data_6OK9 # _entry.id 6OK9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.314 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6OK9 WWPDB D_1000238587 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2019-08-28 _pdbx_database_PDB_obs_spr.pdb_id 6U0W _pdbx_database_PDB_obs_spr.replace_pdb_id 6OK9 _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code OBS _pdbx_database_status.status_code_sf OBS _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6OK9 _pdbx_database_status.recvd_initial_deposition_date 2019-04-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jeliazkov, J.R.' 1 ? 'Robinson, A.C.' 2 ? 'Berger, J.M.' 3 ? 'Garcia-Moreno E., B.' 4 ? 'Gray, J.G.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of Staphylococcal nuclease variant Delta+PHS K133M at cryogenic temperature' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jeliazkov, J.R.' 1 0000-0003-4249-1955 primary 'Robinson, A.C.' 2 0000-0001-6410-7147 primary 'Berger, J.M.' 3 0000-0003-0666-1240 primary 'Garcia-Moreno E, B.' 4 0000-0003-4304-2238 primary 'Gray, J.G.' 5 0000-0001-6380-2324 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 93.020 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6OK9 _cell.details ? _cell.formula_units_Z ? _cell.length_a 30.927 _cell.length_a_esd ? _cell.length_b 60.473 _cell.length_b_esd ? _cell.length_c 38.105 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6OK9 _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Thermonuclease 16145.479 1 3.1.31.1 G50F/V51N/P117G/H124L/S128A/K133M/Del44-49 'UNP residues 83-231' ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 3 non-polymer syn "THYMIDINE-3',5'-DIPHOSPHATE" 402.188 1 ? ? ? ? 4 water nat water 18.015 39 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'TNase, Micrococcal nuclease, Staphylococcal nuclease' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYG RGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAMKEKLNIWSEDNADSGQ ; _entity_poly.pdbx_seq_one_letter_code_can ;ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYG RGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAMKEKLNIWSEDNADSGQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 THR n 1 3 SER n 1 4 THR n 1 5 LYS n 1 6 LYS n 1 7 LEU n 1 8 HIS n 1 9 LYS n 1 10 GLU n 1 11 PRO n 1 12 ALA n 1 13 THR n 1 14 LEU n 1 15 ILE n 1 16 LYS n 1 17 ALA n 1 18 ILE n 1 19 ASP n 1 20 GLY n 1 21 ASP n 1 22 THR n 1 23 VAL n 1 24 LYS n 1 25 LEU n 1 26 MET n 1 27 TYR n 1 28 LYS n 1 29 GLY n 1 30 GLN n 1 31 PRO n 1 32 MET n 1 33 THR n 1 34 PHE n 1 35 ARG n 1 36 LEU n 1 37 LEU n 1 38 LEU n 1 39 VAL n 1 40 ASP n 1 41 THR n 1 42 PRO n 1 43 GLU n 1 44 PHE n 1 45 ASN n 1 46 GLU n 1 47 LYS n 1 48 TYR n 1 49 GLY n 1 50 PRO n 1 51 GLU n 1 52 ALA n 1 53 SER n 1 54 ALA n 1 55 PHE n 1 56 THR n 1 57 LYS n 1 58 LYS n 1 59 MET n 1 60 VAL n 1 61 GLU n 1 62 ASN n 1 63 ALA n 1 64 LYS n 1 65 LYS n 1 66 ILE n 1 67 GLU n 1 68 VAL n 1 69 GLU n 1 70 PHE n 1 71 ASP n 1 72 LYS n 1 73 GLY n 1 74 GLN n 1 75 ARG n 1 76 THR n 1 77 ASP n 1 78 LYS n 1 79 TYR n 1 80 GLY n 1 81 ARG n 1 82 GLY n 1 83 LEU n 1 84 ALA n 1 85 TYR n 1 86 ILE n 1 87 TYR n 1 88 ALA n 1 89 ASP n 1 90 GLY n 1 91 