data_6ONQ # _entry.id 6ONQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.321 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6ONQ WWPDB D_1000240980 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6ONQ _pdbx_database_status.recvd_initial_deposition_date 2019-04-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'McBride, M.J.' 1 ? 'Featherston, E.R.' 2 ? 'Boal, A.K.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country GE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Chembiochem _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1439-7633 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 20 _citation.language ? _citation.page_first 2360 _citation.page_last 2372 _citation.title ;Biochemical and Structural Characterization of XoxG and XoxJ and Their Roles in Lanthanide-Dependent Methanol Dehydrogenase Activity. ; _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/cbic.201900184 _citation.pdbx_database_id_PubMed 31017712 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Featherston, E.R.' 1 ? primary 'Rose, H.R.' 2 ? primary 'McBride, M.J.' 3 ? primary 'Taylor, E.M.' 4 ? primary 'Boal, A.K.' 5 ? primary 'Cotruvo Jr., J.A.' 6 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6ONQ _cell.details ? _cell.formula_units_Z ? _cell.length_a 95.841 _cell.length_a_esd ? _cell.length_b 95.841 _cell.length_b_esd ? _cell.length_c 80.411 _cell.length_c_esd ? _cell.volume 639659.373 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6ONQ _symmetry.cell_setting ? _symmetry.Int_Tables_number 180 _symmetry.space_group_name_Hall 'P 62 2 (x,y,z+1/3)' _symmetry.space_group_name_H-M 'P 62 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cytochrome c XoxG' 21336.066 1 ? ? ? ? 2 non-polymer syn 'HEME C' 618.503 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKRTALLGLVGAALLGAVPAATVAFAQDAKPELANKLDPNAKEIDEPVLKAATAAKEEDGKYFDKDGHPTFHITNDGKKV DWFTYSGYRRYHAECHVCHGPDGMGSTYAPALKDSLKRLSYEEFYGILAGGKQEISNTANQVMPAFGDNKNVMCYANDLY VYLRARAAGAWGRARPGEKEDKPESAKTVEKECLGG ; _entity_poly.pdbx_seq_one_letter_code_can ;MKRTALLGLVGAALLGAVPAATVAFAQDAKPELANKLDPNAKEIDEPVLKAATAAKEEDGKYFDKDGHPTFHITNDGKKV DWFTYSGYRRYHAECHVCHGPDGMGSTYAPALKDSLKRLSYEEFYGILAGGKQEISNTANQVMPAFGDNKNVMCYANDLY VYLRARAAGAWGRARPGEKEDKPESAKTVEKECLGG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 ARG n 1 4 THR n 1 5 ALA n 1 6 LEU n 1 7 LEU n 1 8 GLY n 1 9 LEU n 1 10 VAL n 1 11 GLY n 1 12 ALA n 1 13 ALA n 1 14 LEU n 1 15 LEU n 1 16 GLY n 1 17 ALA n 1 18 VAL n 1 19 PRO n 1 20 ALA n 1 21 ALA n 1 22 THR n 1 23 VAL n 1 24 ALA n 1 25 PHE n 1 26 ALA n 1 27 GLN n 1 28 ASP n 1 29 ALA n 1 30 LYS n 1 31 PRO n 1 32 GLU n 1 33 LEU n 1 34 ALA n 1 35 ASN n 1 36 LYS n 1 37 LEU n 1 38 ASP n 1 39 PRO n 1 40 ASN n 1 41 ALA n 1 42 LYS n 1 43 GLU n 1 44 ILE n 1 45 ASP n 1 46 GLU n 1 47 PRO n 1 48 VAL n 1 49 LEU n 1 50 LYS n 1 51 ALA n 1 52 ALA n 1 53 THR n 1 54 ALA n 1 55 ALA n 1 56 LYS n 1 57 GLU n 1 58 GLU n 1 59 ASP n 1 60 GLY n 1 61 LYS n 1 62 TYR n 1 63 PHE n 1 64 ASP n 1 65 LYS n 1 66 ASP n 1 67 GLY n 1 68 HIS n 1 69 PRO n 1 70 THR n 1 71 PHE n 1 72 HIS n 1 73 ILE n 1 74 THR n 1 75 ASN n 1 76 ASP n 1 77 GLY n 1 78 LYS n 1 79 LYS n 1 80 VAL n 1 81 ASP n 1 82 TRP n 1 83 PHE n 1 84 THR n 1 85 TYR n 1 86 SER n 1 87 GLY n 1 88 TYR n 1 89 ARG n 1 90 ARG n 1 91 TYR n 1 92 HIS n 1 93 ALA n 1 94 GLU n 1 95 CYS n 1 96 HIS n 1 97 VAL n 1 98 CYS n 1 99 HIS n 1 100 GLY n 1 101 PRO n 1 102 ASP n 1 103 GLY n 1 104 MET n 1 105 GLY n 1 106 SER n 1 107 THR n 1 108 TYR n 1 109 ALA n 1 110 PRO n 1 111 ALA n 1 112 LEU n 1 113 LYS n 1 114 ASP n 1 115 SER n 1 116 LEU n 1 117 LYS n 1 118 ARG n 1 119 LEU n 1 120 SER n 1 121 TYR n 1 122 GLU n 1 123 GLU n 1 124 PHE n 1 125 TYR n 1 126 GLY n 1 127 ILE n 1 128 LEU n 1 129 ALA n 1 130 GLY n 1 131 GLY n 1 132 LYS n 1 133 GLN n 1 134 GLU n 1 135 ILE n 1 136 SER n 1 137 ASN n 1 138 THR n 1 139 ALA n 1 140 ASN n 1 141 GLN n 1 142 VAL n 1 143 MET n 1 144 PRO n 1 145 ALA n 1 146 PHE n 1 147 GLY n 1 148 ASP n 1 149 ASN n 1 150 LYS n 1 151 ASN n 1 152 VAL n 1 153 MET n 1 154 CYS n 1 155 TYR n 1 156 ALA n 1 157 ASN n 1 158 ASP n 1 159 LEU n 1 160 TYR n 1 161 VAL n 1 162 TYR n 1 163 LEU n 1 164 ARG n 1 165 ALA n 1 166 ARG n 1 167 ALA n 1 168 ALA n 1 169 GLY n 1 170 ALA n 1 171 TRP n 1 172 GLY n 1 173 ARG n 1 174 ALA n 1 175 ARG n 1 176 PRO n 1 177 GLY n 1 178 GLU n 1 179 LYS n 1 180 GLU n 1 181 ASP n 1 182 LYS n 1 183 PRO n 1 184 GLU n 1 185 SER n 1 186 ALA n 1 187 LYS n 1 188 THR n 1 189 VAL n 1 190 GLU n 1 191 LYS n 1 192 GLU n 1 193 CYS n 1 194 LEU n 1 195 GLY n 1 196 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 196 _entity_src_gen.gene_src_common_name 'Methylobacterium dichloromethanicum' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene "maxG'" _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Methylobacterium extorquens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 408 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code P71510_METEX _struct_ref.pdbx_db_accession P71510 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKRTALLGLVGAALLGAVPAATVAFAQDAKPELANKLDPNAKEIDEPVLKAATAAKEEDGKYFDKDGHPTFHITNDGKKV DWFTYSGYRRYHAECHVCHGPDGMGSTYAPALKDSLKRLSYEEFYGILAGGKQEISNTANQVMPAFGDNKNVMCYANDLY VYLRARAAGAWGRARPGEKEDKPESAKTVEKECLGG ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6ONQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 196 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P71510 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 196 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 196 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEC non-polymer . 'HEME C' ? 'C34 H34 Fe N4 O4' 618.503 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6ONQ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.50 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.77 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.2 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;.2 M sodium acetate, 0.1 M phosphate-citra te pH 4.2, and 20% (w/v) PEG 8000 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-08-30 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.6984 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.2.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.6984 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.2.2 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 39.79 _reflns.entry_id 6ONQ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.71 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6337 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 37.7 _reflns.pdbx_Rmerge_I_obs 0.124 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 39 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.020 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.71 _reflns_shell.d_res_low 2.76 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 305 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.242 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.256 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.898 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 39.79 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6ONQ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.71 _refine.ls_d_res_low 41.50 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6236 _refine.ls_number_reflns_R_free 313 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.75 _refine.ls_percent_reflns_R_free 5.02 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1963 _refine.ls_R_factor_R_free 0.2484 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1937 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.3881 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3258 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.71 _refine_hist.d_res_low 41.50 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1295 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1252 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 43 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0073 ? 1336 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.9695 ? 1812 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0465 ? 171 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0046 ? 235 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 8.4804 ? 778 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.71 3.41 . . 152 2857 98.08 . . . 0.3161 . 0.2330 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.41 41.51 . . 161 3066 99.38 . . . 0.2163 . 0.1758 . . . . . . . . . . # _struct.entry_id 6ONQ _struct.title 'Crystal structure of c-type cytochrome XoxG from Methylobacterium extorquens AM1' _struct.pdbx_descriptor 'Cytochrome c XoxG' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6ONQ _struct_keywords.text 'Cytochrome, heme, electron transport, methanol oxidation, lanthanide' _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 45 ? ALA A 52 ? ASP A 45 ALA A 52 1 ? 8 HELX_P HELX_P2 AA2 ASP A 81 ? CYS A 95 ? ASP A 81 CYS A 95 1 ? 15 HELX_P HELX_P3 AA3 CYS A 95 ? GLY A 100 ? CYS A 95 GLY A 100 1 ? 6 HELX_P HELX_P4 AA4 PRO A 101 ? MET A 104 ? PRO A 101 MET A 104 5 ? 4 HELX_P HELX_P5 AA5 ALA A 111 ? LEU A 119 ? ALA A 111 LEU A 119 1 ? 9 HELX_P HELX_P6 AA6 SER A 120 ? GLY A 131 ? SER A 120 GLY A 131 1 ? 12 HELX_P HELX_P7 AA7 ASN A 149 ? CYS A 154 ? ASN A 149 CYS A 154 1 ? 6 HELX_P HELX_P8 AA8 TYR A 155 ? ALA A 168 ? TYR A 155 ALA A 168 1 ? 14 HELX_P HELX_P9 AA9 PRO A 183 ? LEU A 194 ? PRO A 183 LEU A 194 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 154 SG ? ? ? 1_555 A CYS 193 SG ? ? A CYS 154 A CYS 193 1_555 ? ? ? ? ? ? ? 2.070 ? covale1 covale none ? A CYS 95 SG ? ? ? 1_555 B HEC . CAB ? ? A CYS 95 A HEC 201 1_555 ? ? ? ? ? ? ? 1.765 ? covale2 covale none ? A CYS 98 SG ? ? ? 1_555 B HEC . CAC ? ? A CYS 98 A HEC 201 1_555 ? ? ? ? ? ? ? 2.041 ? metalc1 metalc ? ? A HIS 99 NE2 ? ? ? 1_555 B HEC . FE ? ? A HIS 99 A HEC 201 1_555 ? ? ? ? ? ? ? 2.284 ? metalc2 metalc ? ? A MET 143 SD ? ? ? 1_555 B HEC . FE ? ? A MET 143 A HEC 201 1_555 ? ? ? ? ? ? ? 