data_6OVA # _entry.id 6OVA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6OVA pdb_00006ova 10.2210/pdb6ova/pdb WWPDB D_1000241122 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-02-12 2 'Structure model' 1 1 2024-03-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6OVA _pdbx_database_status.recvd_initial_deposition_date 2019-05-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Skene, R.J.' 1 0000-0002-1482-6546 'Hoffman, I.D.' 2 0000-0003-2694-802X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Bioorg.Med.Chem.Lett. _citation.journal_id_ASTM BMCLE8 _citation.journal_id_CSD 1127 _citation.journal_id_ISSN 1464-3405 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 30 _citation.language ? _citation.page_first 126963 _citation.page_last 126963 _citation.title ;Efficient synthesis of tert-butyl 3-cyano-3-cyclopropyl-2-oxopyrrolidine-4-carboxylates: Highly functionalized 2-pyrrolidinone enabling access to novel macrocyclic Tyk2 inhibitors. ; _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bmcl.2020.126963 _citation.pdbx_database_id_PubMed 31980341 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sasaki, Y.' 1 ? primary 'Tokuhara, H.' 2 ? primary 'Ohba, Y.' 3 ? primary 'Okabe, A.' 4 ? primary 'Nakayama, M.' 5 ? primary 'Nakagawa, H.' 6 ? primary 'Skene, R.' 7 ? primary 'Hoffman, I.' 8 ? primary 'Zou, H.' 9 ? primary 'Yoshida, M.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Non-receptor tyrosine-protein kinase TYK2' 34844.863 1 2.7.10.2 ? 'residues 884-1176' ? 2 non-polymer syn '6-({4-[(3S)-3-cyano-3-cyclopropyl-2-oxopyrrolidin-1-yl]pyridin-2-yl}amino)-N,N-dimethylpyridine-3-carboxamide' 390.438 1 ? ? ? ? 3 water nat water 18.015 50 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSPASDPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHIIK YKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHSQHYIHRNLAARNVLLDNDRLVKIGD FGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTV LRLTELLERGERLPRPDKCPCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSPASDPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHIIK YKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHSQHYIHRNLAARNVLLDNDRLVKIGD FGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTV LRLTELLERGERLPRPDKCPCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '6-({4-[(3S)-3-cyano-3-cyclopropyl-2-oxopyrrolidin-1-yl]pyridin-2-yl}amino)-N,N-dimethylpyridine-3-carboxamide' N9G 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 PRO n 1 5 ALA n 1 6 SER n 1 7 ASP n 1 8 PRO n 1 9 THR n 1 10 VAL n 1 11 PHE n 1 12 HIS n 1 13 LYS n 1 14 ARG n 1 15 TYR n 1 16 LEU n 1 17 LYS n 1 18 LYS n 1 19 ILE n 1 20 ARG n 1 21 ASP n 1 22 LEU n 1 23 GLY n 1 24 GLU n 1 25 GLY n 1 26 HIS n 1 27 PHE n 1 28 GLY n 1 29 LYS n 1 30 VAL n 1 31 SER n 1 32 LEU n 1 33 TYR n 1 34 CYS n 1 35 TYR n 1 36 ASP n 1 37 PRO n 1 38 THR n 1 39 ASN n 1 40 ASP n 1 41 GLY n 1 42 THR n 1 43 GLY n 1 44 GLU n 1 45 MET n 1 46 VAL n 1 47 ALA n 1 48 VAL n 1 49 LYS n 1 50 ALA n 1 51 LEU n 1 52 LYS n 1 53 ALA n 1 54 ASP n 1 55 CYS n 1 56 GLY n 1 57 PRO n 1 58 GLN n 1 59 HIS n 1 60 ARG n 1 61 SER n 1 62 GLY n 1 63 TRP n 1 64 LYS n 1 65 GLN n 1 66 GLU n 1 67 ILE n 1 68 ASP n 1 69 ILE n 1 70 LEU n 1 71 ARG n 1 72 THR n 1 73 LEU n 1 74 TYR n 1 75 HIS n 1 76 GLU n 1 77 HIS n 1 78 ILE n 1 79 ILE n 1 80 LYS n 1 81 TYR n 1 82 LYS n 1 83 GLY n 1 84 CYS n 1 85 CYS n 1 86 GLU n 1 87 ASP n 1 88 GLN n 1 89 GLY n 1 90 GLU n 1 91 LYS n 1 92 SER n 1 93 LEU n 1 94 GLN n 1 95 LEU n 1 96 VAL n 1 97 MET n 1 98 GLU n 1 99 TYR n 1 100 VAL n 1 101 PRO n 1 102 LEU n 1 103 GLY n 1 104 SER n 1 105 LEU n 1 106 ARG n 1 107 ASP n 1 108 TYR n 1 109 LEU n 1 110 PRO n 1 111 ARG n 1 112 HIS n 1 113 SER n 1 114 ILE n 1 115 GLY n 1 116 LEU n 1 117 ALA n 1 118 GLN n 1 119 LEU n 1 120 LEU n 1 121 LEU n 1 122 PHE n 1 123 ALA n 1 124 GLN n 1 125 GLN n 1 126 ILE n 1 127 CYS n 1 128 GLU n 1 129 GLY n 1 130 MET n 1 131 ALA n 1 132 TYR n 1 133 LEU n 1 134 HIS n 1 135 SER n 1 136 GLN n 1 137 HIS n 1 138 TYR n 1 139 ILE n 1 140 HIS n 1 141 ARG n 1 142 ASN n 1 143 LEU n 1 144 ALA n 1 145 ALA n 1 146 ARG n 1 147 ASN n 1 148 VAL n 1 149 LEU n 1 150 LEU n 1 151 ASP n 1 152 ASN n 1 153 ASP n 1 154 ARG n 1 155 LEU n 1 156 VAL n 1 157 LYS n 1 158 ILE n 1 159 GLY n 1 160 ASP n 1 161 PHE n 1 162 GLY n 1 163 LEU n 1 164 ALA n 1 165 LYS n 1 166 ALA n 1 167 VAL n 1 168 PRO n 1 169 GLU n 1 170 GLY n 1 171 HIS n 1 172 GLU n 1 173 TYR n 1 174 TYR n 1 175 ARG n 1 176 VAL n 1 177 ARG n 1 178 GLU n 1 179 ASP n 1 180 GLY n 1 181 ASP n 1 182 SER n 1 183 PRO n 1 184 VAL n 1 185 PHE n 1 186 TRP n 1 187 TYR n 1 188 ALA n 1 189 PRO n 1 190 GLU n 1 191 CYS n 1 192 LEU n 1 193 LYS n 1 194 GLU n 1 195 TYR n 1 196 LYS n 1 197 PHE n 1 198 TYR n 1 199 TYR n 1 200 ALA n 1 201 SER n 1 202 ASP n 1 203 VAL n 1 204 TRP n 1 205 SER n 1 206 PHE n 1 207 GLY n 1 208 VAL n 1 209 THR n 1 210 LEU n 1 211 TYR n 1 212 GLU n 1 213 LEU n 1 214 LEU n 1 215 THR n 1 216 HIS n 1 217 CYS n 1 218 ASP n 1 219 SER n 1 220 SER n 1 221 GLN n 1 222 SER n 1 223 PRO n 1 224 PRO n 1 225 THR n 1 226 LYS n 1 227 PHE n 1 228 LEU n 1 229 GLU n 1 230 LEU n 1 231 ILE n 1 232 GLY n 1 233 ILE n 1 234 ALA n 1 235 GLN n 1 236 GLY n 1 237 GLN n 1 238 MET n 1 239 THR n 1 240 VAL n 1 241 LEU n 1 242 ARG n 1 243 LEU n 1 244 THR n 1 245 GLU n 1 246 LEU n 1 247 LEU n 1 248 GLU n 1 249 ARG n 1 250 GLY n 1 251 GLU n 1 252 ARG n 1 253 LEU n 1 254 PRO n 1 255 ARG n 1 256 PRO n 1 257 ASP n 1 258 LYS n 1 259 CYS n 1 260 PRO n 1 261 CYS n 1 262 GLU n 1 263 VAL n 1 264 TYR n 1 265 HIS n 1 266 LEU n 1 267 MET n 1 268 LYS n 1 269 ASN n 1 270 CYS n 1 271 TRP n 1 272 GLU n 1 273 THR n 1 274 GLU n 1 275 ALA n 1 276 SER n 1 277 PHE n 1 278 ARG n 1 279 PRO n 1 280 THR n 1 281 PHE n 1 282 GLU n 1 283 ASN n 1 284 LEU n 1 285 ILE n 1 286 PRO n 1 287 ILE n 1 288 LEU n 1 289 LYS n 1 290 THR n 1 291 VAL n 1 292 HIS n 1 293 GLU n 1 294 LYS n 1 295 TYR n 1 296 HIS n 1 297 HIS n 1 298 HIS n 1 299 HIS n 1 300 HIS n 1 301 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 301 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene TYK2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'unidentified baculovirus' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 10469 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 N9G non-polymer . '6-({4-[(3S)-3-cyano-3-cyclopropyl-2-oxopyrrolidin-1-yl]pyridin-2-yl}amino)-N,N-dimethylpyridine-3-carboxamide' ? 'C21 H22 N6 O2' 390.438 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 882 ? ? ? A . n A 1 2 GLY 2 883 ? ? ? A . n A 1 3 SER 3 884 ? ? ? A . n A 1 4 PRO 4 885 ? ? ? A . n A 1 5 ALA 5 886 ? ? ? A . n A 1 6 SER 6 887 ? ? ? A . n A 1 7 ASP 7 888 888 ASP ASP A . n A 1 8 PRO 8 889 889 PRO PRO A . n A 1 9 THR 9 890 890 THR THR A . n A 1 10 VAL 10 891 891 VAL VAL A . n A 1 11 PHE 11 892 892 PHE PHE A . n A 1 12 HIS 12 893 893 HIS HIS A . n A 1 13 LYS 13 894 894 LYS LYS A . n A 1 14 ARG 14 895 895 ARG ARG A . n A 1 15 TYR 15 896 896 TYR TYR A . n A 1 16 LEU 16 897 897 LEU LEU A . n A 1 17 LYS 17 898 898 LYS LYS A . n A 1 18 LYS 18 899 899 LYS LYS A . n A 1 19 ILE 19 900 900 ILE ILE A . n A 1 20 ARG 20 901 901 ARG ARG A . n A 1 21 ASP 21 902 902 ASP ASP A . n A 1 22 LEU 22 903 903 LEU LEU A . n A 1 23 GLY 23 904 904 GLY GLY A . n A 1 24 GLU 24 905 905 GLU GLU A . n A 1 25 GLY 25 906 906 GLY GLY A . n A 1 26 HIS 26 907 907 HIS HIS A . n A 1 27 PHE 27 908 908 PHE PHE A . n A 1 28 GLY 28 909 909 GLY GLY A . n A 1 29 LYS 29 910 910 LYS LYS A . n A 1 30 VAL 30 911 911 VAL VAL A . n A 1 31 SER 31 912 912 SER SER A . n A 1 32 LEU 32 913 913 LEU LEU A . n A 1 33 TYR 33 914 914 TYR TYR A . n A 1 34 CYS 34 915 915 CYS CYS A . n A 1 35 TYR 35 916 916 TYR TYR A . n A 1 36 ASP 36 917 917 ASP ASP A . n A 1 37 PRO 37 918 918 PRO PRO A . n A 1 38 THR 38 919 919 THR THR A . n A 1 39 ASN 39 920 920 ASN ASN A . n A 1 40 ASP 40 921 921 ASP ASP A . n A 1 41 GLY 41 922 922 GLY GLY A . n A 1 42 THR 42 923 923 THR THR A . n A 1 43 GLY 43 924 924 GLY GLY A . n A 1 44 GLU 44 925 925 GLU GLU A . n A 1 45 MET 45 926 926 MET MET A . n A 1 46 VAL 46 927 927 VAL VAL A . n A 1 47 ALA 47 928 928 ALA ALA A . n A 1 48 VAL 48 929 929 VAL VAL A . n A 1 49 LYS 49 930 930 LYS LYS A . n A 1 50 ALA 50 931 931 ALA ALA A . n A 1 51 LEU 51 932 932 LEU LEU A . n A 1 52 LYS 52 933 933 LYS LYS A . n A 1 53 ALA 53 934 ? ? ? A . n A 1 54 ASP 54 935 ? ? ? A . n A 1 55 CYS 55 936 ? ? ? A . n A 1 56 GLY 56 937 ? ? ? A . n A 1 57 PRO 57 938 ? ? ? A . n A 1 58 GLN 58 939 ? ? ? A . n A 1 59 HIS 59 940 ? ? ? A . n A 1 60 ARG 60 941 ? ? ? A . n A 1 61 SER 61 942 942 SER SER A . n A 1 62 GLY 62 943 943 GLY GLY A . n A 1 63 TRP 63 944 944 TRP TRP A . n A 1 64 LYS 64 945 945 LYS LYS A . n A 1 65 GLN 65 946 946 GLN GLN A . n A 1 66 GLU 66 947 947 GLU GLU A . n A 1 67 ILE 67 948 948 ILE ILE A . n A 1 68 ASP 68 949 949 ASP ASP A . n A 1 69 ILE 69 950 950 ILE ILE A . n A 1 70 LEU 70 951 951 LEU LEU A . n A 1 71 ARG 71 952 952 ARG ARG A . n A 1 72 THR 72 953 953 THR THR A . n A 1 73 LEU 73 954 954 LEU LEU A . n A 1 74 TYR 74 955 955 TYR TYR A . n A 1 75 HIS 75 956 956 HIS HIS A . n A 1 76 GLU 76 957 957 GLU GLU A . n A 1 77 HIS 77 958 958 HIS HIS A . n A 1 78 ILE 78 959 959 ILE ILE A . n A 1 79 ILE 79 960 960 ILE ILE A . n A 1 80 LYS 80 961 961 LYS LYS A . n A 1 81 TYR 81 962 962 TYR TYR A . n A 1 82 LYS 82 963 963 LYS LYS A . n A 1 83 GLY 83 964 964 GLY GLY A . n A 1 84 CYS 84 965 965 CYS CYS A . n A 1 85 CYS 85 966 966 CYS CYS A . n A 1 86 GLU 86 967 967 GLU GLU A . n A 1 87 ASP 87 968 ? ? ? A . n A 1 88 GLN 88 969 ? ? ? A . n A 1 89 GLY 89 970 ? ? ? A . n A 1 90 GLU 90 971 ? ? ? A . n A 1 91 LYS 91 972 ? ? ? A . n A 1 92 SER 92 973 973 SER SER A . n A 1 93 LEU 93 974 974 LEU LEU A . n A 1 94 GLN 94 975 975 GLN GLN A . n A 1 95 LEU 95 976 976 LEU LEU A . n A 1 96 VAL 96 977 977 VAL VAL A . n A 1 97 MET 97 978 978 MET MET A . n A 1 98 GLU 98 979 979 GLU GLU A . n A 1 99 TYR 99 980 980 TYR TYR A . n A 1 100 VAL 100 981 981 VAL VAL A . n A 1 101 PRO 101 982 982 PRO PRO A . n A 1 102 LEU 102 983 983 LEU LEU A . n A 1 103 GLY 103 984 984 GLY GLY A . n A 1 104 SER 104 985 985 SER SER A . n A 1 105 LEU 105 986 986 LEU LEU A . n A 1 106 ARG 106 987 987 ARG ARG A . n A 1 107 ASP 107 988 988 ASP ASP A . n A 1 108 TYR 108 989 989 TYR TYR A . n A 1 109 LEU 109 990 990 LEU LEU A . n A 1 110 PRO 110 991 991 PRO PRO A . n A 1 111 ARG 111 992 992 ARG ARG A . n A 1 112 HIS 112 993 993 HIS HIS A . n A 1 113 SER 113 994 994 SER SER A . n A 1 114 ILE 114 995 995 ILE ILE A . n A 1 115 GLY 115 996 996 GLY GLY A . n A 1 116 LEU 116 997 997 LEU LEU A . n A 1 117 ALA 117 998 998 ALA ALA A . n