data_6OS8 # _entry.id 6OS8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6OS8 pdb_00006os8 10.2210/pdb6os8/pdb WWPDB D_1000240277 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6OS8 _pdbx_database_status.recvd_initial_deposition_date 2019-05-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Smith, M.S.' 1 ? 'Stern, K.L.' 2 ? 'Billings, W.M.' 3 ? 'Price, J.L.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 0006-2960 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 59 _citation.language ? _citation.page_first 1672 _citation.page_last 1679 _citation.title 'Context-Dependent Stabilizing Interactions among Solvent-Exposed Residues along the Surface of a Trimeric Helix Bundle.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.0c00045 _citation.pdbx_database_id_PubMed 32270676 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Stern, K.L.' 1 ? primary 'Smith, M.S.' 2 ? primary 'Billings, W.M.' 3 ? primary 'Loftus, T.J.' 4 ? primary 'Conover, B.M.' 5 ? primary 'Della Corte, D.' 6 ? primary 'Price, J.L.' 7 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6OS8 _cell.details ? _cell.formula_units_Z ? _cell.length_a 39.066 _cell.length_a_esd ? _cell.length_b 39.066 _cell.length_b_esd ? _cell.length_c 98.623 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 18 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6OS8 _symmetry.cell_setting ? _symmetry.Int_Tables_number 146 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'H 3' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn 'Coiled-coil trimer with Glu:p-fluorophenylalanine:Lys Triad' 3704.220 2 ? ? ? ? 2 water nat water 18.015 42 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code '(ACE)EVEALEKKVEALE(PFF)KVQKLEKKVEALEHGWD' _entity_poly.pdbx_seq_one_letter_code_can XEVEALEKKVEALEFKVQKLEKKVEALEHGWD _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ACE n 1 2 GLU n 1 3 VAL n 1 4 GLU n 1 5 ALA n 1 6 LEU n 1 7 GLU n 1 8 LYS n 1 9 LYS n 1 10 VAL n 1 11 GLU n 1 12 ALA n 1 13 LEU n 1 14 GLU n 1 15 PFF n 1 16 LYS n 1 17 VAL n 1 18 GLN n 1 19 LYS n 1 20 LEU n 1 21 GLU n 1 22 LYS n 1 23 LYS n 1 24 VAL n 1 25 GLU n 1 26 ALA n 1 27 LEU n 1 28 GLU n 1 29 HIS n 1 30 GLY n 1 31 TRP n 1 32 ASP n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 32 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6OS8 _struct_ref.pdbx_db_accession 6OS8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6OS8 A 1 ? 32 ? 6OS8 0 ? 31 ? 0 31 2 1 6OS8 B 1 ? 32 ? 6OS8 0 ? 31 ? 0 31 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PFF 'L-peptide linking' n 4-FLUORO-L-PHENYLALANINE ? 