LYS n 1 92 MET n 1 93 VAL n 1 94 ASN n 1 95 GLU n 1 96 ALA n 1 97 LEU n 1 98 VAL n 1 99 ARG n 1 100 GLN n 1 101 GLY n 1 102 LEU n 1 103 ALA n 1 104 LYS n 1 105 VAL n 1 106 ALA n 1 107 TYR n 1 108 VAL n 1 109 TYR n 1 110 LYS n 1 111 GLY n 1 112 ASN n 1 113 ASN n 1 114 THR n 1 115 HIS n 1 116 GLU n 1 117 GLN n 1 118 LEU n 1 119 LEU n 1 120 ARG n 1 121 LYS n 1 122 ALA n 1 123 GLU n 1 124 ALA n 1 125 GLN n 1 126 ALA n 1 127 MET n 1 128 LYS n 1 129 GLU n 1 130 LYS n 1 131 LEU n 1 132 ASN n 1 133 ILE n 1 134 TRP n 1 135 SER n 1 136 GLU n 1 137 ASP n 1 138 ASN n 1 139 ALA n 1 140 ASP n 1 141 SER n 1 142 GLY n 1 143 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 143 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene nuc _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1280 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET24a+ _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NUC_STAAU _struct_ref.pdbx_db_accession P00644 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQ RTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWSEDNADSGQ ; _struct_ref.pdbx_align_begin 83 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6OK9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 143 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00644 _struct_ref_seq.db_align_beg 83 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 231 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 149 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6OK9 ? A ? ? UNP P00644 THR 126 deletion ? 1 1 6OK9 ? A ? ? UNP P00644 LYS 127 deletion ? 2 1 6OK9 ? A ? ? UNP P00644 HIS 128 deletion ? 3 1 6OK9 ? A ? ? UNP P00644 PRO 129 deletion ? 4 1 6OK9 ? A ? ? UNP P00644 LYS 130 deletion ? 5 1 6OK9 ? A ? ? UNP P00644 LYS 131 deletion ? 6 1 6OK9 PHE A 44 ? UNP P00644 GLY 132 'engineered mutation' 50 7 1 6OK9 ASN A 45 ? UNP P00644 VAL 133 'engineered mutation' 51 8 1 6OK9 GLY A 111 ? UNP P00644 PRO 199 'engineered mutation' 117 9 1 6OK9 LEU A 118 ? UNP P00644 HIS 206 'engineered mutation' 124 10 1 6OK9 ALA A 122 ? UNP P00644 SER 210 'engineered mutation' 128 11 1 6OK9 MET A 127 ? UNP P00644 LYS 215 'engineered mutation' 133 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THP 'DNA linking' . "THYMIDINE-3',5'-DIPHOSPHATE" ? 'C10 H16 N2 O11 P2' 402.188 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6OK9 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.20 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.19 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '22% MPD, 25 mM potassium phosphate, calcium chloride, THP' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 77 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 200K' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-04-02 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU FR-E SUPERBRIGHT' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 36.678 _reflns.entry_id 6OK9 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.900 _reflns.d_resolution_low 38.050 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10692 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.300 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.107 _reflns.pdbx_Rmerge_I_obs 0.024 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 25.840 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.010 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.028 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.900 1.950 ? 