A 1 118 GLN 118 999 999 GLN GLN A . n A 1 119 LEU 119 1000 1000 LEU LEU A . n A 1 120 LEU 120 1001 1001 LEU LEU A . n A 1 121 LEU 121 1002 1002 LEU LEU A . n A 1 122 PHE 122 1003 1003 PHE PHE A . n A 1 123 ALA 123 1004 1004 ALA ALA A . n A 1 124 GLN 124 1005 1005 GLN GLN A . n A 1 125 GLN 125 1006 1006 GLN GLN A . n A 1 126 ILE 126 1007 1007 ILE ILE A . n A 1 127 CYS 127 1008 1008 CYS CYS A . n A 1 128 GLU 128 1009 1009 GLU GLU A . n A 1 129 GLY 129 1010 1010 GLY GLY A . n A 1 130 MET 130 1011 1011 MET MET A . n A 1 131 ALA 131 1012 1012 ALA ALA A . n A 1 132 TYR 132 1013 1013 TYR TYR A . n A 1 133 LEU 133 1014 1014 LEU LEU A . n A 1 134 HIS 134 1015 1015 HIS HIS A . n A 1 135 SER 135 1016 1016 SER SER A . n A 1 136 GLN 136 1017 1017 GLN GLN A . n A 1 137 HIS 137 1018 1018 HIS HIS A . n A 1 138 TYR 138 1019 1019 TYR TYR A . n A 1 139 ILE 139 1020 1020 ILE ILE A . n A 1 140 HIS 140 1021 1021 HIS HIS A . n A 1 141 ARG 141 1022 1022 ARG ARG A . n A 1 142 ASN 142 1023 1023 ASN ASN A . n A 1 143 LEU 143 1024 1024 LEU LEU A . n A 1 144 ALA 144 1025 1025 ALA ALA A . n A 1 145 ALA 145 1026 1026 ALA ALA A . n A 1 146 ARG 146 1027 1027 ARG ARG A . n A 1 147 ASN 147 1028 1028 ASN ASN A . n A 1 148 VAL 148 1029 1029 VAL VAL A . n A 1 149 LEU 149 1030 1030 LEU LEU A . n A 1 150 LEU 150 1031 1031 LEU LEU A . n A 1 151 ASP 151 1032 1032 ASP ASP A . n A 1 152 ASN 152 1033 1033 ASN ASN A . n A 1 153 ASP 153 1034 1034 ASP ASP A . n A 1 154 ARG 154 1035 1035 ARG ARG A . n A 1 155 LEU 155 1036 1036 LEU LEU A . n A 1 156 VAL 156 1037 1037 VAL VAL A . n A 1 157 LYS 157 1038 1038 LYS LYS A . n A 1 158 ILE 158 1039 1039 ILE ILE A . n A 1 159 GLY 159 1040 1040 GLY GLY A . n A 1 160 ASP 160 1041 1041 ASP ASP A . n A 1 161 PHE 161 1042 1042 PHE PHE A . n A 1 162 GLY 162 1043 1043 GLY GLY A . n A 1 163 LEU 163 1044 1044 LEU LEU A . n A 1 164 ALA 164 1045 1045 ALA ALA A . n A 1 165 LYS 165 1046 1046 LYS LYS A . n A 1 166 ALA 166 1047 1047 ALA ALA A . n A 1 167 VAL 167 1048 1048 VAL VAL A . n A 1 168 PRO 168 1049 1049 PRO PRO A . n A 1 169 GLU 169 1050 1050 GLU GLU A . n A 1 170 GLY 170 1051 1051 GLY GLY A . n A 1 171 HIS 171 1052 1052 HIS HIS A . n A 1 172 GLU 172 1053 1053 GLU GLU A . n A 1 173 TYR 173 1054 1054 TYR TYR A . n A 1 174 TYR 174 1055 1055 TYR TYR A . n A 1 175 ARG 175 1056 1056 ARG ARG A . n A 1 176 VAL 176 1057 1057 VAL VAL A . n A 1 177 ARG 177 1058 1058 ARG ARG A . n A 1 178 GLU 178 1059 1059 GLU GLU A . n A 1 179 ASP 179 1060 1060 ASP ASP A . n A 1 180 GLY 180 1061 1061 GLY GLY A . n A 1 181 ASP 181 1062 1062 ASP ASP A . n A 1 182 SER 182 1063 1063 SER SER A . n A 1 183 PRO 183 1064 1064 PRO PRO A . n A 1 184 VAL 184 1065 1065 VAL VAL A . n A 1 185 PHE 185 1066 1066 PHE PHE A . n A 1 186 TRP 186 1067 1067 TRP TRP A . n A 1 187 TYR 187 1068 1068 TYR TYR A . n A 1 188 ALA 188 1069 1069 ALA ALA A . n A 1 189 PRO 189 1070 1070 PRO PRO A . n A 1 190 GLU 190 1071 1071 GLU GLU A . n A 1 191 CYS 191 1072 1072 CYS CYS A . n A 1 192 LEU 192 1073 1073 LEU LEU A . n A 1 193 LYS 193 1074 1074 LYS LYS A . n A 1 194 GLU 194 1075 1075 GLU GLU A . n A 1 195 TYR 195 1076 1076 TYR TYR A . n A 1 196 LYS 196 1077 1077 LYS LYS A . n A 1 197 PHE 197 1078 1078 PHE PHE A . n A 1 198 TYR 198 1079 1079 TYR TYR A . n A 1 199 TYR 199 1080 1080 TYR TYR A . n A 1 200 ALA 200 1081 1081 ALA ALA A . n A 1 201 SER 201 1082 1082 SER SER A . n A 1 202 ASP 202 1083 1083 ASP ASP A . n A 1 203 VAL 203 1084 1084 VAL VAL A . n A 1 204 TRP 204 1085 1085 TRP TRP A . n A 1 205 SER 205 1086 1086 SER SER A . n A 1 206 PHE 206 1087 1087 PHE PHE A . n A 1 207 GLY 207 1088 1088 GLY GLY A . n A 1 208 VAL 208 1089 1089 VAL VAL A . n A 1 209 THR 209 1090 1090 THR THR A . n A 1 210 LEU 210 1091 1091 LEU LEU A . n A 1 211 TYR 211 1092 1092 TYR TYR A . n A 1 212 GLU 212 1093 1093 GLU GLU A . n A 1 213 LEU 213 1094 1094 LEU LEU A . n A 1 214 LEU 214 1095 1095 LEU LEU A . n A 1 215 THR 215 1096 1096 THR THR A . n A 1 216 HIS 216 1097 1097 HIS HIS A . n A 1 217 CYS 217 1098 1098 CYS CYS A . n A 1 218 ASP 218 1099 1099 ASP ASP A . n A 1 219 SER 219 1100 1100 SER SER A . n A 1 220 SER 220 1101 1101 SER SER A . n A 1 221 GLN 221 1102 1102 GLN GLN A . n A 1 222 SER 222 1103 1103 SER SER A . n A 1 223 PRO 223 1104 1104 PRO PRO A . n A 1 224 PRO 224 1105 1105 PRO PRO A . n A 1 225 THR 225 1106 1106 THR THR A . n A 1 226 LYS 226 1107 1107 LYS LYS A . n A 1 227 PHE 227 1108 1108 PHE PHE A . n A 1 228 LEU 228 1109 1109 LEU LEU A . n A 1 229 GLU 229 1110 1110 GLU GLU A . n A 1 230 LEU 230 1111 1111 LEU LEU A . n A 1 231 ILE 231 1112 1112 ILE ILE A . n A 1 232 GLY 232 1113 ? ? ? A . n A 1 233 ILE 233 1114 ? ? ? A . n A 1 234 ALA 234 1115 1115 ALA ALA A . n A 1 235 GLN 235 1116 1116 GLN GLN A . n A 1 236 GLY 236 1117 1117 GLY GLY A . n A 1 237 GLN 237 1118 1118 GLN GLN A . n A 1 238 MET 238 1119 1119 MET MET A . n A 1 239 THR 239 1120 1120 THR THR A . n A 1 240 VAL 240 1121 1121 VAL VAL A . n A 1 241 LEU 241 1122 1122 LEU LEU A . n A 1 242 ARG 242 1123 1123 ARG ARG A . n A 1 243 LEU 243 1124 1124 LEU LEU A . n A 1 244 THR 244 1125 1125 THR THR A . n A 1 245 GLU 245 1126 1126 GLU GLU A . n A 1 246 LEU 246 1127 1127 LEU LEU A . n A 1 247 LEU 247 1128 1128 LEU LEU A . n A 1 248 GLU 248 1129 1129 GLU GLU A . n A 1 249 ARG 249 1130 1130 ARG ARG A . n A 1 250 GLY 250 1131 