'C9 H10 F N O2' 183.180 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6OS8 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.95 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 37.08 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '40% PEG300, 100 mM sodium cacodylate/HCl, pH 6.5, 200 mM calcium acetate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'APEX II CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-10-04 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5406 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'ENRAF-NONIUS FR591' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5406 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6OS8 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.15 _reflns.d_resolution_low 19.93 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 3077 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.1 _reflns.pdbx_Rmerge_I_obs 0.163 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.184 _reflns.pdbx_Rpim_I_all 0.083 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.972 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.15 _reflns_shell.d_res_low 2.227 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 321 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.353 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.454 _reflns_shell.pdbx_Rpim_I_all 0.282 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.845 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 58.650 _refine.B_iso_mean 26.7169 _refine.B_iso_min 13.810 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6OS8 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1500 _refine.ls_d_res_low 19.9260 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 3077 _refine.ls_number_reflns_R_free 517 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 90.4500 _refine.ls_percent_reflns_R_free 9.3000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2071 _refine.ls_R_factor_R_free 0.2783 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2000 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.980 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB entry 5UXT' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.9100 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3300 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.1500 _refine_hist.d_res_low 19.9260 _refine_hist.number_atoms_solvent 42 _refine_hist.number_atoms_total 564 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 64 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 33.62 _refine_hist.pdbx_number_atoms_protein 522 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.1505 2.3666 1269 . 111 1158 82.0000 . . . 0.3186 0.0000 0.2235 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 2.3666 2.7083 1361 . 139 1222 89.0000 . . . 0.3339 0.0000 0.2176 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 2.7083 3.4094 1410 . 123 1287 92.0000 . . . 0.3046 0.0000 0.2082 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 3.4094 19.9267 1519 . 144 1375 99.0000 . . . 0.2395 0.0000 0.1836 . . . . . . 4 . . . # _struct.entry_id 6OS8 _struct.title 'Coiled-coil Trimer with Glu:p-fluorophenylalanine:Lys Triad' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6OS8 _struct_keywords.text 'Trimer, Helix, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 2 ? GLY A 30 ? GLU A 1 GLY A 29 1 ? 29 HELX_P HELX_P2 AA2 GLU B 2 ? GLY B 30 ? GLU B 1 GLY B 29 1 ? 29 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ACE 1 C ? ? ? 1_555 A GLU 2 N ? ? A ACE 0 A GLU 1 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale2 covale both ? A GLU 14 C ? ? ? 1_555 A PFF 15 N ? ? A GLU 13 A PFF 14 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale3 covale both ? A PFF 15 C ? ? ? 1_555 A LYS 16 N ? ? A PFF 14 A LYS 15 1_555 ? ? ? ? ? ? ? 1.321 ? ? covale4 covale both ? B ACE 1 C ? ? ? 1_555 B GLU 2 N ? ? B ACE 0 B GLU 1 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale5 covale both ? B GLU 14 C ? ? ? 1_555 B PFF 15 N ? ? B GLU 13 B PFF 14 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale6 covale both ? B PFF 15 C ? ? ? 1_555 B LYS 16 N ? ? B PFF 14 B LYS 15 1_555 ? ? ? ? ? ? ? 1.329 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 6OS8 _atom_sites.fract_transf_matrix[1][1] 0.025598 _atom_sites.fract_transf_matrix[1][2] 0.014779 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.029558 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010140 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C F N O # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ACE 1 0 0 ACE ACE A . n A 1 2 GLU 2 1 1 GLU GLU A . n A 1 3 VAL 3 2 2 VAL VAL A . n A 1 4 GLU 4 3 3 GLU GLU A . n A 1 5 ALA 5 4 4 ALA ALA A . n A 1 6 LEU 6 5 5 LEU LEU A . n A 1 7 GLU 7 6 6 GLU GLU A . n A 1 8 LYS 8 7 7 LYS LYS A . n A 1 9 LYS 9 8 8 LYS LYS A . n A 1 10 VAL 10 9 9 VAL VAL A . n A 1 11 GLU 11 10 10 GLU GLU A . n A 1 12 ALA 12 11 11 ALA ALA A . n A 1 13 LEU 13 12 12 LEU LEU A . n A 1 14 GLU 14 13 13 GLU GLU A . n A 1 15 PFF 15 14 14 PFF PFF A . n A 1 16 LYS 16 15 15 LYS LYS A . n A 1 17 VAL 17 16 16 VAL VAL A . n A 1 18 GLN 18 17 17 GLN GLN A . n A 1 19 LYS 19 18 18 LYS LYS A . n A 1 20 LEU 20 19 19 LEU LEU A . n A 1 21 GLU 21 20 20 GLU GLU A . n A 1 22 LYS 22 21 21 LYS LYS A . n A 1 23 LYS 23 22 22 LYS LYS A . n A 1 24 VAL 24 23 23 VAL VAL A . n A 1 25 GLU 25 24 24 GLU GLU A . n A 1 26 ALA 26 25 25 ALA ALA A . n A 1 27 LEU 27 26 26 LEU LEU A . n A 1 28 GLU 28 27 27 GLU GLU A . n A 1 29 HIS 29 28 28 HIS HIS A . n A 1 30 GLY 30 29 29 GLY GLY A . n A 1 31 TRP 31 30 30 TRP TRP A . n A 1 32 ASP 32 31 31 ASP ASP A . n B 1 1 ACE 1 0 0 ACE ACE B . n B 1 2 GLU 2 1 1 GLU GLU B . n B 1 3 VAL 3 2 2 VAL VAL B . n B 1 4 GLU 4 3 3 GLU GLU B . n B 1 5 ALA 5 4 4 ALA ALA B . n B 1 6 LEU 6 5 5 LEU LEU B . n B 1 7 GLU 7 6 6 GLU GLU B . n B 1 8 LYS 8 7 7 LYS LYS B . n B 1 9 LYS 9 8 8 LYS LYS B . n B 1 10 VAL 10 9 9 VAL VAL B . n B 1 11 GLU 11 10 10 GLU GLU B . n B 1 12 ALA 12 11 11 ALA ALA B . n B 1 13 LEU 13 12 12 LEU LEU B . n B 1 14 GLU 14 13 13 GLU GLU B . n B 1 15 PFF 15 14 14 PFF PFF B . n B 1 16 LYS 16 15 15 LYS LYS B . n B 1 17 VAL 17 16 16 VAL VAL B . n B 1 18 GLN 18 17 17 GLN GLN B . n B 1 19 LYS 19 18 18 LYS LYS B . n B 1 20 LEU 20 19 19 LEU LEU B . n B 1 21 GLU 21 20 20 GLU GLU B . n B 1 22 LYS 22 21 21 LYS LYS B . n B 1 23 LYS 23 22 22 LYS LYS B . n B 1 