3.840 ? ? ? ? 627 77.000 ? ? ? ? 0.169 ? ? ? ? ? ? ? ? 1.766 ? ? ? ? 0.223 ? ? 1 1 0.984 ? 1.950 2.000 ? 5.550 ? ? ? ? 759 95.200 ? ? ? ? 0.167 ? ? ? ? ? ? ? ? 2.436 ? ? ? ? 0.210 ? ? 2 1 0.979 ? 2.000 2.060 ? 10.110 ? ? ? ? 770 98.600 ? ? ? ? 0.088 ? ? ? ? ? ? ? ? 2.949 ? ? ? ? 0.106 ? ? 3 1 0.996 ? 2.060 2.130 ? 11.620 ? ? ? ? 745 99.100 ? ? ? ? 0.083 ? ? ? ? ? ? ? ? 3.008 ? ? ? ? 0.101 ? ? 4 1 0.996 ? 2.130 2.200 ? 13.810 ? ? ? ? 723 99.200 ? ? ? ? 0.064 ? ? ? ? ? ? ? ? 3.127 ? ? ? ? 0.076 ? ? 5 1 0.998 ? 2.200 2.270 ? 16.080 ? ? ? ? 680 97.000 ? ? ? ? 0.065 ? ? ? ? ? ? ? ? 3.185 ? ? ? ? 0.078 ? ? 6 1 0.998 ? 2.270 2.360 ? 18.430 ? ? ? ? 657 96.300 ? ? ? ? 0.050 ? ? ? ? ? ? ? ? 3.247 ? ? ? ? 0.060 ? ? 7 1 0.999 ? 2.360 2.450 ? 21.780 ? ? ? ? 631 96.900 ? ? ? ? 0.043 ? ? ? ? ? ? ? ? 3.372 ? ? ? ? 0.052 ? ? 8 1 0.999 ? 2.450 2.560 ? 24.560 ? ? ? ? 602 95.600 ? ? ? ? 0.035 ? ? ? ? ? ? ? ? 3.435 ? ? ? ? 0.042 ? ? 9 1 0.999 ? 2.560 2.690 ? 28.010 ? ? ? ? 589 98.200 ? ? ? ? 0.031 ? ? ? ? ? ? ? ? 3.433 ? ? ? ? 0.037 ? ? 10 1 0.999 ? 2.690 2.830 ? 29.420 ? ? ? ? 559 96.200 ? ? ? ? 0.031 ? ? ? ? ? ? ? ? 3.444 ? ? ? ? 0.037 ? ? 11 1 0.999 ? 2.830 3.010 ? 34.370 ? ? ? ? 530 98.100 ? ? ? ? 0.027 ? ? ? ? ? ? ? ? 3.460 ? ? ? ? 0.031 ? ? 12 1 0.999 ? 3.010 3.210 ? 39.170 ? ? ? ? 512 99.000 ? ? ? ? 0.023 ? ? ? ? ? ? ? ? 3.418 ? ? ? ? 0.027 ? ? 13 1 0.999 ? 3.210 3.470 ? 44.190 ? ? ? ? 468 98.700 ? ? ? ? 0.020 ? ? ? ? ? ? ? ? 3.385 ? ? ? ? 0.024 ? ? 14 1 0.999 ? 3.470 3.800 ? 50.490 ? ? ? ? 435 99.100 ? ? ? ? 0.020 ? ? ? ? ? ? ? ? 3.320 ? ? ? ? 0.023 ? ? 15 1 0.999 ? 3.800 4.250 ? 52.980 ? ? ? ? 400 99.500 ? ? ? ? 0.018 ? ? ? ? ? ? ? ? 3.277 ? ? ? ? 0.021 ? ? 16 1 0.999 ? 4.250 4.910 ? 56.680 ? ? ? ? 344 99.400 ? ? ? ? 0.017 ? ? ? ? ? ? ? ? 3.276 ? ? ? ? 0.020 ? ? 17 1 1.000 ? 4.910 6.010 ? 55.860 ? ? ? ? 297 98.700 ? ? ? ? 0.018 ? ? ? ? ? ? ? ? 3.141 ? ? ? ? 0.021 ? ? 18 1 0.999 ? 6.010 8.500 ? 55.270 ? ? ? ? 231 99.100 ? ? ? ? 0.019 ? ? ? ? ? ? ? ? 2.913 ? ? ? ? 0.024 ? ? 19 1 0.999 ? 8.500 38.050 ? 57.990 ? ? ? ? 133 98.500 ? ? ? ? 0.017 ? ? ? ? ? ? ? ? 2.925 ? ? ? ? 0.020 ? ? 20 1 0.999 ? # _refine.aniso_B[1][1] -4.2200 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 1.5800 _refine.aniso_B[2][2] -1.4900 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 5.5100 _refine.B_iso_max 68.360 _refine.B_iso_mean 37.0450 _refine.B_iso_min 22.540 _refine.correlation_coeff_Fo_to_Fc 0.9570 _refine.correlation_coeff_Fo_to_Fc_free 0.9490 _refine.details 'U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6OK9 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.9000 _refine.ls_d_res_low 38.0500 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10168 _refine.ls_number_reflns_R_free 538 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.3200 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2239 _refine.ls_R_factor_R_free 0.2617 