1131 GLY GLY A . n A 1 251 GLU 251 1132 1132 GLU GLU A . n A 1 252 ARG 252 1133 1133 ARG ARG A . n A 1 253 LEU 253 1134 1134 LEU LEU A . n A 1 254 PRO 254 1135 1135 PRO PRO A . n A 1 255 ARG 255 1136 1136 ARG ARG A . n A 1 256 PRO 256 1137 1137 PRO PRO A . n A 1 257 ASP 257 1138 1138 ASP ASP A . n A 1 258 LYS 258 1139 1139 LYS LYS A . n A 1 259 CYS 259 1140 1140 CYS CYS A . n A 1 260 PRO 260 1141 1141 PRO PRO A . n A 1 261 CYS 261 1142 1142 CYS CYS A . n A 1 262 GLU 262 1143 1143 GLU GLU A . n A 1 263 VAL 263 1144 1144 VAL VAL A . n A 1 264 TYR 264 1145 1145 TYR TYR A . n A 1 265 HIS 265 1146 1146 HIS HIS A . n A 1 266 LEU 266 1147 1147 LEU LEU A . n A 1 267 MET 267 1148 1148 MET MET A . n A 1 268 LYS 268 1149 1149 LYS LYS A . n A 1 269 ASN 269 1150 1150 ASN ASN A . n A 1 270 CYS 270 1151 1151 CYS CYS A . n A 1 271 TRP 271 1152 1152 TRP TRP A . n A 1 272 GLU 272 1153 1153 GLU GLU A . n A 1 273 THR 273 1154 1154 THR THR A . n A 1 274 GLU 274 1155 1155 GLU GLU A . n A 1 275 ALA 275 1156 1156 ALA ALA A . n A 1 276 SER 276 1157 1157 SER SER A . n A 1 277 PHE 277 1158 1158 PHE PHE A . n A 1 278 ARG 278 1159 1159 ARG ARG A . n A 1 279 PRO 279 1160 1160 PRO PRO A . n A 1 280 THR 280 1161 1161 THR THR A . n A 1 281 PHE 281 1162 1162 PHE PHE A . n A 1 282 GLU 282 1163 1163 GLU GLU A . n A 1 283 ASN 283 1164 1164 ASN ASN A . n A 1 284 LEU 284 1165 1165 LEU LEU A . n A 1 285 ILE 285 1166 1166 ILE ILE A . n A 1 286 PRO 286 1167 1167 PRO PRO A . n A 1 287 ILE 287 1168 1168 ILE ILE A . n A 1 288 LEU 288 1169 1169 LEU LEU A . n A 1 289 LYS 289 1170 1170 LYS LYS A . n A 1 290 THR 290 1171 1171 THR THR A . n A 1 291 VAL 291 1172 1172 VAL VAL A . n A 1 292 HIS 292 1173 1173 HIS HIS A . n A 1 293 GLU 293 1174 1174 GLU GLU A . n A 1 294 LYS 294 1175 1175 LYS LYS A . n A 1 295 TYR 295 1176 ? ? ? A . n A 1 296 HIS 296 1177 ? ? ? A . n A 1 297 HIS 297 1178 ? ? ? A . n A 1 298 HIS 298 1179 ? ? ? A . n A 1 299 HIS 299 1180 ? ? ? A . n A 1 300 HIS 300 1181 ? ? ? A . n A 1 301 HIS 301 1182 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 N9G 1 1200 1200 N9G LIG A . C 3 HOH 1 1301 1228 HOH HOH A . C 3 HOH 2 1302 1211 HOH HOH A . C 3 HOH 3 1303 1234 HOH HOH A . C 3 HOH 4 1304 1254 HOH HOH A . C 3 HOH 5 1305 1215 HOH HOH A . C 3 HOH 6 1306 1202 HOH HOH A . C 3 HOH 7 1307 1242 HOH HOH A . C 3 HOH 8 1308 1214 HOH HOH A . C 3 HOH 9 1309 1201 HOH HOH A . C 3 HOH 10 1310 1208 HOH HOH A . C 3 HOH 11 1311 1207 HOH HOH A . C 3 HOH 12 1312 1256 HOH HOH A . C 3 HOH 13 1313 1243 HOH HOH A . C 3 HOH 14 1314 1253 HOH HOH A . C 3 HOH 15 1315 1235 HOH HOH A . C 3 HOH 16 1316 1212 HOH HOH A . C 3 HOH 17 1317 1223 HOH HOH A . C 3 HOH 18 1318 1241 HOH HOH A . C 3 HOH 19 1319 1225 HOH HOH A . C 3 HOH 20 1320 1252 HOH HOH A . C 3 HOH 21 1321 1247 HOH HOH A . C 3 HOH 22 1322 1218 HOH HOH A . C 3 HOH 23 1323 1224 HOH HOH A . C 3 HOH 24 1324 1213 HOH HOH A . C 3 HOH 25 1325 1222 HOH HOH A . C 3 HOH 26 1326 1204 HOH HOH A . C 3 HOH 27 1327 1232 HOH HOH A . C 3 HOH 28 1328 1206 HOH HOH A . C 3 HOH 29 1329 1240 HOH HOH A . C 3 HOH 30 1330 1257 HOH HOH A . C 3 HOH 31 1331 1245 HOH HOH A . C 3 HOH 32 1332 1230 HOH HOH A . C 3 HOH 33 1333 1248 HOH HOH A . C 3 HOH 34 1334 1249 HOH HOH A . C 3 HOH 35 1335 1219 HOH HOH A . C 3 HOH 36 1336 1226 HOH HOH A . C 3 HOH 37 1337 1231 HOH HOH A . C 3 HOH 38 1338 1237 HOH HOH A . C 3 HOH 39 1339 1229 HOH HOH A . C 3 HOH 40 1340 1258 HOH HOH A . C 3 HOH 41 1341 1246 HOH HOH A . C 3 HOH 42 1342 1244 HOH HOH A . C 3 HOH 43 1343 1250 HOH HOH A . C 3 HOH 44 1344 1227 HOH HOH A . C 3 HOH 45 1345 1238 HOH HOH A . C 3 HOH 46 1346 1251 HOH HOH A . C 3 HOH 47 1347 1236 HOH HOH A . C 3 HOH 48 1348 1255 HOH HOH A . C 3 HOH 49 1349 1233 HOH HOH A . C 3 HOH 50 1350 1239 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 1050 ? CG ? A GLU 169 CG 2 1 Y 1 A GLU 1050 ? CD ? A GLU 169 CD 3 1 Y 1 A GLU 1050 ? OE1 ? A GLU 169 OE1 4 1 Y 1 A GLU 1050 ? OE2 ? A GLU 169 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0238 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.5.1 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6OVA _cell.details ? _cell.formula_units_Z ? _cell.length_a 48.073 _cell.length_a_esd ? _cell.length_b 48.073 _cell.length_b_esd ? _cell.length_c 475.025 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6OVA _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6OVA _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.50 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.74 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '15% PEG 5000 MME, and 100 mM Sodium Citrate (pH 6.0)' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-02-06 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.976 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 5.0.3' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.976 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 5.0.3 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6OVA _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.500 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12106 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 95.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.300 _reflns.pdbx_Rmerge_I_obs 0.078 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.200 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.004 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 112859 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.500 2.540 ? ? ? ? ? ? 382 63.700 ? ? ? ? 0.297 ? ? ? ? ? ? ? ? 5.600 ? 1.071 ? ? ? ? ? 1 1 ? ? 2.540 2.590 ? ? ? ? ? ? 453 76.500 ? ? ? ? 0.378 ? ? ? ? ? ? ? ? 6.300 ? 1.036 ? ? ? ? ? 2 1 ? ? 2.590 2.640 ? ? ? ? ? ? 494 82.600 ? ? ? ? 0.361 ? ? ? ? ? ? ? ? 7.600 ? 0.961 ? ? ? ? ? 3 1 ? ? 2.640 2.690 ? ? ? ? ? ? 549 89.600 ? ? ? ? 0.349 ? ? ? ? ? ? ? ? 8.100 ? 0.970 ? ? ? ? ? 4 1 ? ? 2.690 2.750 ? ? ? ? ? ? 591 99.800 ? ? ? ? 0.338 ? ? ? ? ? ? ? ? 8.500 ? 0.982 ? ? ? ? ? 5 1 ? ? 2.750 2.820 ? ? ? ? ? ? 614 100.000 ? ? ? ? 0.337 ? ? ? ? ? ? ? ? 9.300 ? 0.991 ? ? ? ? ? 6 1 ? ? 2.820 2.890 ? ? ? ? ? ? 589 100.000 ? ? ? ? 0.255 ? ? ? ? ? ? ? ? 10.000 ? 1.018 ? ? ? ? ? 7 1 ? ? 2.890 2.960 ? ? ? ? ? ? 622 100.000 ? ? ? ? 0.249 ? ? ? ? ? ? ? ? 10.200 ? 0.996 ? ? ? ? ? 8 1 ? ? 2.960 3.050 ? ? ? ? ? ? 606 100.000 ? ? ? ? 0.178 ? ? ? ? ? ? ? ? 10.100 ? 1.011 ? ? ? ? ? 9 1 ? ? 3.050 3.150 ? ? ? ? ? ? 600 100.000 ? ? ? ? 0.166 ? ? ? ? ? ? ? ? 10.500 ? 1.006 ? ? ? ? ? 10 1 ? ? 3.150 3.260 ? ? ? ? ? ? 623 100.000 ? ? ? ? 0.149 ? ? ? ? ? ? ? ? 10.300 ? 0.989 ? ? ? ? ? 11 1 ? ? 3.260 3.390 ? ? ? ? ? ? 619 100.000 ? ? ? ? 0.107 ? ? ? ? ? ? ? ? 10.300 ? 1.015 ? ? ? ? ? 12 1 ? ? 3.390 3.550 ? ? ? ? ? ? 620 100.000 ? ? ? ? 0.074 ? ? ? ? ? ? ? ? 10.000 ? 1.026 ? ? ? ? ? 13 1 ? ? 3.550 3.730 ? ? ? ? ? ? 639 100.000 ? ? ? ? 0.078 ? ? ? ? ? ? ? ? 10.300 ? 1.003 ? ? ? ? ? 14 1 ? ? 3.730 3.970 ? ? ? ? ? ? 637 100.000 ? ? ? ? 0.063 ? ? ? ? ? ? ? ? 10.100 ? 1.002 ? ? ? ? ? 15 1 ? ? 3.970 4.270 ? ? ? ? ? ? 629 100.000 ? ? ? ? 0.056 ? ? ? ? ? ? ? ? 9.900 ? 1.011 ? ? ? ? ? 16 1 ? ? 4.270 4.700 ? ? ? ? ? ? 657 100.000 ? ? ? ? 0.058 ? ? ? ? ? ? ? ? 9.900 ? 0.989 ? ? ? ? ? 17 1 ? ? 4.700 5.380 ? ? ? ? ? ? 666 100.000 ? ? ? ? 0.066 ? ? ? ? ? ? ? ? 9.600 ? 1.013 ? ? ? ? ? 18 1 ? ? 5.380 6.780 ? ? ? ? ? ? 693 100.000 ? ? ? ? 0.066 ? ? ? ? ? ? ? ? 9.200 ? 1.054 ? ? ? ? ? 19 1 ? ? 6.780 50.000 ? ? ? ? ? ? 823 99.800 ? ? ? ? 0.033 ? ? ? ? ? ? ? ? 8.200 ? 0.973 ? ? ? ? ? 20 1 ? ? # _refine.aniso_B[1][1] 0.4800 _refine.aniso_B[1][2] 0.2400 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 0.4800 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -1.5600 _refine.B_iso_max 200.570 _refine.B_iso_mean 73.3010 _refine.B_iso_min 40.360 _refine.correlation_coeff_Fo_to_Fc 0.9620 _refine.correlation_coeff_Fo_to_Fc_free 0.9440 _refine.details 'U VALUES : WITH TLS ADDED' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6OVA _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5000 _refine.ls_d_res_low 24.1700 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11364 _refine.ls_number_reflns_R_free 574 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.6200 _refine.ls_percent_reflns_R_free 4.8000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1995 _refine.ls_R_factor_R_free 0.2509 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1968 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.5310 _refine.pdbx_overall_ESU_R_Free 0.2920 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 24.6730 _refine.overall_SU_ML 0.2530 _refine.overall_SU_R_Cruickshank_DPI 0.5247 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.5000 _refine_hist.d_res_low 24.1700 _refine_hist.number_atoms_solvent 50 _refine_hist.number_atoms_total 2306 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 273 _refine_hist.pdbx_B_iso_mean_ligand 69.36 _refine_hist.pdbx_B_iso_mean_solvent 67.04 _refine_hist.pdbx_number_atoms_protein 2227 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 29 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.005 0.012 2323 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 1.378 1.659 3146 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 6.739 5.000 271 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 36.591 21.694 124 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 17.453 15.000 401 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 22.181 15.000 15 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.106 0.200 283 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 1776 ? r_gen_planes_refined ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.5040 _refine_ls_shell.d_res_low 2.5690 _refine_ls_shell.number_reflns_all 571 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 29 _refine_ls_shell.number_reflns_R_work 542 _refine_ls_shell.percent_reflns_obs 66.9400 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.4200 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.4170 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6OVA _struct.title 'Crystal Structure of TYK2 with novel pyrrolidinone inhibitor' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6OVA _struct_keywords.text 'Inhibitor, Complex, TRANSFERASE-TRANSFERASE INHIBITOR complex' _struct_keywords.pdbx_keywords 'TRANSFERASE/TRANSFERASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TYK2_HUMAN _struct_ref.pdbx_db_accession P29597 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SPASDPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHIIKYK GCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYIHRDLAARNVLLDNDRLVKIGDFG LAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLR LTELLERGERLPRPDKCPCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKY ; _struct_ref.pdbx_align_begin 884 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6OVA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 295 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P29597 _struct_ref_seq.db_align_beg 884 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1176 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 884 _struct_ref_seq.pdbx_auth_seq_align_end 1176 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6OVA MET A 1 ? UNP P29597 ? ? 