24 VAL 24 23 23 VAL VAL B . n B 1 25 GLU 25 24 24 GLU GLU B . n B 1 26 ALA 26 25 25 ALA ALA B . n B 1 27 LEU 27 26 26 LEU LEU B . n B 1 28 GLU 28 27 27 GLU GLU B . n B 1 29 HIS 29 28 28 HIS HIS B . n B 1 30 GLY 30 29 29 GLY GLY B . n B 1 31 TRP 31 30 30 TRP TRP B . n B 1 32 ASP 32 31 31 ASP ASP B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 HOH 1 101 12 HOH HOH A . C 2 HOH 2 102 4 HOH HOH A . C 2 HOH 3 103 32 HOH HOH A . C 2 HOH 4 104 22 HOH HOH A . C 2 HOH 5 105 13 HOH HOH A . C 2 HOH 6 106 15 HOH HOH A . C 2 HOH 7 107 11 HOH HOH A . C 2 HOH 8 108 24 HOH HOH A . C 2 HOH 9 109 17 HOH HOH A . C 2 HOH 10 110 6 HOH HOH A . C 2 HOH 11 111 9 HOH HOH A . C 2 HOH 12 112 1 HOH HOH A . C 2 HOH 13 113 7 HOH HOH A . C 2 HOH 14 114 20 HOH HOH A . C 2 HOH 15 115 21 HOH HOH A . C 2 HOH 16 116 16 HOH HOH A . C 2 HOH 17 117 29 HOH HOH A . C 2 HOH 18 118 31 HOH HOH A . C 2 HOH 19 119 28 HOH HOH A . C 2 HOH 20 120 40 HOH HOH A . C 2 HOH 21 121 38 HOH HOH A . D 2 HOH 1 101 36 HOH HOH B . D 2 HOH 2 102 33 HOH HOH B . D 2 HOH 3 103 35 HOH HOH B . D 2 HOH 4 104 19 HOH HOH B . D 2 HOH 5 105 14 HOH HOH B . D 2 HOH 6 106 2 HOH HOH B . D 2 HOH 7 107 10 HOH HOH B . D 2 HOH 8 108 34 HOH HOH B . D 2 HOH 9 109 37 HOH HOH B . D 2 HOH 10 110 27 HOH HOH B . D 2 HOH 11 111 23 HOH HOH B . D 2 HOH 12 112 3 HOH HOH B . D 2 HOH 13 113 26 HOH HOH B . D 2 HOH 14 114 8 HOH HOH B . D 2 HOH 15 115 5 HOH HOH B . D 2 HOH 16 116 42 HOH HOH B . D 2 HOH 17 117 18 HOH HOH B . D 2 HOH 18 118 30 HOH HOH B . D 2 HOH 19 119 41 HOH HOH B . D 2 HOH 20 120 39 HOH HOH B . D 2 HOH 21 121 25 HOH HOH B . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA trimeric 3 2 author_and_software_defined_assembly PISA trimeric 3 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1,2,4 A,C 2 1,3,5 B,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3750 ? 1 MORE -31 ? 1 'SSA (A^2)' 6490 ? 2 'ABSA (A^2)' 3690 ? 2 MORE -35 ? 2 'SSA (A^2)' 6500 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_545 -y,x-y-1,z -0.5000000000 -0.8660254038 0.0000000000 19.5330000000 0.8660254038 -0.5000000000 0.0000000000 -33.8321484242 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 2_555 -y,x-y,z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 3_655 -x+y+1,-x,z -0.5000000000 0.8660254038 0.0000000000 39.0660000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 5 'crystal symmetry operation' 3_555 -x+y,-x,z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-04-29 2 'Structure model' 1 1 2020-05-20 3 'Structure model' 1 2 2023-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 3 'Structure model' '_database_2.pdbx_DOI' 6 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? dev_2906 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? 'PROTEUM PLUS' ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? 'PROTEUM PLUS' ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE1 _pdbx_validate_close_contact.auth_asym_id_1 B _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 1 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 B _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 101 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.81 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACE C C N N 1 ACE O O N N 2 ACE CH3 C N N 3 ACE H H N N 4 ACE H1 H N N 5 ACE H2 H N N 6 ACE H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ASP N N N N 21 ASP CA C N S 22 ASP C C N N 23 ASP O O N N 24 ASP CB C N N 25 ASP CG C N N 26 ASP OD1 O N N 27 ASP OD2 O N N 28 ASP OXT O N N 29 ASP H H N N 30 ASP H2 H N N 31 ASP HA H N N 32 ASP HB2 H N N 33 ASP HB3 H N N 34 ASP HD2 H N N 35 ASP HXT H N N 36 GLN N N N N 37 GLN CA C N S 38 GLN C C N N 39 GLN O O N N 40 GLN CB C N N 41 GLN CG C N N 42 GLN CD C N N 43 GLN OE1 O N N 44 GLN NE2 N N N 45 GLN OXT O N N 46 GLN H H N N 47 GLN H2 H N N 48 GLN HA H N N 49 GLN HB2 H N N 50 GLN HB3 H N N 51 GLN HG2 H N N 52 GLN HG3 H N N 53 GLN HE21 H N N 54 GLN HE22 H N N 55 GLN HXT H N N 56 GLU N N N N 57 GLU CA C N S 58 GLU C C N N 59 GLU O O N N 60 GLU CB C N N 61 GLU CG C N N 62 GLU CD C N N 63 GLU OE1 O N N 64 GLU OE2 O N N 65 GLU OXT O N N 66 GLU H H N N 67 GLU H2 H N N 68 GLU HA H N N 69 GLU HB2 H N N 70 GLU HB3 H N N 71 GLU HG2 H N N 72 GLU HG3 H N N 73 GLU HE2 H N N 74 GLU HXT H N N 75 GLY N N N N 76 GLY CA C N N 77 GLY C C N N 78 GLY O O N N 79 GLY OXT O N N 80 GLY H H N N 81 GLY H2 H N N 82 GLY HA2 H N N 83 GLY HA3 H N N 84 GLY HXT H N N 85 HIS N N N N 86 HIS CA C N S 87 HIS C C N N 88 HIS O O N N 89 HIS CB C N N 90 HIS CG C Y N 91 HIS ND1 N Y N 92 HIS CD2 C Y N 93 HIS CE1 C Y N 94 HIS NE2 N Y N 95 HIS OXT O N N 96 HIS H H N N 97 HIS H2 H N N 98 HIS HA H N N 99 HIS HB2 H N N 100 HIS HB3 H N N 101 HIS HD1 H N N 102 HIS HD2 H N N 103 HIS HE1 H N N 104 HIS HE2 H N N 105 HIS HXT H N N 106 HOH O O N N 107 HOH H1 H N N 108 HOH H2 H N N 109 LEU N N N N 110 LEU CA C N S 111 LEU C C N N 112 LEU O O N N 113 LEU CB C N N 114 LEU CG C N N 115 LEU CD1 C N N 116 LEU CD2 C N N 117 LEU OXT O N N 118 LEU H H N N 119 LEU H2 H N N 120 LEU HA H N N 121 LEU HB2 H N N 122 LEU HB3 H N N 123 LEU HG H N N 124 LEU HD11 H N N 125 LEU HD12 H N N 126 LEU HD13 H N N 127 LEU HD21 H N N 128 LEU HD22 H N N 129 LEU HD23 H N N 130 LEU HXT H N N 131 LYS N N N N 132 LYS CA C N S 133 LYS C C N N 134 LYS O O N N 135 LYS CB C N N 136 LYS CG C N N 137 LYS CD C N N 138 LYS CE C N N 139 LYS NZ N N N 140 LYS OXT O N N 141 LYS H H N N 142 LYS H2 H N N 143 LYS HA H N N 144 LYS HB2 H N N 145 LYS HB3 H N N 146 LYS HG2 H N N 147 LYS HG3 H N N 148 LYS HD2 H N N 149 LYS HD3 H N N 150 LYS HE2 H N N 151 LYS HE3 H N N 152 LYS HZ1 H N N 153 LYS HZ2 H N N 154 LYS HZ3 H N N 155 LYS HXT H N N 156 PFF N N N N 157 PFF CA C N S 158 PFF C C N N 159 PFF O O N N 160 PFF OXT O N N 161 PFF CB C N N 162 PFF CG C Y N 163 PFF CD1 C Y N 164 PFF CD2 C Y N 165 PFF CE1 C Y N 166 PFF CE2 C Y N 167 PFF CZ C Y N 168 PFF F F N N 169 PFF H H N N 170 PFF H2 H N N 171 PFF HA H N N 172 PFF HXT H N N 173 PFF HB2 H N N 174 PFF HB3 H N N 175 PFF HD1 H N N 176 PFF HD2 H N N 177 PFF HE1 H N N 178 PFF HE2 H N N 179 TRP N N N N 180 TRP CA C N S 181 TRP C C N N 182 TRP O O N N 183 TRP CB C N N 184 TRP CG C Y N 185 TRP CD1 C Y N 186 TRP CD2 C Y N 187 TRP NE1 N Y N 188 TRP CE2 C Y N 189 TRP CE3 C Y N 190 TRP CZ2 C Y N 191 TRP CZ3 C Y N 192 TRP CH2 C Y N 193 TRP OXT O N N 194 TRP H H N N 195 TRP H2 H N N 196 TRP HA H N N 197 TRP HB2 H N N 198 TRP HB3 H N N 199 TRP HD1 H N N 200 TRP HE1 H N N 201 TRP HE3 H N N 202 TRP HZ2 H N N 203 TRP HZ3 H N N 204 TRP HH2 H N N 205 TRP HXT H N N 206 VAL N N N N 207 VAL CA C N S 208 VAL C C N N 209 VAL O O N N 210 VAL CB C N N 211 VAL CG1 C N N 212 VAL CG2 C N N 213 VAL OXT O N N 214 VAL H H N N 215 VAL H2 H N N 216 VAL HA H N N 217 VAL HB H N N 218 VAL HG11 H N N 219 VAL HG12 H N N 220 VAL HG13 H N N 221 VAL HG21 H N N 222 VAL HG22 H N N 223 VAL HG23 H N N 224 VAL HXT H N N 225 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACE C O doub N N 1 ACE C CH3 sing N N 2 ACE C H sing N N 3 ACE CH3 H1 sing N N 4 ACE CH3 H2 sing N N 5 ACE CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ASP N CA sing N N 19 ASP N H sing N N 20 ASP N H2 sing N N 21 ASP CA C sing N N 22 ASP CA CB sing N N 23 ASP CA HA sing N N 24 ASP C O doub N N 25 ASP C OXT sing N N 26 ASP CB CG sing N N 27 ASP CB HB2 sing N N 28 ASP CB HB3 sing N N 29 ASP CG OD1 doub N N 30 ASP CG OD2 sing N N 31 ASP OD2 HD2 sing N N 32 ASP OXT HXT sing N N 33 GLN N CA sing N N 34 GLN N H sing N N 35 GLN N H2 sing N N 36 GLN CA C sing N N 37 GLN CA CB sing N N 38 GLN CA HA sing N N 39 GLN C O doub N N 40 GLN C OXT sing N N 41 GLN CB CG sing N N 42 GLN CB HB2 sing N N 43 GLN CB HB3 sing N N 44 GLN CG CD sing N N 45 GLN CG HG2 sing N N 46 GLN CG HG3 sing N N 47 GLN CD OE1 doub N N 48 GLN CD NE2 sing N N 49 GLN NE2 HE21 sing N N 50 GLN NE2 HE22 sing N N 51 GLN OXT HXT sing N N 52 GLU N CA sing N N 53 GLU N H sing N N 54 GLU N H2 sing N N 55 GLU CA C sing N N 56 GLU CA CB sing N N 57 GLU CA HA sing N N 58 GLU C O doub N N 59 GLU C OXT sing N N 60 GLU CB CG sing N N 61 GLU CB HB2 sing N N 62 GLU CB HB3 sing N N 63 GLU CG CD sing N N 64 GLU CG HG2 sing N N 65 GLU CG HG3 sing N N 66 GLU CD OE1 doub N N 67 GLU CD OE2 sing N N 68 GLU OE2 HE2 sing N N 69 GLU OXT HXT sing N N 70 GLY N CA sing N N 71 GLY N H sing N N 72 GLY N H2 sing N N 73 GLY CA C sing N N 74 GLY CA HA2 sing N N 75 GLY CA HA3 sing N N 76 GLY C O doub N N 77 GLY C OXT sing N N 78 GLY OXT HXT sing N N 79 HIS N CA sing N N 80 HIS N H sing N N 81 HIS N H2 sing N N 82 HIS CA C sing N N 83 HIS CA CB sing N N 84 HIS CA HA sing N N 85 HIS C O doub N N 86 HIS C OXT sing N N 87 HIS CB CG sing N N 88 HIS CB HB2 sing N N 89 HIS CB HB3 sing N N 90 HIS CG ND1 sing Y N 91 HIS CG CD2 doub Y N 92 HIS ND1 CE1 doub Y N 93 HIS ND1 HD1 sing N N 94 HIS CD2 NE2 sing Y N 95 HIS CD2 HD2 sing N N 96 HIS CE1 NE2 sing Y N 97 HIS CE1 HE1 sing N N 98 HIS NE2 HE2 sing N N 99 HIS OXT HXT sing N N 100 HOH O H1 sing N N 101 HOH O H2 sing N N 102 LEU N CA sing N N 103 LEU N H sing N N 104 LEU N H2 sing N N 105 LEU CA C sing N N 106 LEU CA CB sing N N 107 LEU CA HA sing N N 108 LEU C O doub N N 109 LEU C OXT sing N N 110 LEU CB CG sing N N 111 LEU CB HB2 sing N N 112 LEU CB HB3 sing N N 113 LEU CG CD1 sing N N 114 LEU CG CD2 sing N N 115 LEU CG HG sing N N 116 LEU CD1 HD11 sing N N 117 LEU CD1 HD12 sing N N 118 LEU CD1 HD13 sing N N 119 LEU CD2 HD21 sing N N 120 LEU CD2 HD22 sing N N 121 LEU CD2 HD23 sing N N 122 LEU OXT HXT sing N N 123 LYS N CA sing N N 124 LYS N H sing N N 125 LYS N H2 sing N N 126 LYS CA C sing N N 127 LYS CA CB sing N N 128 LYS CA HA sing N N 129 LYS C O doub N N 130 LYS C OXT sing N N 131 LYS CB CG sing N N 132 LYS CB HB2 sing N N 133 LYS CB HB3 sing N N 134 LYS CG CD sing N N 135 LYS CG HG2 sing N N 136 LYS CG HG3 sing N N 137 LYS CD CE sing N N 138 LYS CD HD2 sing N N 139 LYS CD HD3 sing N N 140 LYS CE NZ sing N N 141 LYS CE HE2 sing N N 142 LYS CE HE3 sing N N 143 LYS NZ HZ1 sing N N 144 LYS NZ HZ2 sing N N 145 LYS NZ HZ3 sing N N 146 LYS OXT HXT sing N N 147 PFF N CA sing N N 148 PFF N H sing N N 149 PFF N H2 sing N N 150 PFF CA C sing N N 151 PFF CA CB sing N N 152 PFF CA HA sing N N 153 PFF C O doub N N 154 PFF C OXT sing N N 155 PFF OXT HXT sing N N 156 PFF CB CG sing N N 157 PFF CB HB2 sing N N 158 PFF CB HB3 sing N N 159 PFF CG CD1 doub Y N 160 PFF CG CD2 sing Y N 161 PFF CD1 CE1 sing Y N 162 PFF CD1 HD1 sing N N 163 PFF CD2 CE2 doub Y N 164 PFF CD2 HD2 sing N N 165 PFF CE1 CZ doub Y N 166 PFF CE1 HE1 sing N N 167 PFF CE2 CZ sing Y N 168 PFF CE2 HE2 sing N N 169 PFF CZ F sing N N 170 TRP N CA sing N N 171 TRP N H sing N N 172 TRP N H2 sing N N 173 TRP CA C sing N N 174 TRP CA CB sing N N 175 TRP CA HA sing N N 176 TRP C O doub N N 177 TRP C OXT sing N N 178 TRP CB CG sing N N 179 TRP CB HB2 sing N N 180 TRP CB HB3 sing N N 181 TRP CG CD1 doub Y N 182 TRP CG CD2 sing Y N 183 TRP CD1 NE1 sing Y N 184 TRP CD1 HD1 sing N N 185 TRP CD2 CE2 doub Y N 186 TRP CD2 CE3 sing Y N 187 TRP NE1 CE2 sing Y N 188 TRP NE1 HE1 sing N N 189 TRP CE2 CZ2 sing Y N 190 TRP CE3 CZ3 doub Y N 191 TRP CE3 HE3 sing N N 192 TRP CZ2 CH2 doub Y N 193 TRP CZ2 HZ2 sing N N 194 TRP CZ3 CH2 sing Y N 195 TRP CZ3 HZ3 sing N N 196 TRP CH2 HH2 sing N N 197 TRP OXT HXT sing N N 198 VAL N CA sing N N 199 VAL N H sing N N 200 VAL N H2 sing N N 201 VAL CA C sing N N 202 VAL CA CB sing N N 203 VAL CA HA sing N N 204 VAL C O doub N N 205 VAL C OXT sing N N 206 VAL CB CG1 sing N N 207 VAL CB CG2 sing N N 208 VAL CB HB sing N N 209 VAL CG1 HG11 sing N N 210 VAL CG1 HG12 sing N N 211 VAL CG1 HG13 sing N N 212 VAL CG2 HG21 sing N N 213 VAL CG2 HG22 sing N N 214 VAL CG2 HG23 sing N N 215 VAL OXT HXT sing N N 216 # _pdbx_audit_support.funding_organization 'National Institutes of Health/Office of the Director' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 'R15 GM116055-01' _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5UXT _pdbx_initial_refinement_model.details 'PDB entry 5UXT' # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #