.49 32.87 21 5 ASN A 14 ? ? 50.01 74.56 22 5 TYR A 17 ? ? -55.38 105.19 23 5 SER A 44 ? ? -88.02 31.30 24 5 LYS A 53 ? ? 38.65 42.96 25 5 LYS A 65 ? ? -174.75 117.81 26 6 HIS A 13 ? ? -94.77 33.41 27 6 ASN A 14 ? ? 49.96 74.43 28 6 SER A 44 ? ? -88.06 30.57 29 6 LYS A 53 ? ? 39.43 42.41 30 7 HIS A 13 ? ? -94.91 32.89 31 7 ASN A 14 ? ? 50.33 73.65 32 7 TYR A 17 ? ? -54.25 104.30 33 7 LYS A 53 ? ? 39.54 43.02 34 8 HIS A 13 ? ? -94.94 33.14 35 8 ASN A 14 ? ? 49.98 74.53 36 8 SER A 44 ? ? -88.03 30.93 37 8 LYS A 53 ? ? 38.56 42.45 38 9 GLN A 11 ? ? -49.01 159.01 39 9 HIS A 13 ? ? -94.35 31.77 40 9 ASN A 14 ? ? 49.10 74.22 41 9 TYR A 17 ? ? -65.55 98.09 42 9 SER A 44 ? ? -88.13 31.09 43 9 LYS A 53 ? ? 38.62 42.60 44 9 LYS A 65 ? ? -175.72 131.61 45 10 HIS A 13 ? ? -94.92 33.31 46 10 ASN A 14 ? ? 50.09 74.01 47 10 TYR A 17 ? ? -59.16 103.22 48 10 LYS A 53 ? ? 39.24 44.65 49 10 LYS A 65 ? ? -173.68 114.19 50 11 HIS A 13 ? ? -95.24 33.15 51 11 ASN A 14 ? ? 50.28 73.61 52 11 LYS A 53 ? ? 39.36 42.83 53 12 HIS A 13 ? ? -94.90 33.40 54 12 ASN A 14 ? ? 50.10 73.89 55 12 TYR A 17 ? ? -55.22 106.45 56 12 LYS A 53 ? ? 39.34 43.89 57 13 HIS A 13 ? ? -94.90 32.97 58 13 ASN A 14 ? ? 49.60 74.39 59 13 TYR A 17 ? ? -59.68 106.41 60 13 LYS A 53 ? ? 39.19 45.46 61 13 LYS A 65 ? ? -161.81 113.00 62 14 HIS A 13 ? ? -95.20 33.01 63 14 ASN A 14 ? ? 50.39 73.96 64 14 LYS A 53 ? ? 39.48 42.67 65 15 GLN A 11 ? ? -50.00 157.74 66 15 HIS A 13 ? ? -94.84 33.01 67 15 ASN A 14 ? ? 49.58 74.83 68 15 LYS A 53 ? ? 39.34 44.40 69 16 HIS A 13 ? ? -94.89 33.21 70 16 ASN A 14 ? ? 50.10 74.39 71 16 LYS A 53 ? ? 39.27 44.82 72 17 HIS A 13 ? ? -94.80 32.60 73 17 ASN A 14 ? ? 49.80 74.00 74 17 TYR A 17 ? ? -53.20 104.83 75 17 SER A 44 ? ? -88.05 30.86 76 17 LYS A 53 ? ? 39.41 42.87 77 17 LYS A 65 ? ? -164.36 114.73 78 18 HIS A 13 ? ? -94.64 33.09 79 18 ASN A 14 ? ? 50.07 74.10 80 18 LYS A 53 ? ? 39.43 42.70 81 18 LYS A 65 ? ? -175.45 114.24 82 19 HIS A 13 ? ? -95.08 33.50 83 19 ASN A 14 ? ? 49.94 74.40 84 19 LYS A 53 ? ? 39.40 42.59 85 20 HIS A 13 ? ? -95.26 32.77 86 20 ASN A 14 ? ? 50.03 74.01 87 20 TYR A 17 ? ? -53.46 102.34 88 20 LYS A 53 ? ? 38.94 41.99 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #