data_6ONP # _entry.id 6ONP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.321 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6ONP WWPDB D_1000240727 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6ONP _pdbx_database_status.recvd_initial_deposition_date 2019-04-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Rose, H.R.' 1 0000-0002-7982-2001 'Taylor, E.M.' 2 ? 'Boal, A.K.' 3 0000-0002-1234-8472 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country GE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Chembiochem _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1439-7633 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 20 _citation.language ? _citation.page_first 2360 _citation.page_last 2372 _citation.title ;Biochemical and Structural Characterization of XoxG and XoxJ and Their Roles in Lanthanide-Dependent Methanol Dehydrogenase Activity. ; _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/cbic.201900184 _citation.pdbx_database_id_PubMed 31017712 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Featherston, E.R.' 1 ? primary 'Rose, H.R.' 2 ? primary 'McBride, M.J.' 3 ? primary 'Taylor, E.M.' 4 ? primary 'Boal, A.K.' 5 ? primary 'Cotruvo Jr., J.A.' 6 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 98.237 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6ONP _cell.details ? _cell.formula_units_Z ? _cell.length_a 49.900 _cell.length_a_esd ? _cell.length_b 51.759 _cell.length_b_esd ? _cell.length_c 51.241 _cell.length_c_esd ? _cell.volume 130978.657 _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6ONP _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall 'P 2yb' _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'periplasmic binding protein XoxJ' 31127.719 1 ? ? ? ? 2 non-polymer syn 1,2-ETHANEDIOL 62.068 2 ? ? ? ? 3 water nat water 18.015 42 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTRSSAPVSVAVAALLLSAGARPAHAQHLPDLVTQDVLRVCSDPGNMPFSERKGGGFENKIAQIVADELKVKLRYYWLTQ GPGFVRNTLGTGLCDLIIGTSGGDIVQATNPYYRSAYVLVARKGELADLKRLDDPRLKDRQIGIIAGTPPSNRLSELKLV GERIHAYAPYAFGAERKHQTVAAEVIADLAEKKIDVAILWGPAAGWLAKQSGVPMDVVPLLHEPGRPPLTFRVSMGVRHN ENDWKRSLNTVLRKRKADIEAVLREYEVPLLAEEDTKPLDAADE ; _entity_poly.pdbx_seq_one_letter_code_can ;MTRSSAPVSVAVAALLLSAGARPAHAQHLPDLVTQDVLRVCSDPGNMPFSERKGGGFENKIAQIVADELKVKLRYYWLTQ GPGFVRNTLGTGLCDLIIGTSGGDIVQATNPYYRSAYVLVARKGELADLKRLDDPRLKDRQIGIIAGTPPSNRLSELKLV GERIHAYAPYAFGAERKHQTVAAEVIADLAEKKIDVAILWGPAAGWLAKQSGVPMDVVPLLHEPGRPPLTFRVSMGVRHN ENDWKRSLNTVLRKRKADIEAVLREYEVPLLAEEDTKPLDAADE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 ARG n 1 4 SER n 1 5 SER n 1 6 ALA n 1 7 PRO n 1 8 VAL n 1 9 SER n 1 10 VAL n 1 11 ALA n 1 12 VAL n 1 13 ALA n 1 14 ALA n 1 15 LEU n 1 16 LEU n 1 17 LEU n 1 18 SER n 1 19 ALA n 1 20 GLY n 1 21 ALA n 1 22 ARG n 1 23 PRO n 1 24 ALA n 1 25 HIS n 1 26 ALA n 1 27 GLN n 1 28 HIS n 1 29 LEU n 1 30 PRO n 1 31 ASP n 1 32 LEU n 1 33 VAL n 1 34 THR n 1 35 GLN n 1 36 ASP n 1 37 VAL n 1 38 LEU n 1 39 ARG n 1 40 VAL n 1 41 CYS n 1 42 SER n 1 43 ASP n 1 44 PRO n 1 45 GLY n 1 46 ASN n 1 47 MET n 1 48 PRO n 1 49 PHE n 1 50 SER n 1 51 GLU n 1 52 ARG n 1 53 LYS n 1 54 GLY n 1 55 GLY n 1 56 GLY n 1 57 PHE n 1 58 GLU n 1 59 ASN n 1 60 LYS n 1 61 ILE n 1 62 ALA n 1 63 GLN n 1 64 ILE n 1 65 VAL n 1 66 ALA n 1 