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2219 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB entry 3BDC' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.1830 _refine.pdbx_overall_ESU_R_Free 0.1650 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 6.1860 _refine.overall_SU_ML 0.1650 _refine.overall_SU_R_Cruickshank_DPI 0.1834 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.9000 _refine_hist.d_res_low 38.0500 _refine_hist.number_atoms_solvent 39 _refine_hist.number_atoms_total 1058 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 129 _refine_hist.pdbx_B_iso_mean_ligand 39.33 _refine_hist.pdbx_B_iso_mean_solvent 37.19 _refine_hist.pdbx_number_atoms_protein 993 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 26 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.012 0.019 1037 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 1.582 1.994 1408 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 6.376 5.000 128 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 36.253 24.783 46 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.908 15.000 170 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 11.627 15.000 5 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.093 0.200 155 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.021 777 ? r_gen_planes_refined ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.9010 _refine_ls_shell.d_res_low 1.9500 _refine_ls_shell.number_reflns_all 621 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 30 _refine_ls_shell.number_reflns_R_work 591 _refine_ls_shell.percent_reflns_obs 75.7300 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.4990 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3820 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6OK9 _struct.title 'Crystal structure of Staphylococcal nuclease variant Delta+PHS K133M at cryogenic temperature' _struct.pdbx_descriptor 'Thermonuclease (E.C.3.1.31.1)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6OK9 _struct_keywords.text 'nuclease, hyperstable, pdTp, hydrolase' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 TYR A 48 ? ASN A 62 ? TYR A 54 ASN A 68 1 ? 15 HELX_P HELX_P2 AA2 VAL A 93 ? GLN A 100 ? VAL A 99 GLN A 106 1 ? 8 HELX_P HELX_P3 AA3 HIS A 115 ? GLU A 129 ? HIS A 121 GLU A 135 1 ? 15 HELX_P HELX_P4 AA4 LEU A 131 ? SER A 135 ? LEU A 137 SER A 141 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A ASP 21 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 21 A CA 201 1_555 ? ? ? ? ? ? ? 2.915 ? metalc2 metalc ? ? A ASP 40 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 40 A CA 201 1_555 ? ? ? ? ? ? ? 2.719 ? metalc3 metalc ? ? A THR 41 O ? ? ? 1_555 B CA . CA ? ? A THR 41 A CA 201 1_555 ? ? ? ? ? ? ? 2.763 ? metalc4 metalc ? ? A GLU 43 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 43 A CA 201 1_555 ? ? ? ? ? ? ? 3.027 ? metalc5 metalc ? ? B CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 201 A HOH 304 1_555 ? ? ? ? ? ? ? 2.916 ? metalc6 metalc ? ? B CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 201 A HOH 319 1_555 ? ? ? ? ? ? ? 