2.432 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 56 ? GLU A 58 ? LYS A 56 GLU A 58 AA1 2 LYS A 61 ? PHE A 63 ? LYS A 61 PHE A 63 AA1 3 PRO A 69 ? THR A 70 ? PRO A 69 THR A 70 AA2 1 ILE A 73 ? THR A 74 ? ILE A 73 THR A 74 AA2 2 LYS A 79 ? VAL A 80 ? LYS A 79 VAL A 80 AA3 1 LYS A 132 ? GLN A 133 ? LYS A 132 GLN A 133 AA3 2 VAL A 142 ? MET A 143 ? VAL A 142 MET A 143 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 58 ? N GLU A 58 O LYS A 61 ? O LYS A 61 AA1 2 3 N TYR A 62 ? N TYR A 62 O THR A 70 ? O THR A 70 AA2 1 2 N THR A 74 ? N THR A 74 O LYS A 79 ? O LYS A 79 AA3 1 2 N LYS A 132 ? N LYS A 132 O MET A 143 ? O MET A 143 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id HEC _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 16 _struct_site.details 'binding site for residue HEC A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 16 PRO A 47 ? PRO A 47 . ? 4_765 ? 2 AC1 16 GLU A 94 ? GLU A 94 . ? 1_555 ? 3 AC1 16 CYS A 95 ? CYS A 95 . ? 1_555 ? 4 AC1 16 CYS A 98 ? CYS A 98 . ? 1_555 ? 5 AC1 16 HIS A 99 ? HIS A 99 . ? 1_555 ? 6 AC1 16 TYR A 108 ? TYR A 108 . ? 1_555 ? 7 AC1 16 LEU A 112 ? LEU A 112 . ? 1_555 ? 8 AC1 16 SER A 115 ? SER A 115 . ? 1_555 ? 9 AC1 16 ARG A 118 ? ARG A 118 . ? 1_555 ? 10 AC1 16 PHE A 124 ? PHE A 124 . ? 1_555 ? 11 AC1 16 LYS A 132 ? LYS A 132 . ? 1_555 ? 12 AC1 16 GLU A 134 ? GLU A 134 . ? 1_555 ? 13 AC1 16 GLN A 141 ? GLN A 141 . ? 1_555 ? 14 AC1 16 VAL A 142 ? VAL A 142 . ? 1_555 ? 15 AC1 16 MET A 143 ? MET A 143 . ? 1_555 ? 16 AC1 16 PHE A 146 ? PHE A 146 . ? 1_555 ? # _atom_sites.entry_id 6ONQ _atom_sites.fract_transf_matrix[1][1] 0.010434 _atom_sites.fract_transf_matrix[1][2] 0.006024 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012048 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012436 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? FE ? ? 20.90327 4.99816 ? ? 2.55100 38.46870 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 LYS 2 2 ? ? ? A . n A 1 3 ARG 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 ALA 5 5 ? ? ? A . n A 1 6 LEU 6 6 ? ? ? A . n A 1 7 LEU 7 7 ? ? ? A . n A 1 8 GLY 8 8 ? ? ? A . n A 1 9 LEU 9 9 ? ? ? A . n A 1 10 VAL 10 10 ? ? ? A . n A 1 11 GLY 11 11 ? ? ? A . n A 1 12 ALA 12 12 ? ? ? A . n A 1 13 ALA 13 13 ? ? ? A . n A 1 14 LEU 14 14 ? ? ? A . n A 1 15 LEU 15 15 ? ? ? A . n A 1 16 GLY 16 16 ? ? ? A . n A 1 17 ALA 17 17 ? ? ? A . n A 1 18 VAL 18 18 ? ? ? A . n A 1 19 PRO 19 19 ? ? ? A . n A 1 20 ALA 20 20 ? ? ? A . n A 1 21 ALA 21 21 ? ? ? A . n A 1 22 THR 22 22 ? ? ? A . n A 1 23 VAL 23 23 ? ? ? A . n A 1 24 ALA 24 24 ? ? ? A . n A 1 25 PHE 25 25 ? ? ? A . n A 1 26 ALA 26 26 ? ? ? A . n A 1 27 GLN 27 27 ? ? ? A . n A 1 28 ASP 28 28 ? ? ? A . n A 1 29 ALA 29 29 ? ? ? A . n A 1 30 LYS 30 30 ? ? ? A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 TRP 82 82 82 TRP TRP A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 CYS 95 95 95 CYS CYS A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 CYS 98 98 98 CYS CYS A . n A 1 99 HIS 99 99 99 HIS HIS A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 MET 104 104 104 MET MET A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 TYR 108 108 108 TYR TYR A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 TYR 121 121 121 TYR TYR A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 PHE 124 124 124 PHE PHE A . n A 1 125 TYR 125 125 125 TYR TYR A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 GLN 133 133 133 GLN GLN A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 ILE 135 135 ? ? ? A . n A 1 136 SER 136 136 ? ? ? A . n A 1 137 ASN 137 137 ? ? ? A . n A 1 138 THR 138 138 ? ? ? A . n A 1 139 ALA 139 139 ? ? ? A . n A 1 140 ASN 140 140 140 ASN ASN A . n A 1 141 GLN 141 141 141 GLN GLN A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 MET 143 143 143 MET MET A . n A 1 144 PRO 144 144 144 PRO PRO A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 PHE 146 146 146 PHE PHE A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 ASN 149 149 149 ASN ASN A . n A 1 150 LYS 150 150 150 LYS LYS A . n A 1 151 ASN 151 151 151 ASN ASN A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 MET 153 153 153 MET MET A . n A 1 154 CYS 154 154 154 CYS CYS A . n A 1 155 TYR 155 155 155 TYR TYR A . n A 1 156 ALA 156 156 156 ALA ALA A . n A 1 157 ASN 157 157 157 ASN ASN A . n A 1 158 ASP 158 158 158 ASP ASP A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 TYR 160 160 160 TYR TYR A . n A 1 161 VAL 161 161 161 VAL VAL A . n A 1 162 TYR 162 162 162 TYR TYR A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 ARG 164 164 164 ARG ARG A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 ARG 166 166 166 ARG ARG A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 TRP 171 171 171 TRP TRP A . n A 1 172 GLY 172 172 172 GLY GLY A . n A 1 173 ARG 173 173 173 ARG ARG A . n A 1 174 ALA 174 174 174 ALA ALA A . n A 1 175 ARG 175 175 175 ARG ARG A . n A 1 176 PRO 176 176 176 PRO PRO A . n A 1 177 GLY 177 177 177 GLY GLY A . n A 1 178 GLU 178 178 178 GLU GLU A . n A 1 179 LYS 179 179 179 LYS LYS A . n A 1 180 GLU 180 180 180 GLU GLU A . n A 1 181 ASP 181 181 181 ASP ASP A . n A 1 182 LYS 182 182 182 LYS LYS A . n A 1 183 PRO 183 183 183 PRO PRO A . n A 1 184 GLU 184 184 184 GLU GLU A . n A 1 185 SER 185 185 185 SER SER A . n A 1 186 ALA 186 186 186 ALA ALA A . n A 1 187 LYS 187 187 187 LYS LYS A . n A 1 188 THR 188 188 188 THR THR A . n A 1 189 VAL 189 189 189 VAL VAL A . n A 1 190 GLU 190 190 190 GLU GLU A . n A 1 191 LYS 191 191 191 LYS LYS A . n A 1 192 GLU 192 192 192 GLU GLU A . n A 1 193 CYS 193 193 193 CYS CYS A . n A 1 194 LEU 194 194 194 LEU LEU A . n A 1 195 GLY 195 195 ? ? ? A . n A 1 196 GLY 196 196 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id HEC _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id HEC _pdbx_nonpoly_scheme.auth_mon_id HEM _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 99 ? A HIS 99 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 NA ? B HEC . ? A HEC 201 ? 1_555 82.9 ? 2 NE2 ? A HIS 99 ? A HIS 99 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 NB ? B HEC . ? A HEC 201 ? 1_555 95.9 ? 3 NA ? B HEC . ? A HEC 201 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 NB ? B HEC . ? A HEC 201 ? 1_555 92.5 ? 4 NE2 ? A HIS 99 ? A HIS 99 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 NC ? B HEC . ? A HEC 201 ? 1_555 89.5 ? 5 NA ? B HEC . ? A HEC 201 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 NC ? B HEC . ? A HEC 201 ? 1_555 172.4 ? 6 NB ? B HEC . ? A HEC 201 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 NC ? B HEC . ? A HEC 201 ? 1_555 88.3 ? 7 NE2 ? A HIS 99 ? A HIS 99 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 ND ? B HEC . ? A HEC 201 ? 1_555 78.3 ? 8 NA ? B HEC . ? A HEC 201 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 ND ? B HEC . ? A HEC 201 ? 1_555 87.7 ? 9 NB ? B HEC . ? A HEC 201 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 ND ? B HEC . ? A HEC 201 ? 1_555 174.2 ? 10 NC ? B HEC . ? A HEC 201 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 ND ? B HEC . ? A HEC 201 ? 1_555 90.8 ? 11 NE2 ? A HIS 99 ? A HIS 99 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 SD ? A MET 143 ? A MET 143 ? 1_555 171.3 ? 12 NA ? B HEC . ? A HEC 201 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 SD ? A MET 143 ? A MET 143 ? 1_555 97.4 ? 13 NB ? B HEC . ? A HEC 201 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 SD ? A MET 143 ? A MET 143 ? 1_555 92.7 ? 14 NC ? B HEC . ? A HEC 201 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 SD ? A MET 143 ? A MET 143 ? 1_555 90.1 ? 15 ND ? B HEC . ? A HEC 201 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 SD ? A MET 143 ? A MET 143 ? 1_555 93.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-05-08 2 'Structure model' 1 1 2019-07-17 3 'Structure model' 1 2 2019-08-21 4 'Structure model' 1 3 2019-10-02 5 'Structure model' 1 4 2020-01-01 6 'Structure model' 2 0 2020-01-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 5 'Structure model' 'Author supporting evidence' 8 6 'Structure model' Advisory 9 6 'Structure model' 'Atomic model' 10 6 'Structure model' 'Author supporting evidence' 11 6 'Structure model' 'Data collection' 12 6 'Structure model' 'Derived calculations' 13 6 'Structure model' 'Non-polymer description' 14 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' software 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' citation 5 5 'Structure model' pdbx_audit_support 6 6 'Structure model' atom_site 7 6 'Structure model' chem_comp 8 6 'Structure model' entity 9 6 'Structure model' pdbx_entity_instance_feature 10 6 'Structure model' pdbx_entity_nonpoly 11 6 'Structure model' pdbx_nonpoly_scheme 12 6 'Structure model' pdbx_struct_conn_angle 13 6 'Structure model' pdbx_validate_close_contact 14 6 'Structure model' struct_conn 15 6 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_software.name' 2 3 'Structure model' '_citation.title' 3 3 'Structure model' '_citation_author.name' 4 4 'Structure model' '_citation.journal_volume' 5 4 'Structure model' '_citation.page_first' 6 4 'Structure model' '_citation.page_last' 7 5 'Structure model' '_pdbx_audit_support.funding_organization' 8 6 'Structure model' '_atom_site.B_iso_or_equiv' 9 6 'Structure model' '_atom_site.Cartn_x' 10 6 'Structure model' '_atom_site.Cartn_y' 11 6 'Structure model' '_atom_site.Cartn_z' 12 6 'Structure model' '_atom_site.auth_atom_id' 13 6 'Structure model' '_atom_site.auth_comp_id' 14 6 'Structure model' '_atom_site.label_atom_id' 15 6 'Structure model' '_atom_site.label_comp_id' 16 6 'Structure model' '_atom_site.type_symbol' 17 6 'Structure model' '_chem_comp.formula' 18 6 'Structure model' '_chem_comp.formula_weight' 19 6 'Structure model' '_chem_comp.id' 20 6 'Structure model' '_chem_comp.name' 21 6 'Structure model' '_chem_comp.pdbx_synonyms' 22 6 'Structure model' '_entity.formula_weight' 23 6 'Structure model' '_entity.pdbx_description' 24 6 'Structure model' '_pdbx_entity_instance_feature.auth_comp_id' 25 6 'Structure model' '_pdbx_entity_instance_feature.comp_id' 26 6 'Structure model' '_pdbx_entity_nonpoly.comp_id' 27 6 'Structure model' '_pdbx_entity_nonpoly.name' 28 6 'Structure model' '_pdbx_nonpoly_scheme.mon_id' 29 6 'Structure model' '_pdbx_nonpoly_scheme.pdb_mon_id' 30 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 31 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 32 6 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id' 33 6 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 34 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 35 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 36 6 'Structure model' '_pdbx_validate_close_contact.auth_atom_id_2' 37 6 'Structure model' '_pdbx_validate_close_contact.auth_comp_id_2' 38 6 'Structure model' '_pdbx_validate_close_contact.dist' 39 6 'Structure model' '_struct_conn.pdbx_dist_value' 40 6 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 41 6 'Structure model' '_struct_conn.ptnr2_label_atom_id' 42 6 'Structure model' '_struct_conn.ptnr2_label_comp_id' 43 6 'Structure model' '_struct_site.details' 44 6 'Structure model' '_struct_site.pdbx_auth_comp_id' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14_3260 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 1.14_3260 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? SHARP ? ? ? . 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 SG _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 CYS _pdbx_validate_close_contact.auth_seq_id_1 98 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 CBC _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HEC _pdbx_validate_close_contact.auth_seq_id_2 201 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.77 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 40 ? ? -97.39 44.77 2 1 ASP A 59 ? ? 59.14 77.94 3 1 HIS A 72 ? ? -163.63 98.13 4 1 CYS A 95 ? ? -131.08 -30.48 5 1 ARG A 173 ? ? -103.38 46.69 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A LYS 2 ? A LYS 2 3 1 Y 1 A ARG 3 ? A ARG 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A ALA 5 ? A ALA 5 6 1 Y 1 A LEU 6 ? A LEU 6 7 1 Y 1 A LEU 7 ? A LEU 7 8 1 Y 1 A GLY 8 ? A GLY 8 9 1 Y 1 A LEU 9 ? A LEU 9 10 1 Y 1 A VAL 10 ? A VAL 10 11 1 Y 1 A GLY 11 ? A GLY 11 12 1 Y 1 A ALA 12 ? A ALA 12 13 1 Y 1 A ALA 13 ? A ALA 13 14 1 Y 1 A LEU 14 ? A LEU 14 15 1 Y 1 A LEU 15 ? A LEU 15 16 1 Y 1 A GLY 16 ? A GLY 16 17 1 Y 1 A ALA 17 ? A ALA 17 18 1 Y 1 A VAL 18 ? A VAL 18 19 1 Y 1 A PRO 19 ? A PRO 19 20 1 Y 1 A ALA 20 ? A ALA 20 21 1 Y 1 A ALA 21 ? A ALA 21 22 1 Y 1 A THR 22 ? A THR 22 23 1 Y 1 A VAL 23 ? A VAL 23 24 1 Y 1 A ALA 24 ? A ALA 24 25 1 Y 1 A PHE 25 ? A PHE 25 26 1 Y 1 A ALA 26 ? A ALA 26 27 1 Y 1 A GLN 27 ? A GLN 27 28 1 Y 1 A ASP 28 ? A ASP 28 29 1 Y 1 A ALA 29 ? A ALA 29 30 1 Y 1 A LYS 30 ? A LYS 30 31 1 Y 1 A ILE 135 ? A ILE 135 32 1 Y 1 A SER 136 ? A SER 136 33 1 Y 1 A ASN 137 ? A ASN 137 34 1 Y 1 A THR 138 ? A THR 138 35 1 Y 1 A ALA 139 ? A ALA 139 36 1 Y 1 A GLY 195 ? A GLY 195 37 1 Y 1 A GLY 196 ? A GLY 196 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id HEC _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id HEC _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'HEME C' _pdbx_entity_nonpoly.comp_id HEC # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 62 2 2' _space_group.name_Hall 'P 62 2 (x,y,z+1/3)' _space_group.IT_number 180 _space_group.crystal_system hexagonal _space_group.id 1 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+1/3 3 y,-x+y,z+2/3 4 -y,x-y,z+2/3 5 -x+y,-x,z+1/3 6 x-y,-y,-z 7 -x,-x+y,-z+1/3 8 -x,-y,z 9 y,x,-z+2/3 10 -y,-x,-z+2/3 11 -x+y,y,-z 12 x,x-y,-z+1/3 #