67 ASP n 1 68 GLU n 1 69 LEU n 1 70 LYS n 1 71 VAL n 1 72 LYS n 1 73 LEU n 1 74 ARG n 1 75 TYR n 1 76 TYR n 1 77 TRP n 1 78 LEU n 1 79 THR n 1 80 GLN n 1 81 GLY n 1 82 PRO n 1 83 GLY n 1 84 PHE n 1 85 VAL n 1 86 ARG n 1 87 ASN n 1 88 THR n 1 89 LEU n 1 90 GLY n 1 91 THR n 1 92 GLY n 1 93 LEU n 1 94 CYS n 1 95 ASP n 1 96 LEU n 1 97 ILE n 1 98 ILE n 1 99 GLY n 1 100 THR n 1 101 SER n 1 102 GLY n 1 103 GLY n 1 104 ASP n 1 105 ILE n 1 106 VAL n 1 107 GLN n 1 108 ALA n 1 109 THR n 1 110 ASN n 1 111 PRO n 1 112 TYR n 1 113 TYR n 1 114 ARG n 1 115 SER n 1 116 ALA n 1 117 TYR n 1 118 VAL n 1 119 LEU n 1 120 VAL n 1 121 ALA n 1 122 ARG n 1 123 LYS n 1 124 GLY n 1 125 GLU n 1 126 LEU n 1 127 ALA n 1 128 ASP n 1 129 LEU n 1 130 LYS n 1 131 ARG n 1 132 LEU n 1 133 ASP n 1 134 ASP n 1 135 PRO n 1 136 ARG n 1 137 LEU n 1 138 LYS n 1 139 ASP n 1 140 ARG n 1 141 GLN n 1 142 ILE n 1 143 GLY n 1 144 ILE n 1 145 ILE n 1 146 ALA n 1 147 GLY n 1 148 THR n 1 149 PRO n 1 150 PRO n 1 151 SER n 1 152 ASN n 1 153 ARG n 1 154 LEU n 1 155 SER n 1 156 GLU n 1 157 LEU n 1 158 LYS n 1 159 LEU n 1 160 VAL n 1 161 GLY n 1 162 GLU n 1 163 ARG n 1 164 ILE n 1 165 HIS n 1 166 ALA n 1 167 TYR n 1 168 ALA n 1 169 PRO n 1 170 TYR n 1 171 ALA n 1 172 PHE n 1 173 GLY n 1 174 ALA n 1 175 GLU n 1 176 ARG n 1 177 LYS n 1 178 HIS n 1 179 GLN n 1 180 THR n 1 181 VAL n 1 182 ALA n 1 183 ALA n 1 184 GLU n 1 185 VAL n 1 186 ILE n 1 187 ALA n 1 188 ASP n 1 189 LEU n 1 190 ALA n 1 191 GLU n 1 192 LYS n 1 193 LYS n 1 194 ILE n 1 195 ASP n 1 196 VAL n 1 197 ALA n 1 198 ILE n 1 199 LEU n 1 200 TRP n 1 201 GLY n 1 202 PRO n 1 203 ALA n 1 204 ALA n 1 205 GLY n 1 206 TRP n 1 207 LEU n 1 208 ALA n 1 209 LYS n 1 210 GLN n 1 211 SER n 1 212 GLY n 1 213 VAL n 1 214 PRO n 1 215 MET n 1 216 ASP n 1 217 VAL n 1 218 VAL n 1 219 PRO n 1 220 LEU n 1 221 LEU n 1 222 HIS n 1 223 GLU n 1 224 PRO n 1 225 GLY n 1 226 ARG n 1 227 PRO n 1 228 PRO n 1 229 LEU n 1 230 THR n 1 231 PHE n 1 232 ARG n 1 233 VAL n 1 234 SER n 1 235 MET n 1 236 GLY n 1 237 VAL n 1 238 ARG n 1 239 HIS n 1 240 ASN n 1 241 GLU n 1 242 ASN n 1 243 ASP n 1 244 TRP n 1 245 LYS n 1 246 ARG n 1 247 SER n 1 248 LEU n 1 249 ASN n 1 250 THR n 1 251 VAL n 1 252 LEU n 1 253 ARG n 1 254 LYS n 1 255 ARG n 1 256 LYS n 1 257 ALA n 1 258 ASP n 1 259 ILE n 1 260 GLU n 1 261 ALA n 1 262 VAL n 1 263 LEU n 1 264 ARG n 1 265 GLU n 1 266 TYR n 1 267 GLU n 1 268 VAL n 1 269 PRO n 1 270 LEU n 1 271 LEU n 1 272 ALA n 1 273 GLU n 1 274 GLU n 1 275 ASP n 1 276 THR n 1 277 LYS n 1 278 PRO n 1 279 LEU n 1 280 ASP n 1 281 ALA n 1 282 ALA n 1 283 ASP n 1 284 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 284 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'xoxJ, MexAM1_META1p1742' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 272630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET24a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C5B122_METEA _struct_ref.pdbx_db_accession C5B122 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTRSSAPVSVAVAALLLSAGARPAHAQHLPDLVTQDVLRVCSDPGNMPFSERKGGGFENKIAQIVADELKVKLRYYWLTQ GPGFVRNTLGTGLCDLIIGTSGGDIVQATNPYYRSAYVLVARKGELADLKRLDDPRLKDRQIGIIAGTPPSNRLSELKLV GERIHAYAPYAFGAERKHQTVAAEVIADLAEKKIDVAILWGPAAGWLAKQSGVPMDVVPLLHEPGRPPLTFRVSMGVRHN ENDWKRSLNTVLRKRKADIEAVLREYEVPLLAEEDTKPLDAADE ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6ONP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 284 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession C5B122 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 284 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 284 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6ONP _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.10 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 41.54 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Tris pH 9.0, 18% PEG 6000' _exptl_crystal_grow.pdbx_pH_range 8.5-9.0 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-04-28 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.2.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.2.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 29.35 _reflns.entry_id 6ONP _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.27 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12159 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 93.69 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.4 _reflns.pdbx_Rmerge_I_obs 0.088 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 19.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.037 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.27 _reflns_shell.d_res_low 2.30 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 590 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.674 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.304 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.955 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 37.94 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6ONP _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.27 _refine.ls_d_res_low 49.39 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11410 _refine.ls_number_reflns_R_free 549 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 93.71 _refine.ls_percent_reflns_R_free 4.81 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2414 _refine.ls_R_factor_R_free 0.2790 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2395 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.8938 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2384 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.27 _refine_hist.d_res_low 49.39 _refine_hist.number_atoms_solvent 42 _refine_hist.number_atoms_total 1713 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1663 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 8 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0021 ? 1699 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.5324 ? 2291 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0425 ? 260 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0037 ? 289 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 2.3393 ? 1038 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.27 2.49 . . 104 2147 74.81 . . . 0.3352 . 0.2817 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.49 2.85 . . 137 2881 99.83 . . . 0.3394 . 0.2780 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.85 3.60 . . 162 2880 100.00 . . . 0.3155 . 0.2566 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.60 49.40 . . 146 2953 99.90 . . . 0.2226 . 0.2071 . . . . . . . . . . # _struct.entry_id 6ONP _struct.title 'Crystal structure of periplasmic binding protein XoxJ from Methylobacterium extorquens AM1' _struct.pdbx_descriptor 'periplasmic binding protein XoxJ' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6ONP _struct_keywords.text 'perisplasmic binding protein, solute-binding protein, methanol dehydrogenase, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 56 ? LEU A 69 ? GLY A 56 LEU A 69 1 ? 14 HELX_P HELX_P2 AA2 PHE A 84 ? THR A 88 ? PHE A 84 THR A 88 1 ? 5 HELX_P HELX_P3 AA3 ASP A 134 ? ARG A 140 ? ASP A 134 ARG A 140 5 ? 7 HELX_P HELX_P4 AA4 PRO A 149 ? LEU A 157 ? PRO A 149 LEU A 157 1 ? 9 HELX_P HELX_P5 AA5 THR A 180 ? GLU A 191 ? THR A 180 GLU A 191 1 ? 12 HELX_P HELX_P6 AA6 GLY A 201 ? SER A 211 ? GLY A 201 SER A 211 1 ? 11 HELX_P HELX_P7 AA7 ASN A 242 ? ARG A 255 ? ASN A 242 ARG A 255 1 ? 14 HELX_P HELX_P8 AA8 ARG A 255 ? TYR A 266 ? ARG A 255 TYR A 266 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 41 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 94 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 41 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 94 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.026 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id MET _struct_mon_prot_cis.label_seq_id 47 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id MET _struct_mon_prot_cis.auth_seq_id 47 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 48 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 48 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 3.76 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? AA3 ? 6 ? AA4 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? parallel AA3 5 6 ? parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 38 ? SER A 42 ? LEU A 38 SER A 42 AA1 2 LEU A 73 ? TRP A 77 ? LEU A 73 TRP A 77 AA2 1 GLY A 45 ? ASN A 46 ? GLY A 45 ASN A 46 AA2 2 SER A 50 ? GLU A 51 ? SER A 50 GLU A 51 AA3 1 ILE A 97 ? THR A 100 ? ILE A 97 THR A 100 AA3 2 THR A 230 ? GLY A 236 ? THR A 230 GLY A 236 AA3 3 TYR A 113 ? ARG A 122 ? TYR A 113 ARG A 122 AA3 4 VAL A 196 ? TRP A 200 ? VAL A 196 TRP A 200 AA3 5 ILE A 142 ? ILE A 145 ? ILE A 142 ILE A 145 AA3 6 ILE A 164 ? TYR A 167 ? ILE A 164 TYR A 167 AA4 1 ILE A 97 ? THR A 100 ? ILE A 97 THR A 100 AA4 2 THR A 230 ? GLY A 236 ? THR A 230 GLY A 236 AA4 3 TYR A 113 ? ARG A 122 ? TYR A 113 ARG A 122 AA4 4 MET A 215 ? PRO A 219 ? MET A 215 PRO A 219 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 38 ? N LEU A 38 O ARG A 74 ? O ARG A 74 AA2 1 2 N ASN A 46 ? N ASN A 46 O SER A 50 ? O SER A 50 AA3 1 2 N THR A 100 ? N THR A 100 O SER A 234 ? O SER A 234 AA3 2 3 O VAL A 233 ? O VAL A 233 N TYR A 113 ? N TYR A 113 AA3 3 4 N VAL A 118 ? N VAL A 118 O LEU A 199 ? O LEU A 199 AA3 4 5 O VAL A 196 ? O VAL A 196 N GLY A 143 ? N GLY A 143 AA3 5 6 N ILE A 142 ? N ILE A 142 O HIS A 165 ? O HIS A 165 AA4 1 2 N THR A 100 ? N THR A 100 O SER A 234 ? O SER A 234 AA4 2 3 O VAL A 233 ? O VAL A 233 N TYR A 113 ? N TYR A 113 AA4 3 4 N LEU A 119 ? N LEU A 119 O VAL A 218 ? O VAL A 218 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A EDO 301 ? 5 'binding site for residue EDO A 301' AC2 Software A EDO 302 ? 4 'binding site for residue EDO A 302' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 CYS A 41 ? CYS A 41 . ? 1_555 ? 2 AC1 5 SER A 42 ? SER A 42 . ? 1_555 ? 3 AC1 5 GLU A 58 ? GLU A 58 . ? 1_555 ? 4 AC1 5 ILE A 98 ? ILE A 98 . ? 1_555 ? 5 AC1 5 GLY A 99 ? GLY A 99 . ? 1_555 ? 6 AC2 4 ALA A 183 ? ALA A 183 . ? 1_555 ? 7 AC2 4 ALA A 187 ? ALA A 187 . ? 1_555 ? 8 AC2 4 HOH D . ? HOH A 404 . ? 1_555 ? 9 AC2 4 HOH D . ? HOH A 414 . ? 1_555 ? # _atom_sites.entry_id 6ONP _atom_sites.fract_transf_matrix[1][1] 0.020040 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002901 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019320 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019719 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 25.62398 1.50364 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 19.97189 1.75589 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 15.80542 1.70748 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 1.23737 29.19336 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 ARG 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 SER 5 5 ? ? ? A . n A 1 6 ALA 6 6 ? ? ? A . n A 1 7 PRO 7 7 ? ? ? A . n A 1 8 VAL 8 8 ? ? ? A . n A 1 9 SER 9 9 ? ? ? A . n A 1 10 VAL 10 10 ? ? ? A . n A 1 11 ALA 11 11 ? ? ? A . n A 1 12 VAL 12 12 ? ? ? A . n A 1 13 ALA 13 13 ? ? ? A . n A 1 14 ALA 14 14 ? ? ? A . n A 1 15 LEU 15 15 ? ? ? A . n A 1 16 LEU 16 16 ? ? ? A . n A 1 17 LEU 17 17 ? ? ? A . n A 1 18 SER 18 18 ? ? ? A . n A 1 19 ALA 19 19 ? ? ? A . n A 1 20 GLY 20 20 ? ? ? A . n A 1 21 ALA 21 21 ? ? ? A . n A 1 22 ARG 22 22 ? ? ? A . n A 1 23 PRO 23 23 ? ? ? A . n A 1 24 ALA 24 24 ? ? ? A . n A 1 25 HIS 25 25 ? ? ? A . n A 1 26 ALA 26 26 ? ? ? A . n A 1 27 GLN 27 27 ? ? ? A . n A 1 28 HIS 28 28 ? ? ? A . n A 1 29 LEU 29 29 ? ? ? A . n A 1 30 PRO 30 30 ? ? ? A . n A 1 31 ASP 31 31 ? ? ? A . n A 1 32 LEU 32 32 ? ? ? A . n A 1 33 VAL 33 33 ? ? ? A . n A 1 34 THR 34 34 ? ? ? A . n A 1 35 GLN 35 35 ? ? ? A . n A 1 36 ASP 36 36 ? ? ? A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 TRP 77 77 77 TRP TRP A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 GLY 81 81 ? ? ? A . n A 1 82 PRO 82 82 ? ? ? A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 LEU 89 89 ? ? ? A . n A 1 90 GLY 90 90 ? ? ? A . n A 1 91 THR 91 91 ? ? ? A . n A 1 92 GLY 92 92 ? ? ? A . n A 1 93 LEU 93 93 ? ? ? A . n A 1 94 CYS 94 94 94 CYS CYS A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 SER 101 101 ? ? ? A . n A 1 102 GLY 102 102 ? ? ? A . n A 1 103 GLY 103 103 ? ? ? A . n A 1 104 ASP 104 104 ? ? ? A . n A 1 105 ILE 105 105 ? ? ? A . n A 1 106 VAL 106 106 ? ? ? A . n A 1 107 GLN 107 107 ? ? ? A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 ASN 110 110 110 ASN ASN A . n A 1 111 PRO 111 111 111 PRO PRO A . n A 1 112 TYR 112 112 112 TYR TYR A . n A 1 113 TYR 113 113 113 TYR TYR A . n A 1 114 ARG 114 114 114 ARG ARG A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 TYR 117 117 117 TYR TYR A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 PRO 135 135 135 PRO PRO A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 ARG 140 140 140 ARG ARG A . n A 1 141 GLN 141 141 141 GLN GLN A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 ILE 144 144 144 ILE ILE A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 THR 148 148 148 THR THR A . n A 1 149 PRO 149 149 149 PRO PRO A . n A 1 150 PRO 150 150 150 PRO PRO A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 ASN 152 152 152 ASN ASN A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 SER 155 155 155 SER SER A . n A 1 156 GLU 156 156 156 GLU GLU A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 GLY 161 161 161 GLY GLY A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 ARG 163 163 163 ARG ARG A . n A 1 164 ILE 164 164 164 ILE ILE A . n A 1 165 HIS 165 165 165 HIS HIS A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 TYR 167 167 167 TYR TYR A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 PRO 169 169 169 PRO PRO A . n A 1 170 TYR 170 170 ? ? ? A . n A 1 171 ALA 171 171 ? ? ? A . n A 1 172 PHE 172 172 ? ? ? A . n A 1 173 GLY 173 173 ? ? ? A . n A 1 174 ALA 174 174 ? ? ? A . n A 1 175 GLU 175 175 ? ? ? A . n A 1 176 ARG 176 176 ? ? ? A . n A 1 177 LYS 177 177 177 LYS LYS A . n A 1 178 HIS 178 178 178 HIS HIS A . n A 1 179 GLN 179 179 179 GLN GLN A . n A 1 180 THR 180 180 180 THR THR A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 ALA 182 182 182 ALA ALA A . n A 1 183 ALA 183 183 183 ALA ALA A . n A 1 184 GLU 184 184 184 GLU GLU A . n A 1 185 VAL 185 185 185 VAL VAL A . n A 1 186 ILE 186 186 186 ILE ILE A . n A 1 187 ALA 187 187 187 ALA ALA A . n A 1 188 ASP 188 188 188 ASP ASP A . n A 1 189 LEU 189 189 189 LEU LEU A . n A 1 190 ALA 190 190 190 ALA ALA A . n A 1 191 GLU 191 191 191 GLU GLU A . n A 1 192 LYS 192 192 192 LYS LYS A . n A 1 193 LYS 193 193 193 LYS LYS A . n A 1 194 ILE 194 194 194 ILE ILE A . n A 1 195 ASP 195 195 195 ASP ASP A . n A 1 196 VAL 196 196 196 VAL VAL A . n A 1 197 ALA 197 197 197 ALA ALA A . n A 1 198 ILE 198 198 198 ILE ILE A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 TRP 200 200 200 TRP TRP A . n A 1 201 GLY 201 201 201 GLY GLY A . n A 1 202 PRO 202 202 202 PRO PRO A . n A 1 203 ALA 203 203 203 ALA ALA A . n A 1 204 ALA 204 204 204 ALA ALA A . n A 1 205 GLY 205 205 205 GLY GLY A . n A 1 206 TRP 206 206 206 TRP TRP A . n A 1 207 LEU 207 207 207 LEU LEU A . n A 1 208 ALA 208 208 208 ALA ALA A . n A 1 209 LYS 209 209 209 LYS LYS A . n A 1 210 GLN 210 210 210 GLN GLN A . n A 1 211 SER 211 211 211 SER SER A . n A 1 212 GLY 212 212 212 GLY GLY A . n A 1 213 VAL 213 213 213 VAL VAL A . n A 1 214 PRO 214 214 214 PRO PRO A . n A 1 215 MET 215 215 215 MET MET A . n A 1 216 ASP 216 216 216 ASP ASP A . n A 1 217 VAL 217 217 217 VAL VAL A . n A 1 218 VAL 218 218 218 VAL VAL A . n A 1 219 PRO 219 219 219 PRO PRO A . n A 1 220 LEU 220 220 220 LEU LEU A . n A 1 221 LEU 221 221 221 LEU LEU A . n A 1 222 HIS 222 222 222 HIS HIS A . n A 1 223 GLU 223 223 223 GLU GLU A . n A 1 224 PRO 224 224 224 PRO PRO A . n A 1 225 GLY 225 225 ? ? ? A . n A 1 226 ARG 226 226 ? ? ? A . n A 1 227 PRO 227 227 227 PRO PRO A . n A 1 228 PRO 228 228 228 PRO PRO A . n A 1 229 LEU 229 229 229 LEU LEU A . n A 1 230 THR 230 230 230 THR THR A . n A 1 231 PHE 231 231 231 PHE PHE A . n A 1 232 ARG 232 232 232 ARG ARG A . n A 1 233 VAL 233 233 233 VAL VAL A . n A 1 234 SER 234 234 234 SER SER A . n A 1 235 MET 235 235 235 MET MET A . n A 1 236 GLY 236 236 236 GLY GLY A . n A 1 237 VAL 237 237 237 VAL VAL A . n A 1 238 ARG 238 238 ? ? ? A . n A 1 239 HIS 239 239 ? ? ? A . n A 1 240 ASN 240 240 ? ? ? A . n A 1 241 GLU 241 241 241 GLU GLU A . n A 1 242 ASN 242 242 242 ASN ASN A . n A 1 243 ASP 243 243 243 ASP ASP A . n A 1 244 TRP 244 244 244 TRP TRP A . n A 1 245 LYS 245 245 245 LYS LYS A . n A 1 246 ARG 246 246 246 ARG ARG A . n A 1 247 SER 247 247 247 SER SER A . n A 1 248 LEU 248 248 248 LEU LEU A . n A 1 249 ASN 249 249 249 ASN ASN A . n A 1 250 THR 250 250 250 THR THR A . n A 1 251 VAL 251 251 251 VAL VAL A . n A 1 252 LEU 252 252 252 LEU LEU A . n A 1 253 ARG 253 253 253 ARG ARG A . n A 1 254 LYS 254 254 254 LYS LYS A . n A 1 255 ARG 255 255 255 ARG ARG A . n A 1 256 LYS 256 256 256 LYS LYS A . n A 1 257 ALA 257 257 257 ALA ALA A . n A 1 258 ASP 258 258 258 ASP ASP A . n A 1 259 ILE 259 259 259 ILE ILE A . n A 1 260 GLU 260 260 260 GLU GLU A . n A 1 261 ALA 261 261 261 ALA ALA A . n A 1 262 VAL 262 262 262 VAL VAL A . n A 1 263 LEU 263 263 263 LEU LEU A . n A 1 264 ARG 264 264 264 ARG ARG A . n A 1 265 GLU 265 265 265 GLU GLU A . n A 1 266 TYR 266 266 266 TYR TYR A . n A 1 267 GLU 267 267 267 GLU GLU A . n A 1 268 VAL 268 268 268 VAL VAL A . n A 1 269 PRO 269 269 269 PRO PRO A . n A 1 270 LEU 270 270 270 LEU LEU A . n A 1 271 LEU 271 271 271 LEU LEU A . n A 1 272 ALA 272 272 272 ALA ALA A . n A 1 273 GLU 273 273 273 GLU GLU A . n A 1 274 GLU 274 274 ? ? ? A . n A 1 275 ASP 275 275 ? ? ? A . n A 1 276 THR 276 276 ? ? ? A . n A 1 277 LYS 277 277 ? ? ? A . n A 1 278 PRO 278 278 ? ? ? A . n A 1 279 LEU 279 279 ? ? ? A . n A 1 280 ASP 280 280 ? ? ? A . n A 1 281 ALA 281 281 ? ? ? A . n A 1 282 ALA 282 282 ? ? ? A . n A 1 283 ASP 283 283 ? ? ? A . n A 1 284 GLU 284 284 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EDO 1 301 1 EDO EDO A . C 2 EDO 1 302 2 EDO EDO A . D 3 HOH 1 401 41 HOH HOH A . D 3 HOH 2 402 7 HOH HOH A . D 3 HOH 3 403 48 HOH HOH A . D 3 HOH 4 404 16 HOH HOH A . D 3 HOH 5 405 45 HOH HOH A . D 3 HOH 6 406 2 HOH HOH A . D 3 HOH 7 407 38 HOH HOH A . D 3 HOH 8 408 17 HOH HOH A . D 3 HOH 9 409 32 HOH HOH A . D 3 HOH 10 410 5 HOH HOH A . D 3 HOH 11 411 27 HOH HOH A . D 3 HOH 12 412 12 HOH HOH A . D 3 HOH 13 413 29 HOH HOH A . D 3 HOH 14 414 25 HOH HOH A . D 3 HOH 15 415 3 HOH HOH A . D 3 HOH 16 416 13 HOH HOH A . D 3 HOH 17 417 42 HOH HOH A . D 3 HOH 18 418 40 HOH HOH A . D 3 HOH 19 419 11 HOH HOH A . D 3 HOH 20 420 24 HOH HOH A . D 3 HOH 21 421 33 HOH HOH A . D 3 HOH 22 422 19 HOH HOH A . D 3 HOH 23 423 1 HOH HOH A . D 3 HOH 24 424 31 HOH HOH A . D 3 HOH 25 425 34 HOH HOH A . D 3 HOH 26 426 26 HOH HOH A . D 3 HOH 27 427 22 HOH HOH A . D 3 HOH 28 428 15 HOH HOH A . D 3 HOH 29 429 28 HOH HOH A . D 3 HOH 30 430 46 HOH HOH A . D 3 HOH 31 431 20 HOH HOH A . D 3 HOH 32 432 30 HOH HOH A . D 3 HOH 33 433 23 HOH HOH A . D 3 HOH 34 434 47 HOH HOH A . D 3 HOH 35 435 4 HOH HOH A . D 3 HOH 36 436 44 HOH HOH A . D 3 HOH 37 437 39 HOH HOH A . D 3 HOH 38 438 9 HOH HOH A . D 3 HOH 39 439 35 HOH HOH A . D 3 HOH 40 440 36 HOH HOH A . D 3 HOH 41 441 14 HOH HOH A . D 3 HOH 42 442 37 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-05-08 2 'Structure model' 1 1 2019-07-17 3 'Structure model' 1 2 2019-08-21 4 'Structure model' 1 3 2019-10-02 5 'Structure model' 1 4 2020-01-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 5 'Structure model' 'Author supporting evidence' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' software 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' citation 5 5 'Structure model' pdbx_audit_support # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_software.name' 2 2 'Structure model' '_software.version' 3 3 'Structure model' '_citation.title' 4 3 'Structure model' '_citation_author.name' 5 4 'Structure model' '_citation.journal_volume' 6 4 'Structure model' '_citation.page_first' 7 4 'Structure model' '_citation.page_last' 8 5 'Structure model' '_pdbx_audit_support.funding_organization' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.13_2998 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? CRANK2 ? ? ? . 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 46 ? ? -149.00 53.86 2 1 ARG A 255 ? ? -86.45 34.75 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A ARG 3 ? A ARG 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A SER 5 ? A SER 5 6 1 Y 1 A ALA 6 ? A ALA 6 7 1 Y 1 A PRO 7 ? A PRO 7 8 1 Y 1 A VAL 8 ? A VAL 8 9 1 Y 1 A SER 9 ? A SER 9 10 1 Y 1 A VAL 10 ? A VAL 10 11 1 Y 1 A ALA 11 ? A ALA 11 12 1 Y 1 A VAL 12 ? A VAL 12 13 1 Y 1 A ALA 13 ? A ALA 13 14 1 Y 1 A ALA 14 ? A ALA 14 15 1 Y 1 A LEU 15 ? A LEU 15 16 1 Y 1 A LEU 16 ? A LEU 16 17 1 Y 1 A LEU 17 ? A LEU 17 18 1 Y 1 A SER 18 ? A SER 18 19 1 Y 1 A ALA 19 ? A ALA 19 20 1 Y 1 A GLY 20 ? A GLY 20 21 1 Y 1 A ALA 21 ? A ALA 21 22 1 Y 1 A ARG 22 ? A ARG 22 23 1 Y 1 A PRO 23 ? A PRO 23 24 1 Y 1 A ALA 24 ? A ALA 24 25 1 Y 1 A HIS 25 ? A HIS 25 26 1 Y 1 A ALA 26 ? A ALA 26 27 1 Y 1 A GLN 27 ? A GLN 27 28 1 Y 1 A HIS 28 ? A HIS 28 29 1 Y 1 A LEU 29 ? A LEU 29 30 1 Y 1 A PRO 30 ? A PRO 30 31 1 Y 1 A ASP 31 ? A ASP 31 32 1 Y 1 A LEU 32 ? A LEU 32 33 1 Y 1 A VAL 33 ? A VAL 33 34 1 Y 1 A THR 34 ? A THR 34 35 1 Y 1 A GLN 35 ? A GLN 35 36 1 Y 1 A ASP 36 ? A ASP 36 37 1 Y 1 A GLY 81 ? A GLY 81 38 1 Y 1 A PRO 82 ? A PRO 82 39 1 Y 1 A LEU 89 ? A LEU 89 40 1 Y 1 A GLY 90 ? A GLY 90 41 1 Y 1 A THR 91 ? A THR 91 42 1 Y 1 A GLY 92 ? A GLY 92 43 1 Y 1 A LEU 93 ? A LEU 93 44 1 Y 1 A SER 101 ? A SER 101 45 1 Y 1 A GLY 102 ? A GLY 102 46 1 Y 1 A GLY 103 ? A GLY 103 47 1 Y 1 A ASP 104 ? A ASP 104 48 1 Y 1 A ILE 105 ? A ILE 105 49 1 Y 1 A VAL 106 ? A VAL 106 50 1 Y 1 A GLN 107 ? A GLN 107 51 1 Y 1 A TYR 170 ? A TYR 170 52 1 Y 1 A ALA 171 ? A ALA 171 53 1 Y 1 A PHE 172 ? A PHE 172 54 1 Y 1 A GLY 173 ? A GLY 173 55 1 Y 1 A ALA 174 ? A ALA 174 56 1 Y 1 A GLU 175 ? A GLU 175 57 1 Y 1 A ARG 176 ? A ARG 176 58 1 Y 1 A GLY 225 ? A GLY 225 59 1 Y 1 A ARG 226 ? A ARG 226 60 1 Y 1 A ARG 238 ? A ARG 238 61 1 Y 1 A HIS 239 ? A HIS 239 62 1 Y 1 A ASN 240 ? A ASN 240 63 1 Y 1 A GLU 274 ? A GLU 274 64 1 Y 1 A ASP 275 ? A ASP 275 65 1 Y 1 A THR 276 ? A THR 276 66 1 Y 1 A LYS 277 ? A LYS 277 67 1 Y 1 A PRO 278 ? A PRO 278 68 1 Y 1 A LEU 279 ? A LEU 279 69 1 Y 1 A ASP 280 ? A ASP 280 70 1 Y 1 A ALA 281 ? A ALA 281 71 1 Y 1 A ALA 282 ? A ALA 282 72 1 Y 1 A ASP 283 ? A ASP 283 73 1 Y 1 A GLU 284 ? A GLU 284 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,2-ETHANEDIOL EDO 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 1 21 1' _space_group.name_Hall 'P 2yb' _space_group.IT_number 4 _space_group.crystal_system monoclinic _space_group.id 1 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -x,y+1/2,-z #