'initiating methionine' 882 1 1 6OVA GLY A 2 ? UNP P29597 ? ? 'expression tag' 883 2 1 6OVA SER A 135 ? UNP P29597 ALA 1016 conflict 1016 3 1 6OVA ASN A 142 ? UNP P29597 ASP 1023 conflict 1023 4 1 6OVA HIS A 296 ? UNP P29597 ? ? 'expression tag' 1177 5 1 6OVA HIS A 297 ? UNP P29597 ? ? 'expression tag' 1178 6 1 6OVA HIS A 298 ? UNP P29597 ? ? 'expression tag' 1179 7 1 6OVA HIS A 299 ? UNP P29597 ? ? 'expression tag' 1180 8 1 6OVA HIS A 300 ? UNP P29597 ? ? 'expression tag' 1181 9 1 6OVA HIS A 301 ? UNP P29597 ? ? 'expression tag' 1182 10 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 13410 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 12 ? ARG A 14 ? HIS A 893 ARG A 895 5 ? 3 HELX_P HELX_P2 AA2 LYS A 64 ? ARG A 71 ? LYS A 945 ARG A 952 1 ? 8 HELX_P HELX_P3 AA3 LEU A 105 ? LEU A 109 ? LEU A 986 LEU A 990 1 ? 5 HELX_P HELX_P4 AA4 PRO A 110 ? HIS A 112 ? PRO A 991 HIS A 993 5 ? 3 HELX_P HELX_P5 AA5 GLY A 115 ? GLN A 136 ? GLY A 996 GLN A 1017 1 ? 22 HELX_P HELX_P6 AA6 ALA A 144 ? ARG A 146 ? ALA A 1025 ARG A 1027 5 ? 3 HELX_P HELX_P7 AA7 PRO A 183 ? TYR A 187 ? PRO A 1064 TYR A 1068 5 ? 5 HELX_P HELX_P8 AA8 ALA A 188 ? GLU A 194 ? ALA A 1069 GLU A 1075 1 ? 7 HELX_P HELX_P9 AA9 TYR A 199 ? THR A 215 ? TYR A 1080 THR A 1096 1 ? 17 HELX_P HELX_P10 AB1 ASP A 218 ? GLN A 221 ? ASP A 1099 GLN A 1102 5 ? 4 HELX_P HELX_P11 AB2 SER A 222 ? LEU A 230 ? SER A 1103 LEU A 1111 1 ? 9 HELX_P HELX_P12 AB3 GLN A 235 ? ARG A 249 ? GLN A 1116 ARG A 1130 1 ? 15 HELX_P HELX_P13 AB4 PRO A 260 ? TRP A 271 ? PRO A 1141 TRP A 1152 1 ? 12 HELX_P HELX_P14 AB5 GLU A 274 ? ARG A 278 ? GLU A 1155 ARG A 1159 5 ? 5 HELX_P HELX_P15 AB6 THR A 280 ? LYS A 294 ? THR A 1161 LYS A 1175 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? AA3 ? 2 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 16 ? GLY A 25 ? LEU A 897 GLY A 906 AA1 2 GLY A 28 ? TYR A 35 ? GLY A 909 TYR A 916 AA1 3 GLU A 44 ? LEU A 51 ? GLU A 925 LEU A 932 AA1 4 LEU A 93 ? GLU A 98 ? LEU A 974 GLU A 979 AA1 5 TYR A 81 ? CYS A 85 ? TYR A 962 CYS A 966 AA2 1 GLY A 103 ? SER A 104 ? GLY A 984 SER A 985 AA2 2 VAL A 148 ? LEU A 150 ? VAL A 1029 LEU A 1031 AA2 3 VAL A 156 ? ILE A 158 ? VAL A 1037 ILE A 1039 AA3 1 TYR A 138 ? ILE A 139 ? TYR A 1019 ILE A 1020 AA3 2 LYS A 165 ? ALA A 166 ? LYS A 1046 ALA A 1047 AA4 1 TYR A 173 ? ARG A 175 ? TYR A 1054 ARG A 1056 AA4 2 LYS A 196 ? TYR A 198 ? LYS A 1077 TYR A 1079 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 17 ? N LYS A 898 O CYS A 34 ? O CYS A 915 AA1 2 3 N TYR A 35 ? N TYR A 916 O GLU A 44 ? O GLU A 925 AA1 3 4 N ALA A 47 ? N ALA A 928 O MET A 97 ? O MET A 978 AA1 4 5 O VAL A 96 ? O VAL A 977 N LYS A 82 ? N LYS A 963 AA2 1 2 N GLY A 103 ? N GLY A 984 O LEU A 150 ? O LEU A 1031 AA2 2 3 N LEU A 149 ? N LEU A 1030 O LYS A 157 ? O LYS A 1038 AA3 1 2 N ILE A 139 ? N ILE A 1020 O LYS A 165 ? O LYS A 1046 AA4 1 2 N TYR A 174 ? N TYR A 1055 O PHE A 197 ? O PHE A 1078 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id N9G _struct_site.pdbx_auth_seq_id 1200 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 15 _struct_site.details 'binding site for residue N9G A 1200' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 15 LEU A 22 ? LEU A 903 . ? 1_555 ? 2 AC1 15 GLY A 25 ? GLY A 906 . ? 1_555 ? 3 AC1 15 VAL A 30 ? VAL A 911 . ? 1_555 ? 4 AC1 15 ALA A 47 ? ALA A 928 . ? 1_555 ? 5 AC1 15 LYS A 49 ? LYS A 930 . ? 1_555 ? 6 AC1 15 ILE A 79 ? ILE A 960 . ? 1_555 ? 7 AC1 15 GLU A 98 ? GLU A 979 . ? 1_555 ? 8 AC1 15 TYR A 99 ? TYR A 980 . ? 1_555 ? 9 AC1 15 VAL A 100 ? VAL A 981 . ? 1_555 ? 10 AC1 15 PRO A 101 ? PRO A 982 . ? 1_555 ? 11 AC1 15 GLY A 103 ? GLY A 984 . ? 1_555 ? 12 AC1 15 ASP A 107 ? ASP A 988 . ? 1_555 ? 13 AC1 15 ARG A 146 ? ARG A 1027 . ? 1_555 ? 14 AC1 15 ASN A 147 ? ASN A 1028 . ? 1_555 ? 15 AC1 15 ASP A 160 ? ASP A 1041 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 1023 ? ? -152.42 41.35 2 1 ASP A 1041 ? ? 38.71 89.63 3 1 LYS A 1139 ? ? 82.63 1.69 # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 26.140 -16.325 -5.872 0.5019 0.1041 0.1866 0.1374 -0.0137 -0.0434 1.1087 1.2051 3.1310 -1.0998 -0.6636 1.0678 0.2146 -0.1215 -0.0931 0.0735 0.0864 -0.0118 -0.2062 0.4927 0.0243 'X-RAY DIFFRACTION' 2 ? refined 26.169 -9.905 4.000 0.3251 0.1403 0.2780 0.0248 -0.0054 0.0020 0.3387 0.9502 4.3619 -0.4885 -0.4000 -0.1857 0.0464 -0.0724 0.0260 0.0141 0.0124 0.1043 -0.1943 0.0276 0.2367 'X-RAY DIFFRACTION' 3 ? refined 32.011 -25.645 18.727 0.6044 0.4288 0.1629 0.3429 0.0037 0.1703 2.1466 0.8525 4.8734 1.3199 -0.5299 0.0901 -0.6288 -0.0486 0.6774 -0.2738 0.3050 0.2561 -0.3603 0.9153 1.4223 'X-RAY DIFFRACTION' 4 ? refined 23.754 -9.534 16.001 0.3197 0.1273 0.3069 0.0068 -0.0167 -0.0444 0.0351 0.0977 4.7213 0.0573 -0.4069 -0.6676 0.0066 -0.0403 0.0337 -0.0124 -0.0056 0.0190 0.0031 -0.1391 0.1675 'X-RAY DIFFRACTION' 5 ? refined 16.868 -18.359 23.990 0.3149 0.3203 0.3182 -0.0274 0.0035 0.0180 0.0135 0.3778 4.5590 -0.0516 0.1390 -1.2274 0.0135 0.0744 -0.0878 -0.0300 0.0485 -0.0835 -0.1882 0.5653 -0.5078 'X-RAY DIFFRACTION' 6 ? refined 21.471 -18.215 31.523 0.2158 0.3750 0.2302 0.0064 -0.0140 -0.0662 0.0247 0.1725 5.4909 -0.0332 0.1432 -0.9637 0.0109 0.0401 -0.0510 -0.0764 0.0471 -0.0065 -0.0628 0.3973 -0.0239 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 888 A 933 ? ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 942 A 984 ? ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 985 A 1008 ? ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 1009 A 1059 ? ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 1060 A 1110 ? ? ? ? ? ? 'X-RAY DIFFRACTION' 6 6 A 1111 A 1175 ? ? ? ? ? ? # _pdbx_phasing_MR.entry_id 6OVA _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO' _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 6.540 _pdbx_phasing_MR.d_res_low_rotation 41.950 _pdbx_phasing_MR.d_res_high_translation 6.540 _pdbx_phasing_MR.d_res_low_translation 41.950 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 882 ? A MET 1 2 1 Y 1 A GLY 883 ? A GLY 2 3 1 Y 1 A SER 884 ? A SER 3 4 1 Y 1 A PRO 885 ? A PRO 4 5 1 Y 1 A ALA 886 ? A ALA 5 6 1 Y 1 A SER 887 ? A SER 6 7 1 Y 1 A ALA 934 ? A ALA 53 8 1 Y 1 A ASP 935 ? A ASP 54 9 1 Y 1 A CYS 936 ? A CYS 55 10 1 Y 1 A GLY 937 ? A GLY 56 11 1 Y 1 A PRO 938 ? A PRO 57 12 1 Y 1 A GLN 939 ? A GLN 58 13 1 Y 1 A HIS 940 ? A HIS 59 14 1 Y 1 A ARG 941 ? A ARG 60 15 1 Y 1 A ASP 968 ? A ASP 87 16 1 Y 1 A GLN 969 ? A GLN 88 17 1 Y 1 A GLY 970 ? A GLY 89 18 1 Y 1 A GLU 971 ? A GLU 90 19 1 Y 1 A LYS 972 ? A LYS 91 20 1 Y 1 A GLY 1113 ? A GLY 232 21 1 Y 1 A ILE 1114 ? A ILE 233 22 1 Y 1 A TYR 1176 ? A TYR 295 23 1 Y 1 A HIS 1177 ? A HIS 296 24 1 Y 1 A HIS 1178 ? A HIS 297 25 1 Y 1 A HIS 1179 ? A HIS 298 26 1 Y 1 A HIS 1180 ? A HIS 299 27 1 Y 1 A HIS 1181 ? A HIS 300 28 1 Y 1 A HIS 1182 ? A HIS 301 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 N9G C4 C N N 250 N9G C6 C Y N 251 N9G C7 C Y N 252 N9G C8 C Y N 253 N9G C13 C Y N 254 N9G C15 C Y N 255 N9G C20 C N S 256 N9G C21 C N N 257 N9G C24 C N N 258 N9G C26 C N N 259 N9G C1 C N N 260 N9G N2 N N N 261 N9G C3 C N N 262 N9G O5 O N N 263 N9G C9 C Y N 264 N9G N10 N N N 265 N9G C11 C Y N 266 N9G C12 C Y N 267 N9G C14 C Y N 268 N9G N16 N Y N 269 N9G N17 N N N 270 N9G C18 C N N 271 N9G C19 C N N 272 N9G N22 N N N 273 N9G C23 C N N 274 N9G C25 C N N 275 N9G O27 O N N 276 N9G N28 N Y N 277 N9G C29 C Y N 278 N9G H1 H N N 279 N9G H2 H N N 280 N9G H3 H N N 281 N9G H4 H N N 282 N9G H5 H N N 283 N9G H6 H N N 284 N9G H7 H N N 285 N9G H8 H N N 286 N9G H9 H N N 287 N9G H10 H N N 288 N9G H11 H N N 289 N9G H12 H N N 290 N9G H13 H N N 291 N9G H14 H N N 292 N9G H15 H N N 293 N9G H16 H N N 294 N9G H17 H N N 295 N9G H18 H N N 296 N9G H19 H N N 297 N9G H20 H N N 298 N9G H21 H N N 299 N9G H22 H N N 300 PHE N N N N 301 PHE CA C N S 302 PHE C C N N 303 PHE O O N N 304 PHE CB C N N 305 PHE CG C Y N 306 PHE CD1 C Y N 307 PHE CD2 C Y N 308 PHE CE1 C Y N 309 PHE CE2 C Y N 310 PHE CZ C Y N 311 PHE OXT O N N 312 PHE H H N N 313 PHE H2 H N N 314 PHE HA H N N 315 PHE HB2 H N N 316 PHE HB3 H N N 317 PHE HD1 H N N 318 PHE HD2 H N N 319 PHE HE1 H N N 320 PHE HE2 H N N 321 PHE HZ H N N 322 PHE HXT H N N 323 PRO N N N N 324 PRO CA C N S 325 PRO C C N N 326 PRO O O N N 327 PRO CB C N N 328 PRO CG C N N 329 PRO CD C N N 330 PRO OXT O N N 331 PRO H H N N 332 PRO HA H N N 333 PRO HB2 H N N 334 PRO HB3 H N N 335 PRO HG2 H N N 336 PRO HG3 H N N 337 PRO HD2 H N N 338 PRO HD3 H N N 339 PRO HXT H N N 340 SER N N N N 341 SER CA C N S 342 SER C C N N 343 SER O O N N 344 SER CB C N N 345 SER OG O N N 346 SER OXT O N N 347 SER H H N N 348 SER H2 H N N 349 SER HA H N N 350 SER HB2 H N N 351 SER HB3 H N N 352 SER HG H N N 353 SER HXT H N N 354 THR N N N N 355 THR CA C N S 356 THR C C N N 357 THR O O N N 358 THR CB C N R 359 THR OG1 O N N 360 THR CG2 C N N 361 THR OXT O N N 362 THR H H N N 363 THR H2 H N N 364 THR HA H N N 365 THR HB H N N 366 THR HG1 H N N 367 THR HG21 H N N 368 THR HG22 H N N 369 THR HG23 H N N 370 THR HXT H N N 371 TRP N N N N 372 TRP CA C N S 373 TRP C C N N 374 TRP O O N N 375 TRP CB C N N 376 TRP CG C Y N 377 TRP CD1 C Y N 378 TRP CD2 C Y N 379 TRP NE1 N Y N 380 TRP CE2 C Y N 381 TRP CE3 C Y N 382 TRP CZ2 C Y N 383 TRP CZ3 C Y N 384 TRP CH2 C Y N 385 TRP OXT O N N 386 TRP H H N N 387 TRP H2 H N N 388 TRP HA H N N 389 TRP HB2 H N N 390 TRP HB3 H N N 391 TRP HD1 H N N 392 TRP HE1 H N N 393 TRP HE3 H N N 394 TRP HZ2 H N N 395 TRP HZ3 H N N 396 TRP HH2 H N N 397 TRP HXT H N N 398 TYR N N N N 399 TYR CA C N S 400 TYR C C N N 401 TYR O O N N 402 TYR CB C N N 403 TYR CG C Y N 404 TYR CD1 C Y N 405 TYR CD2 C Y N 406 TYR CE1 C Y N 407 TYR CE2 C Y N 408 TYR CZ C Y N 409 TYR OH O N N 410 TYR OXT O N N 411 TYR H H N N 412 TYR H2 H N N 413 TYR HA H N N 414 TYR HB2 H N N 415 TYR HB3 H N N 416 TYR HD1 H N N 417 TYR HD2 H N N 418 TYR HE1 H N N 419 TYR HE2 H N N 420 TYR HH H N N 421 TYR HXT H N N 422 VAL N N N N 423 VAL CA C N S 424 VAL C C N N 425 VAL O O N N 426 VAL CB C N N 427 VAL CG1 C N N 428 VAL CG2 C N N 429 VAL OXT O N N 430 VAL H H N N 431 VAL H2 H N N 432 VAL HA H N N 433 VAL HB H N N 434 VAL HG11 H N N 435 VAL HG12 H N N 436 VAL HG13 H N N 437 VAL HG21 H N N 438 VAL HG22 H N N 439 VAL HG23 H N N 440 VAL HXT H N N 441 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 N9G O5 C4 doub N N 237 N9G N16 C15 doub Y N 238 N9G N16 C11 sing Y N 239 N9G C15 C14 sing Y N 240 N9G N10 C11 sing N N 241 N9G N10 C9 sing N N 242 N9G C11 C12 doub Y N 243 N9G C9 C8 doub Y N 244 N9G C9 N28 sing Y N 245 N9G C8 C7 sing Y N 246 N9G N28 C29 doub Y N 247 N9G C14 C13 doub Y N 248 N9G C7 C6 doub Y N 249 N9G C29 C6 sing Y N 250 N9G C6 C4 sing N N 251 N9G C4 N2 sing N N 252 N9G C12 C13 sing Y N 253 N9G C13 N17 sing N N 254 N9G N17 C18 sing N N 255 N9G N17 C26 sing N N 256 N9G C18 C19 sing N N 257 N9G C19 C20 sing N N 258 N9G N2 C1 sing N N 259 N9G N2 C3 sing N N 260 N9G C26 O27 doub N N 261 N9G C26 C20 sing N N 262 N9G C21 N22 trip N N 263 N9G C21 C20 sing N N 264 N9G C20 C23 sing N N 265 N9G C23 C25 sing N N 266 N9G C23 C24 sing N N 267 N9G C25 C24 sing N N 268 N9G C7 H1 sing N N 269 N9G C8 H2 sing N N 270 N9G C15 H3 sing N N 271 N9G C24 H4 sing N N 272 N9G C24 H5 sing N N 273 N9G C1 H6 sing N N 274 N9G C1 H7 sing N N 275 N9G C1 H8 sing N N 276 N9G C3 H9 sing N N 277 N9G C3 H10 sing N N 278 N9G C3 H11 sing N N 279 N9G N10 H12 sing N N 280 N9G C12 H13 sing N N 281 N9G C14 H14 sing N N 282 N9G C18 H15 sing N N 283 N9G C18 H16 sing N N 284 N9G C19 H17 sing N N 285 N9G C19 H18 sing N N 286 N9G C23 H19 sing N N 287 N9G C25 H20 sing N N 288 N9G C25 H21 sing N N 289 N9G C29 H22 sing N N 290 PHE N CA sing N N 291 PHE N H sing N N 292 PHE N H2 sing N N 293 PHE CA C sing N N 294 PHE CA CB sing N N 295 PHE CA HA sing N N 296 PHE C O doub N N 297 PHE C OXT sing N N 298 PHE CB CG sing N N 299 PHE CB HB2 sing N N 300 PHE CB HB3 sing N N 301 PHE CG CD1 doub Y N 302 PHE CG CD2 sing Y N 303 PHE CD1 CE1 sing Y N 304 PHE CD1 HD1 sing N N 305 PHE CD2 CE2 doub Y N 306 PHE CD2 HD2 sing N N 307 PHE CE1 CZ doub Y N 308 PHE CE1 HE1 sing N N 309 PHE CE2 CZ sing Y N 310 PHE CE2 HE2 sing N N 311 PHE CZ HZ sing N N 312 PHE OXT HXT sing N N 313 PRO N CA sing N N 314 PRO N CD sing N N 315 PRO N H sing N N 316 PRO CA C sing N N 317 PRO CA CB sing N N 318 PRO CA HA sing N N 319 PRO C O doub N N 320 PRO C OXT sing N N 321 PRO CB CG sing N N 322 PRO CB HB2 sing N N 323 PRO CB HB3 sing N N 324 PRO CG CD sing N N 325 PRO CG HG2 sing N N 326 PRO CG HG3 sing N N 327 PRO CD HD2 sing N N 328 PRO CD HD3 sing N N 329 PRO OXT HXT sing N N 330 SER N CA sing N N 331 SER N H sing N N 332 SER N H2 sing N N 333 SER CA C sing N N 334 SER CA CB sing N N 335 SER CA HA sing N N 336 SER C O doub N N 337 SER C OXT sing N N 338 SER CB OG sing N N 339 SER CB HB2 sing N N 340 SER CB HB3 sing N N 341 SER OG HG sing N N 342 SER OXT HXT sing N N 343 THR N CA sing N N 344 THR N H sing N N 345 THR N H2 sing N N 346 THR CA C sing N N 347 THR CA CB sing N N 348 THR CA HA sing N N 349 THR C O doub N N 350 THR C OXT sing N N 351 THR CB OG1 sing N N 352 THR CB CG2 sing N N 353 THR CB HB sing N N 354 THR OG1 HG1 sing N N 355 THR CG2 HG21 sing N N 356 THR CG2 HG22 sing N N 357 THR CG2 HG23 sing N N 358 THR OXT HXT sing N N 359 TRP N CA sing N N 360 TRP N H sing N N 361 TRP N H2 sing N N 362 TRP CA C sing N N 363 TRP CA CB sing N N 364 TRP CA HA sing N N 365 TRP C O doub N N 366 TRP C OXT sing N N 367 TRP CB CG sing N N 368 TRP CB HB2 sing N N 369 TRP CB HB3 sing N N 370 TRP CG CD1 doub Y N 371 TRP CG CD2 sing Y N 372 TRP CD1 NE1 sing Y N 373 TRP CD1 HD1 sing N N 374 TRP CD2 CE2 doub Y N 375 TRP CD2 CE3 sing Y N 376 TRP NE1 CE2 sing Y N 377 TRP NE1 HE1 sing N N 378 TRP CE2 CZ2 sing Y N 379 TRP CE3 CZ3 doub Y N 380 TRP CE3 HE3 sing N N 381 TRP CZ2 CH2 doub Y N 382 TRP CZ2 HZ2 sing N N 383 TRP CZ3 CH2 sing Y N 384 TRP CZ3 HZ3 sing N N 385 TRP CH2 HH2 sing N N 386 TRP OXT HXT sing N N 387 TYR N CA sing N N 388 TYR N H sing N N 389 TYR N H2 sing N N 390 TYR CA C sing N N 391 TYR CA CB sing N N 392 TYR CA HA sing N N 393 TYR C O doub N N 394 TYR C OXT sing N N 395 TYR CB CG sing N N 396 TYR CB HB2 sing N N 397 TYR CB HB3 sing N N 398 TYR CG CD1 doub Y N 399 TYR CG CD2 sing Y N 400 TYR CD1 CE1 sing Y N 401 TYR CD1 HD1 sing N N 402 TYR CD2 CE2 doub Y N 403 TYR CD2 HD2 sing N N 404 TYR CE1 CZ doub Y N 405 TYR CE1 HE1 sing N N 406 TYR CE2 CZ sing Y N 407 TYR CE2 HE2 sing N N 408 TYR CZ OH sing N N 409 TYR OH HH sing N N 410 TYR OXT HXT sing N N 411 VAL N CA sing N N 412 VAL N H sing N N 413 VAL N H2 sing N N 414 VAL CA C sing N N 415 VAL CA CB sing N N 416 VAL CA HA sing N N 417 VAL C O doub N N 418 VAL C OXT sing N N 419 VAL CB CG1 sing N N 420 VAL CB CG2 sing N N 421 VAL CB HB sing N N 422 VAL CG1 HG11 sing N N 423 VAL CG1 HG12 sing N N 424 VAL CG1 HG13 sing N N 425 VAL CG2 HG21 sing N N 426 VAL CG2 HG22 sing N N 427 VAL CG2 HG23 sing N N 428 VAL OXT HXT sing N N 429 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id N9G _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id N9G _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _atom_sites.entry_id 6OVA _atom_sites.fract_transf_matrix[1][1] 0.020802 _atom_sites.fract_transf_matrix[1][2] 0.012010 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.024020 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.002105 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_