2.817 ? metalc7 metalc ? ? B CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 201 A HOH 327 1_555 ? ? ? ? ? ? ? 2.989 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 91 ? MET A 92 ? LYS A 97 MET A 98 AA1 2 GLY A 82 ? ALA A 88 ? GLY A 88 ALA A 94 AA1 3 ILE A 66 ? GLU A 69 ? ILE A 72 GLU A 75 AA1 4 GLU A 10 ? ASP A 19 ? GLU A 10 ASP A 19 AA1 5 THR A 22 ? TYR A 27 ? THR A 22 TYR A 27 AA1 6 GLN A 30 ? LEU A 36 ? GLN A 30 LEU A 36 AA1 7 GLY A 82 ? ALA A 88 ? GLY A 88 ALA A 94 AA2 1 VAL A 39 ? ASP A 40 ? VAL A 39 ASP A 40 AA2 2 LYS A 104 ? VAL A 105 ? LYS A 110 VAL A 111 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LYS A 91 ? O LYS A 97 N ALA A 88 ? N ALA A 94 AA1 2 3 O TYR A 87 ? O TYR A 93 N GLU A 67 ? N GLU A 73 AA1 3 4 O VAL A 68 ? O VAL A 74 N GLU A 10 ? N GLU A 10 AA1 4 5 N LYS A 16 ? N LYS A 16 O LYS A 24 ? O LYS A 24 AA1 5 6 N VAL A 23 ? N VAL A 23 O PHE A 34 ? O PHE A 34 AA1 6 7 N ARG A 35 ? N ARG A 35 O GLY A 82 ? O GLY A 88 AA2 1 2 N ASP A 40 ? N ASP A 40 O LYS A 104 ? O LYS A 110 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 201 ? 8 'binding site for residue CA A 201' AC2 Software A THP 202 ? 13 'binding site for residue THP A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 ASP A 21 ? ASP A 21 . ? 1_555 ? 2 AC1 8 ASP A 40 ? ASP A 40 . ? 1_555 ? 3 AC1 8 THR A 41 ? THR A 41 . ? 1_555 ? 4 AC1 8 GLU A 43 ? GLU A 43 . ? 1_555 ? 5 AC1 8 THP C . ? THP A 202 . ? 1_555 ? 6 AC1 8 HOH D . ? HOH A 304 . ? 1_555 ? 7 AC1 8 HOH D . ? HOH A 319 . ? 1_555 ? 8 AC1 8 HOH D . ? HOH A 327 . ? 1_555 ? 9 AC2 13 ARG A 35 ? ARG A 35 . ? 1_555 ? 10 AC2 13 LEU A 37 ? LEU A 37 . ? 1_555 ? 11 AC2 13 ASP A 40 ? ASP A 40 . ? 1_555 ? 12 AC2 13 LYS A 78 ? LYS A 84 . ? 1_555 ? 13 AC2 13 TYR A 79 ? TYR A 85 . ? 1_555 ? 14 AC2 13 ARG A 81 ? ARG A 87 . ? 1_555 ? 15 AC2 13 LEU A 83 ? LEU A 89 . ? 1_555 ? 16 AC2 13 TYR A 107 ? TYR A 113 . ? 1_555 ? 17 AC2 13 TYR A 109 ? TYR A 115 . ? 1_555 ? 18 AC2 13 LYS A 121 ? LYS A 127 . ? 1_655 ? 19 AC2 13 CA B . ? CA A 201 . ? 1_555 ? 20 AC2 13 HOH D . ? HOH A 304 . ? 1_555 ? 21 AC2 13 HOH D . ? HOH A 308 . ? 1_555 ? # _atom_sites.entry_id 6OK9 _atom_sites.fract_transf_matrix[1][1] 0.032334 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.001704 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016536 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.026280 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CA N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 LYS 5 5 ? ? ? A . n A 1 6 LYS 6 6 ? ? ? A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 MET 32 32 32 MET MET A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 PHE 44 50 50 PHE PHE A . n A 1 45 ASN 45 51 51 ASN ASN A . n A 1 46 GLU 46 52 52 GLU GLU A . n A 1 47 LYS 47 53 53 LYS LYS A . n A 1 48 TYR 48 54 54 TYR TYR A . n A 1 49 GLY 49 55 55 GLY GLY A . n A 1 50 PRO 50 56 56 PRO PRO A . n A 1 51 GLU 51 57 57 GLU GLU A . n A 1 52 ALA 52 58 58 ALA ALA A . n A 1 53 SER 53 59 59 SER SER A . n A 1 54 ALA 54 60 60 ALA ALA A . n A 1 55 PHE 55 61 61 PHE PHE A . n A 1 56 THR 56 62 62 THR THR A . n A 1 57 LYS 57 63 63 LYS LYS A . n A 1 58 LYS 58 64 64 LYS LYS A . n A 1 59 MET 59 65 65 MET MET A . n A 1 60 VAL 60 66 66 VAL VAL A . n A 1 61 GLU 61 67 67 GLU GLU A . n A 1 62 ASN 62 68 68 ASN ASN A . n A 1 63 ALA 63 69 69 ALA ALA A . n A 1 64 LYS 64 70 70 LYS LYS A . n A 1 65 LYS 65 71 71 LYS LYS A . n A 1 66 ILE 66 72 72 ILE ILE A . n A 1 67 GLU 67 73 73 GLU GLU A . n A 1 68 VAL 68 74 74 VAL VAL A . n A 1 69 GLU 69 75 75 GLU GLU A . n A 1 70 PHE 70 76 76 PHE PHE A . n A 1 71 ASP 71 77 77 ASP ASP A . n A 1 72 LYS 72 78 78 LYS LYS A . n A 1 73 GLY 73 79 79 GLY GLY A . n A 1 74 GLN 74 80 80 GLN GLN A . n A 1 75 ARG 75 81 81 ARG ARG A . n A 1 76 THR 76 82 82 THR THR A . n A 1 77 ASP 77 83 83 ASP ASP A . n A 1 78 LYS 78 84 84 LYS LYS A . n A 1 79 TYR 79 85 85 TYR TYR A . n A 1 80 GLY 80 86 86 GLY GLY A . n A 1 81 ARG 81 87 87 ARG ARG A . n A 1 82 GLY 82 88 88 GLY GLY A . n A 1 83 LEU 83 89 89 LEU LEU A . n A 1 84 ALA 84 90 90 ALA ALA A . n A 1 85 TYR 85 91 91 TYR TYR A . n A 1 86 ILE 86 92 92 ILE ILE A . n A 1 87 TYR 87 93 93 TYR TYR A . n A 1 88 ALA 88 94 94 ALA ALA A . n A 1 89 ASP 89 95 95 ASP ASP A . n A 1 90 GLY 90 96 96 GLY GLY A . n A 1 91 LYS 91 97 97 LYS LYS A . n A 1 92 MET 92 98 98 MET MET A . n A 1 93 VAL 93 99 99 VAL VAL A . n A 1 94 ASN 94 100 100 ASN ASN A . n A 1 95 GLU 95 101 101 GLU GLU A . n A 1 96 ALA 96 102 102 ALA ALA A . n A 1 97 LEU 97 103 103 LEU LEU A . n A 1 98 VAL 98 104 104 VAL VAL A . n A 1 99 ARG 99 105 105 ARG ARG A . n A 1 100 GLN 100 106 106 GLN GLN A . n A 1 101 GLY 101 107 107 GLY GLY A . n A 1 102 LEU 102 108 108 LEU LEU A . n A 1 103 ALA 103 109 109 ALA ALA A . n A 1 104 LYS 104 110 110 LYS LYS A . n A 1 105 VAL 105 111 111 VAL VAL A . n A 1 106 ALA 106 112 112 ALA ALA A . n A 1 107 TYR 107 113 113 TYR TYR A . n A 1 108 VAL 108 114 114 VAL VAL A . n A 1 109 TYR 109 115 115 TYR TYR A . n A 1 110 LYS 110 116 116 LYS LYS A . n A 1 111 GLY 111 117 117 GLY GLY A . n A 1 112 ASN 112 118 118 ASN ASN A . n A 1 113 ASN 113 119 119 ASN ASN A . n A 1 114 THR 114 120 120 THR THR A . n A 1 115 HIS 115 121 121 HIS HIS A . n A 1 116 GLU 116 122 122 GLU GLU A . n A 1 117 GLN 117 123 123 GLN GLN A . n A 1 118 LEU 118 124 124 LEU LEU A . n A 1 119 LEU 119 125 125 LEU LEU A . n A 1 120 ARG 120 126 126 ARG ARG A . n A 1 121 LYS 121 127 127 LYS LYS A . n A 1 122 ALA 122 128 128 ALA ALA A . n A 1 123 GLU 123 129 129 GLU GLU A . n A 1 124 ALA 124 130 130 ALA ALA A . n A 1 125 GLN 125 131 131 GLN GLN A . n A 1 126 ALA 126 132 132 ALA ALA A . n A 1 127 MET 127 133 133 MET MET A . n A 1 128 LYS 128 134 134 LYS LYS A . n A 1 129 GLU 129 135 135 GLU GLU A . n A 1 130 LYS 130 136 136 LYS LYS A . n A 1 131 LEU 131 137 137 LEU LEU A . n A 1 132 ASN 132 138 138 ASN ASN A . n A 1 133 ILE 133 139 139 ILE ILE A . n A 1 134 TRP 134 140 140 TRP TRP A . n A 1 135 SER 135 141 141 SER SER A . n A 1 136 GLU 136 142 ? ? ? A . n A 1 137 ASP 137 143 ? ? ? A . n A 1 138 ASN 138 144 ? ? ? A . n A 1 139 ALA 139 145 ? ? ? A . n A 1 140 ASP 140 146 ? ? ? A . n A 1 141 SER 141 147 ? ? ? A . n A 1 142 GLY 142 148 ? ? ? A . n A 1 143 GLN 143 149 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 201 150 CA CA A . C 3 THP 1 202 151 THP THP A . D 4 HOH 1 301 9 HOH HOH A . D 4 HOH 2 302 4 HOH HOH A . D 4 HOH 3 303 22 HOH HOH A . D 4 HOH 4 304 5 HOH HOH A . D 4 HOH 5 305 10 HOH HOH A . D 4 HOH 6 306 35 HOH HOH A . D 4 HOH 7 307 13 HOH HOH A . D 4 HOH 8 308 3 HOH HOH A . D 4 HOH 9 309 39 HOH HOH A . D 4 HOH 10 310 19 HOH HOH A . D 4 HOH 11 311 11 HOH HOH A . D 4 HOH 12 312 15 HOH HOH A . D 4 HOH 13 313 33 HOH HOH A . D 4 HOH 14 314 2 HOH HOH A . D 4 HOH 15 315 28 HOH HOH A . D 4 HOH 16 316 17 HOH HOH A . D 4 HOH 17 317 18 HOH HOH A . D 4 HOH 18 318 8 HOH HOH A . D 4 HOH 19 319 1 HOH HOH A . D 4 HOH 20 320 7 HOH HOH A . D 4 HOH 21 321 12 HOH HOH A . D 4 HOH 22 322 29 HOH HOH A . D 4 HOH 23 323 21 HOH HOH A . D 4 HOH 24 324 25 HOH HOH A . D 4 HOH 25 325 27 HOH HOH A . D 4 HOH 26 326 20 HOH HOH A . D 4 HOH 27 327 30 HOH HOH A . D 4 HOH 28 328 16 HOH HOH A . D 4 HOH 29 329 34 HOH HOH A . D 4 HOH 30 330 14 HOH HOH A . D 4 HOH 31 331 38 HOH HOH A . D 4 HOH 32 332 6 HOH HOH A . D 4 HOH 33 333 26 HOH HOH A . D 4 HOH 34 334 32 HOH HOH A . D 4 HOH 35 335 37 HOH HOH A . D 4 HOH 36 336 36 HOH HOH A . D 4 HOH 37 337 23 HOH HOH A . D 4 HOH 38 338 31 HOH HOH A . D 4 HOH 39 339 24 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 830 ? 1 MORE -12 ? 1 'SSA (A^2)' 6470 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASP 40 ? A ASP 40 ? 1_555 82.2 ? 2 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A THR 41 ? A THR 41 ? 1_555 92.2 ? 3 OD1 ? A ASP 40 ? A ASP 40 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A THR 41 ? A THR 41 ? 1_555 81.1 ? 4 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 43 ? A GLU 43 ? 1_555 144.7 ? 5 OD1 ? A ASP 40 ? A ASP 40 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 43 ? A GLU 43 ? 1_555 130.8 ? 6 O ? A THR 41 ? A THR 41 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 43 ? A GLU 43 ? 1_555 103.7 ? 7 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 304 ? 1_555 73.6 ? 8 OD1 ? A ASP 40 ? A ASP 40 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 304 ? 1_555 132.2 ? 9 O ? A THR 41 ? A THR 41 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 304 ? 1_555 139.1 ? 10 OE1 ? A GLU 43 ? A GLU 43 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 304 ? 1_555 73.8 ? 11 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 319 ? 1_555 81.5 ? 12 OD1 ? A ASP 40 ? A ASP 40 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 319 ? 1_555 143.3 ? 13 O ? A THR 41 ? A THR 41 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 319 ? 1_555 67.0 ? 14 OE1 ? A GLU 43 ? A GLU 43 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 319 ? 1_555 76.4 ? 15 O ? D HOH . ? A HOH 304 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 319 ? 1_555 73.0 ? 16 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 327 ? 1_555 135.2 ? 17 OD1 ? A ASP 40 ? A ASP 40 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 327 ? 1_555 62.6 ? 18 O ? A THR 41 ? A THR 41 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 327 ? 1_555 57.5 ? 19 OE1 ? A GLU 43 ? A GLU 43 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 327 ? 1_555 78.8 ? 20 O ? D HOH . ? A HOH 304 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 327 ? 1_555 150.9 ? 21 O ? D HOH . ? A HOH 319 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 327 ? 1_555 110.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-05-08 2 'Structure model' 1 1 2019-08-28 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 2 'Structure model' repository Obsolete ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Data collection' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_database_PDB_obs_spr 2 2 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_database_status.status_code' 2 2 'Structure model' '_pdbx_database_status.status_code_sf' # _pdbx_phasing_MR.entry_id 6OK9 _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 4.470 _pdbx_phasing_MR.d_res_low_rotation 32.210 _pdbx_phasing_MR.d_res_high_translation 4.470 _pdbx_phasing_MR.d_res_low_translation 32.210 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? . 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.1 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 18 ? ? -122.48 -70.20 2 1 ASP A 19 ? ? -147.19 -155.58 3 1 LEU A 38 ? ? 80.33 12.93 4 1 TYR A 54 ? ? 69.19 -6.40 5 1 ASN A 119 ? ? -149.14 18.30 6 1 ASN A 138 ? ? 42.39 -98.93 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 16 ? CD ? A LYS 16 CD 2 1 Y 1 A LYS 16 ? CE ? A LYS 16 CE 3 1 Y 1 A LYS 16 ? NZ ? A LYS 16 NZ 4 1 Y 1 A LYS 53 ? CG ? A LYS 47 CG 5 1 Y 1 A LYS 53 ? CD ? A LYS 47 CD 6 1 Y 1 A LYS 53 ? CE ? A LYS 47 CE 7 1 Y 1 A LYS 53 ? NZ ? A LYS 47 NZ 8 1 Y 1 A LYS 64 ? CG ? A LYS 58 CG 9 1 Y 1 A LYS 64 ? CD ? A LYS 58 CD 10 1 Y 1 A LYS 64 ? CE ? A LYS 58 CE 11 1 Y 1 A LYS 64 ? NZ ? A LYS 58 NZ 12 1 Y 1 A LYS 70 ? CG ? A LYS 64 CG 13 1 Y 1 A LYS 70 ? CD ? A LYS 64 CD 14 1 Y 1 A LYS 70 ? CE ? A LYS 64 CE 15 1 Y 1 A LYS 70 ? NZ ? A LYS 64 NZ 16 1 Y 1 A LYS 78 ? CG ? A LYS 72 CG 17 1 Y 1 A LYS 78 ? CD ? A LYS 72 CD 18 1 Y 1 A LYS 78 ? CE ? A LYS 72 CE 19 1 Y 1 A LYS 78 ? NZ ? A LYS 72 NZ 20 1 Y 1 A GLN 80 ? CG ? A GLN 74 CG 21 1 Y 1 A GLN 80 ? CD ? A GLN 74 CD 22 1 Y 1 A GLN 80 ? OE1 ? A GLN 74 OE1 23 1 Y 1 A GLN 80 ? NE2 ? A GLN 74 NE2 24 1 Y 1 A LYS 97 ? CG ? A LYS 91 CG 25 1 Y 1 A LYS 97 ? CD ? A LYS 91 CD 26 1 Y 1 A LYS 97 ? CE ? A LYS 91 CE 27 1 Y 1 A LYS 97 ? NZ ? A LYS 91 NZ 28 1 Y 1 A LYS 116 ? CG ? A LYS 110 CG 29 1 Y 1 A LYS 116 ? CD ? A LYS 110 CD 30 1 Y 1 A LYS 116 ? CE ? A LYS 110 CE 31 1 Y 1 A LYS 116 ? NZ ? A LYS 110 NZ 32 1 Y 1 A LYS 134 ? CG ? A LYS 128 CG 33 1 Y 1 A LYS 134 ? CD ? A LYS 128 CD 34 1 Y 1 A LYS 134 ? CE ? A LYS 128 CE 35 1 Y 1 A LYS 134 ? NZ ? A LYS 128 NZ 36 1 Y 1 A LYS 136 ? CG ? A LYS 130 CG 37 1 Y 1 A LYS 136 ? CD ? A LYS 130 CD 38 1 Y 1 A LYS 136 ? CE ? A LYS 130 CE 39 1 Y 1 A LYS 136 ? NZ ? A LYS 130 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 1 ? A ALA 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A LYS 5 ? A LYS 5 6 1 Y 1 A LYS 6 ? A LYS 6 7 1 Y 1 A GLU 142 ? A GLU 136 8 1 Y 1 A ASP 143 ? A ASP 137 9 1 Y 1 A ASN 144 ? A ASN 138 10 1 Y 1 A ALA 145 ? A ALA 139 11 1 Y 1 A ASP 146 ? A ASP 140 12 1 Y 1 A SER 147 ? A SER 141 13 1 Y 1 A GLY 148 ? A GLY 142 14 1 Y 1 A GLN 149 ? A GLN 143 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number GM123616 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 "THYMIDINE-3',5'-DIPHOSPHATE" THP 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #