data_6OWY # _entry.id 6OWY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.320 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6OWY WWPDB D_1000241499 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6OWY _pdbx_database_status.recvd_initial_deposition_date 2019-05-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Rocchio, S.' 1 ? 'Duman, R.' 2 ? 'El Omari, K.' 3 ? 'Mykhaylyk, V.' 4 ? 'Yan, Z.' 5 ? 'Wagner, A.' 6 ? 'Bardwell, J.C.A.' 7 ? 'Horowitz, S.' 8 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr D Struct Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2059-7983 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 75 _citation.language ? _citation.page_first 1084 _citation.page_last 1095 _citation.title 'Identifying dynamic, partially occupied residues using anomalous scattering.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2059798319014475 _citation.pdbx_database_id_PubMed 31793902 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rocchio, S.' 1 ? primary 'Duman, R.' 2 ? primary 'El Omari, K.' 3 ? primary 'Mykhaylyk, V.' 4 ? primary 'Orr, C.' 5 ? primary 'Yan, Z.' 6 0000-0002-2943-2849 primary 'Salmon, L.' 7 ? primary 'Wagner, A.' 8 0000-0001-8995-7324 primary 'Bardwell, J.C.A.' 9 ? primary 'Horowitz, S.' 10 0000-0002-1148-0105 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6OWY _cell.details ? _cell.formula_units_Z ? _cell.length_a 42.840 _cell.length_a_esd ? _cell.length_b 42.840 _cell.length_b_esd ? _cell.length_c 257.630 _cell.length_c_esd ? _cell.volume 472819.477 _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6OWY _symmetry.cell_setting ? _symmetry.Int_Tables_number 91 _symmetry.space_group_name_Hall 'P 4w 2c' _symmetry.space_group_name_H-M 'P 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Periplasmic chaperone Spy' 11515.285 2 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 11 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 2 ? ? ? ? 4 non-polymer syn IMIDAZOLE 69.085 3 ? ? ? ? 5 non-polymer syn 'IODIDE ION' 126.904 1 ? ? ? ? 6 water nat water 18.015 58 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Spheroplast protein Y' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SFKDLNLTDAQKQQIREIMKGQRDQMKRPPLEERRAMHDIIASDTFDKVKAEAQIAKMEEQRKANMLALMETQNKIYNIL TPEQKKQFNANFEKRLT ; _entity_poly.pdbx_seq_one_letter_code_can ;SFKDLNLTDAQKQQIREIMKGQRDQMKRPPLEERRAMHDIIASDTFDKVKAEAQIAKMEEQRKANMLALMETQNKIYNIL TPEQKKQFNANFEKRLT ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 PHE n 1 3 LYS n 1 4 ASP n 1 5 LEU n 1 6 ASN n 1 7 LEU n 1 8 THR n 1 9 ASP n 1 10 ALA n 1 11 GLN n 1 12 LYS n 1 13 GLN n 1 14 GLN n 1 15 ILE n 1 16 ARG n 1 17 GLU n 1 18 ILE n 1 19 MET n 1 20 LYS n 1 21 GLY n 1 22 GLN n 1 23 ARG n 1 24 ASP n 1 25 GLN n 1 26 MET n 1 27 LYS n 1 28 ARG n 1 29 PRO n 1 30 PRO n 1 31 LEU n 1 32 GLU n 1 33 GLU n 1 34 ARG n 1 35 ARG n 1 36 ALA n 1 37 MET n 1 38 HIS n 1 39 ASP n 1 40 ILE n 1 41 ILE n 1 42 ALA n 1 43 SER n 1 44 ASP n 1 45 THR n 1 46 PHE n 1 47 ASP n 1 48 LYS n 1 49 VAL n 1 50 LYS n 1 51 ALA n 1 52 GLU n 1 53 ALA n 1 54 GLN n 1 55 ILE n 1 56 ALA n 1 57 LYS n 1 58 MET n 1 59 GLU n 1 60 GLU n 1 61 GLN n 1 62 ARG n 1 63 LYS n 1 64 ALA n 1 65 ASN n 1 66 MET n 1 67 LEU n 1 68 ALA n 1 69 LEU n 1 70 MET n 1 71 GLU n 1 72 THR n 1 73 GLN n 1 74 ASN n 1 75 LYS n 1 76 ILE n 1 77 TYR n 1 78 ASN n 1 79 ILE n 1 80 LEU n 1 81 THR n 1 82 PRO n 1 83 GLU n 1 84 GLN n 1 85 LYS n 1 86 LYS n 1 87 GLN n 1 88 PHE n 1 89 ASN n 1 90 ALA n 1 91 ASN n 1 92 PHE n 1 93 GLU n 1 94 LYS n 1 95 ARG n 1 96 LEU n 1 97 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 97 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SPY_ECOLI _struct_ref.pdbx_db_accession P77754 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;FKDLNLTDAQKQQIREIMKGQRDQMKRPPLEERRAMHDIIASDTFDKVKAEAQIAKMEEQRKANMLAHMETQNKIYNILT PEQKKQFNANFEKRLT ; _struct_ref.pdbx_align_begin 52 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6OWY A 2 ? 97 ? P77754 52 ? 147 ? 29 124 2 1 6OWY B 2 ? 97 ? P77754 52 ? 147 ? 29 124 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6OWY SER A 1 ? UNP P77754 ? ? 'expression tag' 28 1 1 6OWY LEU A 69 ? UNP P77754 HIS 119 'engineered mutation' 96 2 2 6OWY SER B 1 ? UNP P77754 ? ? 'expression tag' 28 3 2 6OWY LEU B 69 ? UNP P77754 HIS 119 'engineered mutation' 96 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IMD non-polymer . IMIDAZOLE ? 'C3 H5 N2 1' 69.085 IOD non-polymer . 'IODIDE ION' ? 'I -1' 126.904 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6OWY _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.77 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.55 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '22-34% PEG 3000, 70-270 mM zinc acetate, and 0.1 M imidazole, pH 8.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 75 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-10-24 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 2.3843 1.0 2 2.7552 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I23' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list '2.3843, 2.7552' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I23 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 46.91 _reflns.entry_id 6OWY _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.07 _reflns.d_resolution_low 42.84 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15762 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.07 _reflns_shell.d_res_low 2.12 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1115 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.691 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 58.31 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6OWY _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.07 _refine.ls_d_res_low 42.84 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15674 _refine.ls_number_reflns_R_free 939 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.63 _refine.ls_percent_reflns_R_free 5.99 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2300 _refine.ls_R_factor_R_free 0.2728 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2272 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5wnw _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.9121 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3322 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.07 _refine_hist.d_res_low 42.84 _refine_hist.number_atoms_solvent 58 _refine_hist.number_atoms_total 1458 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1371 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 29 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0129 ? 1432 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.2266 ? 1917 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0540 ? 215 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0072 ? 257 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 24.5366 ? 551 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.07 2.18 . . 128 2023 98.58 . . . 0.4118 . 0.3579 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.18 2.32 . . 129 2023 99.63 . . . 0.3831 . 0.3137 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.32 2.49 . . 132 2051 99.36 . . . 0.3203 . 0.2762 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.49 2.75 . . 132 2088 99.95 . . . 0.3274 . 0.2452 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.75 3.14 . . 133 2083 100.00 . . . 0.3089 . 0.2318 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.14 3.96 . . 137 2149 99.91 . . . 0.2246 . 0.2113 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.96 42.26 . . 148 2318 99.92 . . . 0.2525 . 0.2056 . . . . . . . . . . # _struct.entry_id 6OWY _struct.title 'Spy H96L:Im7 K20pI-Phe complex; multiple anomalous datasets contained herein for element identification' _struct.pdbx_descriptor 'Periplasmic chaperone Spy' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6OWY _struct_keywords.text 'periplasmic, CHAPERONE' _struct_keywords.pdbx_keywords CHAPERONE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? I N N 2 ? J N N 2 ? K N N 2 ? L N N 3 ? M N N 3 ? N N N 4 ? O N N 4 ? P N N 5 ? Q N N 2 ? R N N 2 ? S N N 4 ? T N N 6 ? U N N 6 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 8 ? GLY A 21 ? THR A 35 GLY A 48 1 ? 14 HELX_P HELX_P2 AA2 PRO A 30 ? ALA A 42 ? PRO A 57 ALA A 69 1 ? 13 HELX_P HELX_P3 AA3 ASP A 47 ? MET A 58 ? ASP A 74 MET A 85 1 ? 12 HELX_P HELX_P4 AA4 MET A 58 ? ASN A 78 ? MET A 85 ASN A 105 1 ? 21 HELX_P HELX_P5 AA5 THR A 81 ? ARG A 95 ? THR A 108 ARG A 122 1 ? 15 HELX_P HELX_P6 AA6 THR B 8 ? GLN B 22 ? THR B 35 GLN B 49 1 ? 15 HELX_P HELX_P7 AA7 GLU B 32 ? ALA B 42 ? GLU B 59 ALA B 69 1 ? 11 HELX_P HELX_P8 AA8 ASP B 47 ? ASN B 78 ? ASP B 74 ASN B 105 1 ? 32 HELX_P HELX_P9 AA9 THR B 81 ? ARG B 95 ? THR B 108 ARG B 122 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A ASP 9 OD1 ? ? ? 1_555 C ZN . ZN ? ? A ASP 36 A ZN 201 1_555 ? ? ? ? ? ? ? 2.633 ? metalc2 metalc ? ? A ASP 9 OD2 ? ? ? 1_555 C ZN . ZN ? ? A ASP 36 A ZN 201 1_555 ? ? ? ? ? ? ? 2.514 ? metalc3 metalc ? ? A GLU 32 OE1 ? ? ? 1_555 H ZN . ZN ? ? A GLU 59 A ZN 206 1_555 ? ? ? ? ? ? ? 2.623 ? metalc4 metalc ? ? A GLU 32 OE2 ? ? ? 1_555 H ZN . ZN ? ? A GLU 59 A ZN 206 1_555 ? ? ? ? ? ? ? 2.320 ? metalc5 metalc ? ? A HIS 38 ND1 ? ? ? 1_555 J ZN . ZN ? ? A HIS 65 A ZN 208 1_555 ? ? ? ? ? ? ? 2.129 ? metalc6 metalc ? ? A ASP 39 OD1 ? ? ? 1_555 D ZN . ZN ? ? A ASP 66 A ZN 202 1_555 ? ? ? ? ? ? ? 2.093 ? metalc7 metalc ? ? A ASP 39 OD2 ? ? ? 1_555 D ZN . ZN ? ? A ASP 66 A ZN 202 1_555 ? ? ? ? ? ? ? 2.548 ? metalc8 metalc ? ? A ASP 44 OD2 ? ? ? 1_555 E ZN . ZN ? ? A ASP 71 A ZN 203 1_555 ? ? ? ? ? ? ? 1.932 ? metalc9 metalc ? ? A GLU 59 OE1 ? ? ? 1_555 F ZN . ZN ? ? A GLU 86 A ZN 204 1_555 ? ? ? ? ? ? ? 2.027 ? metalc10 metalc ? ? A GLU 93 OE2 ? ? ? 1_555 G ZN . ZN ? ? A GLU 120 A ZN 205 1_555 ? ? ? ? ? ? ? 1.726 ? metalc11 metalc ? ? B HIS 38 ND1 ? ? ? 1_555 G ZN . ZN ? ? B HIS 65 A ZN 205 1_555 ? ? ? ? ? ? ? 2.163 ? metalc12 metalc ? ? B ASP 47 OD2 ? ? ? 1_555 Q ZN . ZN ? ? B ASP 74 B ZN 201 1_555 ? ? ? ? ? ? ? 1.868 ? metalc13 metalc ? ? B GLU 93 OE2 ? ? ? 1_555 J ZN . ZN ? ? B GLU 120 A ZN 208 1_555 ? ? ? ? ? ? ? 1.917 ? metalc14 metalc ? ? F ZN . ZN ? ? ? 1_555 O IMD . N1 ? ? A ZN 204 A IMD 213 1_555 ? ? ? ? ? ? ? 2.328 ? metalc15 metalc ? ? Q ZN . ZN ? ? ? 1_555 U HOH . O ? ? B ZN 201 B HOH 322 1_555 ? ? ? ? ? ? ? 2.633 ? metalc16 metalc ? ? A GLU 17 OE1 ? ? ? 1_555 C ZN . ZN ? ? A GLU 44 A ZN 201 5_655 ? ? ? ? ? ? ? 1.964 ? metalc17 metalc ? ? A ASP 47 OD2 ? ? ? 1_555 E ZN . ZN ? ? A ASP 74 A ZN 203 8_445 ? ? ? ? ? ? ? 2.027 ? metalc18 metalc ? ? B ASP 39 OD1 ? ? ? 1_555 D ZN . ZN ? ? B ASP 66 A ZN 202 1_565 ? ? ? ? ? ? ? 2.384 ? metalc19 metalc ? ? B ASP 39 OD2 ? ? ? 1_555 D ZN . ZN ? ? B ASP 66 A ZN 202 1_565 ? ? ? ? ? ? ? 2.123 ? metalc20 metalc ? ? B ASP 44 OD2 ? ? ? 1_555 H ZN . ZN ? ? B ASP 71 A ZN 206 1_565 ? ? ? ? ? ? ? 2.086 ? metalc21 metalc ? ? B GLU 52 OE2 ? ? ? 1_555 F ZN . ZN ? ? B GLU 79 A ZN 204 8_555 ? ? ? ? ? ? ? 1.909 ? metalc22 metalc ? ? B GLU 60 OE2 ? ? ? 1_555 Q ZN . ZN ? ? B GLU 87 B ZN 201 8_555 ? ? ? ? ? ? ? 2.471 ? metalc23 metalc ? ? B LYS 63 NZ ? ? ? 1_555 Q ZN . ZN ? ? B LYS 90 B ZN 201 8_555 ? ? ? ? ? ? ? 2.192 ? metalc24 metalc ? ? B GLU 83 OE1 ? ? ? 1_555 C ZN . ZN ? ? B GLU 110 A ZN 201 5_545 ? ? ? ? ? ? ? 2.433 ? metalc25 metalc ? ? B GLU 83 OE2 ? ? ? 1_555 C ZN . ZN ? ? B GLU 110 A ZN 201 5_545 ? ? ? ? ? ? ? 2.208 ? metalc26 metalc ? ? C ZN . ZN ? ? ? 1_555 U HOH . O ? ? A ZN 201 B HOH 314 5_565 ? ? ? ? ? ? ? 2.229 ? metalc27 metalc ? ? C ZN . ZN ? ? ? 1_555 T HOH . O ? ? A ZN 201 A HOH 301 5_655 ? ? ? ? ? ? ? 2.688 ? metalc28 metalc ? ? D ZN . ZN ? ? ? 1_555 U HOH . O ? ? A ZN 202 B HOH 316 1_545 ? ? ? ? ? ? ? 2.196 ? metalc29 metalc ? ? D ZN . ZN ? ? ? 1_555 U HOH . O ? ? A ZN 202 B HOH 302 1_545 ? ? ? ? ? ? ? 1.793 ? metalc30 metalc ? ? E ZN . ZN ? ? ? 1_555 T HOH . O ? ? A ZN 203 A HOH 330 8_445 ? ? ? ? ? ? ? 2.275 ? metalc31 metalc ? ? F ZN . ZN ? ? ? 1_555 U HOH . O ? ? A ZN 204 B HOH 319 8_555 ? ? ? ? ? ? ? 2.471 ? metalc32 metalc ? ? G ZN . ZN ? ? ? 1_555 N IMD . N1 ? ? A ZN 205 A IMD 212 1_565 ? ? ? ? ? ? ? 2.301 ? metalc33 metalc ? ? H ZN . ZN ? ? ? 1_555 U HOH . O ? ? A ZN 206 B HOH 321 1_545 ? ? ? ? ? ? ? 2.376 ? metalc34 metalc ? ? H ZN . ZN ? ? ? 1_555 U HOH . O ? ? A ZN 206 B HOH 320 1_655 ? ? ? ? ? ? ? 2.660 ? metalc35 metalc ? ? J ZN . ZN ? ? ? 1_555 S IMD . N3 ? ? A ZN 208 B IMD 203 1_545 ? ? ? ? ? ? ? 1.942 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 5 'binding site for residue ZN A 201' AC2 Software A ZN 202 ? 6 'binding site for residue ZN A 202' AC3 Software A ZN 203 ? 4 'binding site for residue ZN A 203' AC4 Software A ZN 204 ? 4 'binding site for residue ZN A 204' AC5 Software A ZN 205 ? 4 'binding site for residue ZN A 205' AC6 Software A ZN 206 ? 4 'binding site for residue ZN A 206' AC7 Software A ZN 207 ? 1 'binding site for residue ZN A 207' AC8 Software A ZN 208 ? 4 'binding site for residue ZN A 208' AC9 Software A ZN 209 ? 6 'binding site for residue ZN A 209' AD1 Software A CL 210 ? 5 'binding site for residue CL A 210' AD2 Software A CL 211 ? 6 'binding site for residue CL A 211' AD3 Software A IMD 212 ? 9 'binding site for residue IMD A 212' AD4 Software A IMD 213 ? 5 'binding site for residue IMD A 213' AD5 Software A IOD 214 ? 1 'binding site for residue IOD A 214' AD6 Software B ZN 201 ? 4 'binding site for residue ZN B 201' AD7 Software B ZN 202 ? 1 'binding site for residue ZN B 202' AD8 Software B IMD 203 ? 10 'binding site for residue IMD B 203' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ASP A 9 ? ASP A 36 . ? 1_555 ? 2 AC1 5 GLU A 17 ? GLU A 44 . ? 5_655 ? 3 AC1 5 HOH T . ? HOH A 301 . ? 5_655 ? 4 AC1 5 GLU B 83 ? GLU B 110 . ? 5_565 ? 5 AC1 5 HOH U . ? HOH B 314 . ? 5_565 ? 6 AC2 6 ASP A 39 ? ASP A 66 . ? 1_555 ? 7 AC2 6 IMD N . ? IMD A 212 . ? 1_555 ? 8 AC2 6 ASP B 39 ? ASP B 66 . ? 1_545 ? 9 AC2 6 IMD S . ? IMD B 203 . ? 1_545 ? 10 AC2 6 HOH U . ? HOH B 302 . ? 1_545 ? 11 AC2 6 HOH U . ? HOH B 316 . ? 1_545 ? 12 AC3 4 ASP A 44 ? ASP A 71 . ? 1_555 ? 13 AC3 4 ASP A 47 ? ASP A 74 . ? 8_445 ? 14 AC3 4 LYS A 50 ? LYS A 77 . ? 8_445 ? 15 AC3 4 HOH T . ? HOH A 330 . ? 8_445 ? 16 AC4 4 GLU A 59 ? GLU A 86 . ? 1_555 ? 17 AC4 4 IMD O . ? IMD A 213 . ? 1_555 ? 18 AC4 4 GLU B 52 ? GLU B 79 . ? 8_555 ? 19 AC4 4 HOH U . ? HOH B 319 . ? 8_555 ? 20 AC5 4 GLU A 93 ? GLU A 120 . ? 1_555 ? 21 AC5 4 CL L . ? CL A 210 . ? 1_555 ? 22 AC5 4 IMD N . ? IMD A 212 . ? 1_565 ? 23 AC5 4 HIS B 38 ? HIS B 65 . ? 1_555 ? 24 AC6 4 GLU A 32 ? GLU A 59 . ? 1_555 ? 25 AC6 4 ASP B 44 ? ASP B 71 . ? 1_545 ? 26 AC6 4 HOH U . ? HOH B 320 . ? 1_655 ? 27 AC6 4 HOH U . ? HOH B 321 . ? 1_545 ? 28 AC7 1 GLU A 71 ? GLU A 98 . ? 1_555 ? 29 AC8 4 HIS A 38 ? HIS A 65 . ? 1_555 ? 30 AC8 4 CL M . ? CL A 211 . ? 1_555 ? 31 AC8 4 GLU B 93 ? GLU B 120 . ? 1_555 ? 32 AC8 4 IMD S . ? IMD B 203 . ? 1_545 ? 33 AC9 6 GLU A 60 ? GLU A 87 . ? 1_555 ? 34 AC9 6 GLU A 60 ? GLU A 87 . ? 8_555 ? 35 AC9 6 LYS A 63 ? LYS A 90 . ? 1_555 ? 36 AC9 6 LYS A 63 ? LYS A 90 . ? 8_555 ? 37 AC9 6 HOH T . ? HOH A 322 . ? 8_555 ? 38 AC9 6 HOH T . ? HOH A 322 . ? 1_555 ? 39 AD1 5 PHE A 92 ? PHE A 119 . ? 1_555 ? 40 AD1 5 GLU A 93 ? GLU A 120 . ? 1_555 ? 41 AD1 5 ZN G . ? ZN A 205 . ? 1_555 ? 42 AD1 5 IMD N . ? IMD A 212 . ? 1_565 ? 43 AD1 5 ARG B 34 ? ARG B 61 . ? 1_555 ? 44 AD2 6 ARG A 35 ? ARG A 62 . ? 1_555 ? 45 AD2 6 HIS A 38 ? HIS A 65 . ? 1_555 ? 46 AD2 6 ZN J . ? ZN A 208 . ? 1_555 ? 47 AD2 6 PHE B 92 ? PHE B 119 . ? 1_555 ? 48 AD2 6 GLU B 93 ? GLU B 120 . ? 1_555 ? 49 AD2 6 IMD S . ? IMD B 203 . ? 1_545 ? 50 AD3 9 HIS A 38 ? HIS A 65 . ? 1_555 ? 51 AD3 9 ASP A 39 ? ASP A 66 . ? 1_555 ? 52 AD3 9 GLU A 93 ? GLU A 120 . ? 1_545 ? 53 AD3 9 ZN D . ? ZN A 202 . ? 1_555 ? 54 AD3 9 ZN G . ? ZN A 205 . ? 1_545 ? 55 AD3 9 CL L . ? CL A 210 . ? 1_545 ? 56 AD3 9 HIS B 38 ? HIS B 65 . ? 1_545 ? 57 AD3 9 ASP B 39 ? ASP B 66 . ? 1_545 ? 58 AD3 9 IMD S . ? IMD B 203 . ? 1_545 ? 59 AD4 5 ALA A 56 ? ALA A 83 . ? 1_555 ? 60 AD4 5 GLU A 59 ? GLU A 86 . ? 1_555 ? 61 AD4 5 ZN F . ? ZN A 204 . ? 1_555 ? 62 AD4 5 VAL B 49 ? VAL B 76 . ? 8_555 ? 63 AD4 5 GLU B 52 ? GLU B 79 . ? 8_555 ? 64 AD5 1 GLN A 73 ? GLN A 100 . ? 1_555 ? 65 AD6 4 ASP B 47 ? ASP B 74 . ? 1_555 ? 66 AD6 4 GLU B 60 ? GLU B 87 . ? 8_555 ? 67 AD6 4 LYS B 63 ? LYS B 90 . ? 8_555 ? 68 AD6 4 HOH U . ? HOH B 322 . ? 1_555 ? 69 AD7 1 GLU B 71 ? GLU B 98 . ? 1_555 ? 70 AD8 10 ARG A 35 ? ARG A 62 . ? 1_565 ? 71 AD8 10 HIS A 38 ? HIS A 65 . ? 1_565 ? 72 AD8 10 ZN D . ? ZN A 202 . ? 1_565 ? 73 AD8 10 ZN J . ? ZN A 208 . ? 1_565 ? 74 AD8 10 CL M . ? CL A 211 . ? 1_565 ? 75 AD8 10 IMD N . ? IMD A 212 . ? 1_565 ? 76 AD8 10 HIS B 38 ? HIS B 65 . ? 1_555 ? 77 AD8 10 ASP B 39 ? ASP B 66 . ? 1_555 ? 78 AD8 10 GLU B 93 ? GLU B 120 . ? 1_565 ? 79 AD8 10 HOH U . ? HOH B 302 . ? 1_555 ? # _atom_sites.entry_id 6OWY _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.023343 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023343 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003882 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 9.50761 7.44341 ? ? 1.04373 23.83732 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? I ? ? 40.26819 12.56501 ? ? 1.42647 27.02115 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? ZN ? ? 24.64596 5.25405 ? ? 2.14387 29.76375 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 28 28 SER SER A . n A 1 2 PHE 2 29 29 PHE PHE A . n A 1 3 LYS 3 30 30 LYS LYS A . n A 1 4 ASP 4 31 31 ASP ASP A . n A 1 5 LEU 5 32 32 LEU LEU A . n A 1 6 ASN 6 33 33 ASN ASN A . n A 1 7 LEU 7 34 34 LEU LEU A . n A 1 8 THR 8 35 35 THR THR A . n A 1 9 ASP 9 36 36 ASP ASP A . n A 1 10 ALA 10 37 37 ALA ALA A . n A 1 11 GLN 11 38 38 GLN GLN A . n A 1 12 LYS 12 39 39 LYS LYS A . n A 1 13 GLN 13 40 40 GLN GLN A . n A 1 14 GLN 14 41 41 GLN GLN A . n A 1 15 ILE 15 42 42 ILE ILE A . n A 1 16 ARG 16 43 43 ARG ARG A . n A 1 17 GLU 17 44 44 GLU GLU A . n A 1 18 ILE 18 45 45 ILE ILE A . n A 1 19 MET 19 46 46 MET MET A . n A 1 20 LYS 20 47 47 LYS LYS A . n A 1 21 GLY 21 48 48 GLY GLY A . n A 1 22 GLN 22 49 49 GLN GLN A . n A 1 23 ARG 23 50 50 ARG ARG A . n A 1 24 ASP 24 51 ? ? ? A . n A 1 25 GLN 25 52 ? ? ? A . n A 1 26 MET 26 53 ? ? ? A . n A 1 27 LYS 27 54 ? ? ? A . n A 1 28 ARG 28 55 ? ? ? A . n A 1 29 PRO 29 56 56 PRO PRO A . n A 1 30 PRO 30 57 57 PRO PRO A . n A 1 31 LEU 31 58 58 LEU LEU A . n A 1 32 GLU 32 59 59 GLU GLU A . n A 1 33 GLU 33 60 60 GLU GLU A . n A 1 34 ARG 34 61 61 ARG ARG A . n A 1 35 ARG 35 62 62 ARG ARG A . n A 1 36 ALA 36 63 63 ALA ALA A . n A 1 37 MET 37 64 64 MET MET A . n A 1 38 HIS 38 65 65 HIS HIS A . n A 1 39 ASP 39 66 66 ASP ASP A . n A 1 40 ILE 40 67 67 ILE ILE A . n A 1 41 ILE 41 68 68 ILE ILE A . n A 1 42 ALA 42 69 69 ALA ALA A . n A 1 43 SER 43 70 70 SER SER A . n A 1 44 ASP 44 71 71 ASP ASP A . n A 1 45 THR 45 72 72 THR THR A . n A 1 46 PHE 46 73 73 PHE PHE A . n A 1 47 ASP 47 74 74 ASP ASP A . n A 1 48 LYS 48 75 75 LYS LYS A . n A 1 49 VAL 49 76 76 VAL VAL A . n A 1 50 LYS 50 77 77 LYS LYS A . n A 1 51 ALA 51 78 78 ALA ALA A . n A 1 52 GLU 52 79 79 GLU GLU A . n A 1 53 ALA 53 80 80 ALA ALA A . n A 1 54 GLN 54 81 81 GLN GLN A . n A 1 55 ILE 55 82 82 ILE ILE A . n A 1 56 ALA 56 83 83 ALA ALA A . n A 1 57 LYS 57 84 84 LYS LYS A . n A 1 58 MET 58 85 85 MET MET A . n A 1 59 GLU 59 86 86 GLU GLU A . n A 1 60 GLU 60 87 87 GLU GLU A . n A 1 61 GLN 61 88 88 GLN GLN A . n A 1 62 ARG 62 89 89 ARG ARG A . n A 1 63 LYS 63 90 90 LYS LYS A . n A 1 64 ALA 64 91 91 ALA ALA A . n A 1 65 ASN 65 92 92 ASN ASN A . n A 1 66 MET 66 93 93 MET MET A . n A 1 67 LEU 67 94 94 LEU LEU A . n A 1 68 ALA 68 95 95 ALA ALA A . n A 1 69 LEU 69 96 96 LEU LEU A . n A 1 70 MET 70 97 97 MET MET A . n A 1 71 GLU 71 98 98 GLU GLU A . n A 1 72 THR 72 99 99 THR THR A . n A 1 73 GLN 73 100 100 GLN GLN A . n A 1 74 ASN 74 101 101 ASN ASN A . n A 1 75 LYS 75 102 102 LYS LYS A . n A 1 76 ILE 76 103 103 ILE ILE A . n A 1 77 TYR 77 104 104 TYR TYR A . n A 1 78 ASN 78 105 105 ASN ASN A . n A 1 79 ILE 79 106 106 ILE ILE A . n A 1 80 LEU 80 107 107 LEU LEU A . n A 1 81 THR 81 108 108 THR THR A . n A 1 82 PRO 82 109 109 PRO PRO A . n A 1 83 GLU 83 110 110 GLU GLU A . n A 1 84 GLN 84 111 111 GLN GLN A . n A 1 85 LYS 85 112 112 LYS LYS A . n A 1 86 LYS 86 113 113 LYS LYS A . n A 1 87 GLN 87 114 114 GLN GLN A . n A 1 88 PHE 88 115 115 PHE PHE A . n A 1 89 ASN 89 116 116 ASN ASN A . n A 1 90 ALA 90 117 117 ALA ALA A . n A 1 91 ASN 91 118 118 ASN ASN A . n A 1 92 PHE 92 119 119 PHE PHE A . n A 1 93 GLU 93 120 120 GLU GLU A . n A 1 94 LYS 94 121 121 LYS LYS A . n A 1 95 ARG 95 122 122 ARG ARG A . n A 1 96 LEU 96 123 ? ? ? A . n A 1 97 THR 97 124 ? ? ? A . n B 1 1 SER 1 28 ? ? ? B . n B 1 2 PHE 2 29 29 PHE PHE B . n B 1 3 LYS 3 30 30 LYS LYS B . n B 1 4 ASP 4 31 31 ASP ASP B . n B 1 5 LEU 5 32 32 LEU LEU B . n B 1 6 ASN 6 33 33 ASN ASN B . n B 1 7 LEU 7 34 34 LEU LEU B . n B 1 8 THR 8 35 35 THR THR B . n B 1 9 ASP 9 36 36 ASP ASP B . n B 1 10 ALA 10 37 37 ALA ALA B . n B 1 11 GLN 11 38 38 GLN GLN B . n B 1 12 LYS 12 39 39 LYS LYS B . n B 1 13 GLN 13 40 40 GLN GLN B . n B 1 14 GLN 14 41 41 GLN GLN B . n B 1 15 ILE 15 42 42 ILE ILE B . n B 1 16 ARG 16 43 43 ARG ARG B . n B 1 17 GLU 17 44 44 GLU GLU B . n B 1 18 ILE 18 45 45 ILE ILE B . n B 1 19 MET 19 46 46 MET MET B . n B 1 20 LYS 20 47 47 LYS LYS B . n B 1 21 GLY 21 48 48 GLY GLY B . n B 1 22 GLN 22 49 49 GLN GLN B . n B 1 23 ARG 23 50 50 ARG ARG B . n B 1 24 ASP 24 51 51 ASP ASP B . n B 1 25 GLN 25 52 ? ? ? B . n B 1 26 MET 26 53 ? ? ? B . n B 1 27 LYS 27 54 ? ? ? B . n B 1 28 ARG 28 55 ? ? ? B . n B 1 29 PRO 29 56 ? ? ? B . n B 1 30 PRO 30 57 ? ? ? B . n B 1 31 LEU 31 58 58 LEU LEU B . n B 1 32 GLU 32 59 59 GLU GLU B . n B 1 33 GLU 33 60 60 GLU GLU B . n B 1 34 ARG 34 61 61 ARG ARG B . n B 1 35 ARG 35 62 62 ARG ARG B . n B 1 36 ALA 36 63 63 ALA ALA B . n B 1 37 MET 37 64 64 MET MET B . n B 1 38 HIS 38 65 65 HIS HIS B . n B 1 39 ASP 39 66 66 ASP ASP B . n B 1 40 ILE 40 67 67 ILE ILE B . n B 1 41 ILE 41 68 68 ILE ILE B . n B 1 42 ALA 42 69 69 ALA ALA B . n B 1 43 SER 43 70 70 SER SER B . n B 1 44 ASP 44 71 71 ASP ASP B . n B 1 45 THR 45 72 72 THR THR B . n B 1 46 PHE 46 73 73 PHE PHE B . n B 1 47 ASP 47 74 74 ASP ASP B . n B 1 48 LYS 48 75 75 LYS LYS B . n B 1 49 VAL 49 76 76 VAL VAL B . n B 1 50 LYS 50 77 77 LYS LYS B . n B 1 51 ALA 51 78 78 ALA ALA B . n B 1 52 GLU 52 79 79 GLU GLU B . n B 1 53 ALA 53 80 80 ALA ALA B . n B 1 54 GLN 54 81 81 GLN GLN B . n B 1 55 ILE 55 82 82 ILE ILE B . n B 1 56 ALA 56 83 83 ALA ALA B . n B 1 57 LYS 57 84 84 LYS LYS B . n B 1 58 MET 58 85 85 MET MET B . n B 1 59 GLU 59 86 86 GLU GLU B . n B 1 60 GLU 60 87 87 GLU GLU B . n B 1 61 GLN 61 88 88 GLN GLN B . n B 1 62 ARG 62 89 89 ARG ARG B . n B 1 63 LYS 63 90 90 LYS LYS B . n B 1 64 ALA 64 91 91 ALA ALA B . n B 1 65 ASN 65 92 92 ASN ASN B . n B 1 66 MET 66 93 93 MET MET B . n B 1 67 LEU 67 94 94 LEU LEU B . n B 1 68 ALA 68 95 95 ALA ALA B . n B 1 69 LEU 69 96 96 LEU LEU B . n B 1 70 MET 70 97 97 MET MET B . n B 1 71 GLU 71 98 98 GLU GLU B . n B 1 72 THR 72 99 99 THR THR B . n B 1 73 GLN 73 100 100 GLN GLN B . n B 1 74 ASN 74 101 101 ASN ASN B . n B 1 75 LYS 75 102 102 LYS LYS B . n B 1 76 ILE 76 103 103 ILE ILE B . n B 1 77 TYR 77 104 104 TYR TYR B . n B 1 78 ASN 78 105 105 ASN ASN B . n B 1 79 ILE 79 106 106 ILE ILE B . n B 1 80 LEU 80 107 107 LEU LEU B . n B 1 81 THR 81 108 108 THR THR B . n B 1 82 PRO 82 109 109 PRO PRO B . n B 1 83 GLU 83 110 110 GLU GLU B . n B 1 84 GLN 84 111 111 GLN GLN B . n B 1 85 LYS 85 112 112 LYS LYS B . n B 1 86 LYS 86 113 113 LYS LYS B . n B 1 87 GLN 87 114 114 GLN GLN B . n B 1 88 PHE 88 115 115 PHE PHE B . n B 1 89 ASN 89 116 116 ASN ASN B . n B 1 90 ALA 90 117 117 ALA ALA B . n B 1 91 ASN 91 118 118 ASN ASN B . n B 1 92 PHE 92 119 119 PHE PHE B . n B 1 93 GLU 93 120 120 GLU GLU B . n B 1 94 LYS 94 121 121 LYS LYS B . n B 1 95 ARG 95 122 122 ARG ARG B . n B 1 96 LEU 96 123 ? ? ? B . n B 1 97 THR 97 124 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 ZN 1 201 1 ZN ZN A . D 2 ZN 1 202 2 ZN ZN A . E 2 ZN 1 203 3 ZN ZN A . F 2 ZN 1 204 4 ZN ZN A . G 2 ZN 1 205 5 ZN ZN A . H 2 ZN 1 206 6 ZN ZN A . I 2 ZN 1 207 8 ZN ZN A . J 2 ZN 1 208 9 ZN ZN A . K 2 ZN 1 209 10 ZN ZN A . L 3 CL 1 210 1 CL CL A . M 3 CL 1 211 2 CL CL A . N 4 IMD 1 212 1 IMD IMD A . O 4 IMD 1 213 2 IMD IMD A . P 5 IOD 1 214 1 IOD IOD A . Q 2 ZN 1 201 7 ZN ZN B . R 2 ZN 1 202 11 ZN ZN B . S 4 IMD 1 203 4 IMD IMD B . T 6 HOH 1 301 26 HOH HOH A . T 6 HOH 2 302 18 HOH HOH A . T 6 HOH 3 303 44 HOH HOH A . T 6 HOH 4 304 13 HOH HOH A . T 6 HOH 5 305 52 HOH HOH A . T 6 HOH 6 306 58 HOH HOH A . T 6 HOH 7 307 34 HOH HOH A . T 6 HOH 8 308 43 HOH HOH A . T 6 HOH 9 309 11 HOH HOH A . T 6 HOH 10 310 57 HOH HOH A . T 6 HOH 11 311 46 HOH HOH A . T 6 HOH 12 312 42 HOH HOH A . T 6 HOH 13 313 19 HOH HOH A . T 6 HOH 14 314 33 HOH HOH A . T 6 HOH 15 315 29 HOH HOH A . T 6 HOH 16 316 4 HOH HOH A . T 6 HOH 17 317 8 HOH HOH A . T 6 HOH 18 318 17 HOH HOH A . T 6 HOH 19 319 3 HOH HOH A . T 6 HOH 20 320 20 HOH HOH A . T 6 HOH 21 321 45 HOH HOH A . T 6 HOH 22 322 24 HOH HOH A . T 6 HOH 23 323 9 HOH HOH A . T 6 HOH 24 324 50 HOH HOH A . T 6 HOH 25 325 27 HOH HOH A . T 6 HOH 26 326 22 HOH HOH A . T 6 HOH 27 327 39 HOH HOH A . T 6 HOH 28 328 51 HOH HOH A . T 6 HOH 29 329 21 HOH HOH A . T 6 HOH 30 330 41 HOH HOH A . T 6 HOH 31 331 23 HOH HOH A . T 6 HOH 32 332 14 HOH HOH A . T 6 HOH 33 333 47 HOH HOH A . T 6 HOH 34 334 16 HOH HOH A . T 6 HOH 35 335 53 HOH HOH A . U 6 HOH 1 301 36 HOH HOH B . U 6 HOH 2 302 54 HOH HOH B . U 6 HOH 3 303 5 HOH HOH B . U 6 HOH 4 304 32 HOH HOH B . U 6 HOH 5 305 10 HOH HOH B . U 6 HOH 6 306 30 HOH HOH B . U 6 HOH 7 307 49 HOH HOH B . U 6 HOH 8 308 38 HOH HOH B . U 6 HOH 9 309 28 HOH HOH B . U 6 HOH 10 310 7 HOH HOH B . U 6 HOH 11 311 56 HOH HOH B . U 6 HOH 12 312 31 HOH HOH B . U 6 HOH 13 313 1 HOH HOH B . U 6 HOH 14 314 12 HOH HOH B . U 6 HOH 15 315 6 HOH HOH B . U 6 HOH 16 316 55 HOH HOH B . U 6 HOH 17 317 2 HOH HOH B . U 6 HOH 18 318 15 HOH HOH B . U 6 HOH 19 319 40 HOH HOH B . U 6 HOH 20 320 35 HOH HOH B . U 6 HOH 21 321 25 HOH HOH B . U 6 HOH 22 322 48 HOH HOH B . U 6 HOH 23 323 37 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3010 ? 1 MORE -24 ? 1 'SSA (A^2)' 11940 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A ZN 209 ? K ZN . 2 1 B HOH 311 ? U HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 9 ? A ASP 36 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 OD2 ? A ASP 9 ? A ASP 36 ? 1_555 49.9 ? 2 OD1 ? A ASP 9 ? A ASP 36 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 OE1 ? A GLU 17 ? A GLU 44 ? 1_555 40.3 ? 3 OD2 ? A ASP 9 ? A ASP 36 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 OE1 ? A GLU 17 ? A GLU 44 ? 1_555 55.0 ? 4 OD1 ? A ASP 9 ? A ASP 36 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 OE1 ? B GLU 83 ? B GLU 110 ? 1_555 71.9 ? 5 OD2 ? A ASP 9 ? A ASP 36 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 OE1 ? B GLU 83 ? B GLU 110 ? 1_555 121.7 ? 6 OE1 ? A GLU 17 ? A GLU 44 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 OE1 ? B GLU 83 ? B GLU 110 ? 1_555 81.6 ? 7 OD1 ? A ASP 9 ? A ASP 36 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 OE2 ? B GLU 83 ? B GLU 110 ? 1_555 72.6 ? 8 OD2 ? A ASP 9 ? A ASP 36 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 OE2 ? B GLU 83 ? B GLU 110 ? 1_555 122.4 ? 9 OE1 ? A GLU 17 ? A GLU 44 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 OE2 ? B GLU 83 ? B GLU 110 ? 1_555 81.2 ? 10 OE1 ? B GLU 83 ? B GLU 110 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 OE2 ? B GLU 83 ? B GLU 110 ? 1_555 1.5 ? 11 OD1 ? A ASP 9 ? A ASP 36 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 O ? U HOH . ? B HOH 314 ? 5_565 122.8 ? 12 OD2 ? A ASP 9 ? A ASP 36 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 O ? U HOH . ? B HOH 314 ? 5_565 73.6 ? 13 OE1 ? A GLU 17 ? A GLU 44 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 O ? U HOH . ? B HOH 314 ? 5_565 115.2 ? 14 OE1 ? B GLU 83 ? B GLU 110 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 O ? U HOH . ? B HOH 314 ? 5_565 162.9 ? 15 OE2 ? B GLU 83 ? B GLU 110 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 O ? U HOH . ? B HOH 314 ? 5_565 162.9 ? 16 OD1 ? A ASP 9 ? A ASP 36 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 O ? T HOH . ? A HOH 301 ? 5_655 54.1 ? 17 OD2 ? A ASP 9 ? A ASP 36 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 O ? T HOH . ? A HOH 301 ? 5_655 102.4 ? 18 OE1 ? A GLU 17 ? A GLU 44 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 O ? T HOH . ? A HOH 301 ? 5_655 77.5 ? 19 OE1 ? B GLU 83 ? B GLU 110 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 O ? T HOH . ? A HOH 301 ? 5_655 23.7 ? 20 OE2 ? B GLU 83 ? B GLU 110 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 O ? T HOH . ? A HOH 301 ? 5_655 25.1 ? 21 O ? U HOH . ? B HOH 314 ? 5_565 ZN ? C ZN . ? A ZN 201 ? 1_555 O ? T HOH . ? A HOH 301 ? 5_655 157.2 ? 22 OE1 ? A GLU 32 ? A GLU 59 ? 1_555 ZN ? H ZN . ? A ZN 206 ? 1_555 OE2 ? A GLU 32 ? A GLU 59 ? 1_555 52.4 ? 23 OE1 ? A GLU 32 ? A GLU 59 ? 1_555 ZN ? H ZN . ? A ZN 206 ? 1_555 OD2 ? B ASP 44 ? B ASP 71 ? 1_555 120.6 ? 24 OE2 ? A GLU 32 ? A GLU 59 ? 1_555 ZN ? H ZN . ? A ZN 206 ? 1_555 OD2 ? B ASP 44 ? B ASP 71 ? 1_555 78.9 ? 25 OE1 ? A GLU 32 ? A GLU 59 ? 1_555 ZN ? H ZN . ? A ZN 206 ? 1_555 O ? U HOH . ? B HOH 321 ? 1_545 131.8 ? 26 OE2 ? A GLU 32 ? A GLU 59 ? 1_555 ZN ? H ZN . ? A ZN 206 ? 1_555 O ? U HOH . ? B HOH 321 ? 1_545 111.5 ? 27 OD2 ? B ASP 44 ? B ASP 71 ? 1_555 ZN ? H ZN . ? A ZN 206 ? 1_555 O ? U HOH . ? B HOH 321 ? 1_545 93.4 ? 28 OE1 ? A GLU 32 ? A GLU 59 ? 1_555 ZN ? H ZN . ? A ZN 206 ? 1_555 O ? U HOH . ? B HOH 320 ? 1_655 100.7 ? 29 OE2 ? A GLU 32 ? A GLU 59 ? 1_555 ZN ? H ZN . ? A ZN 206 ? 1_555 O ? U HOH . ? B HOH 320 ? 1_655 89.6 ? 30 OD2 ? B ASP 44 ? B ASP 71 ? 1_555 ZN ? H ZN . ? A ZN 206 ? 1_555 O ? U HOH . ? B HOH 320 ? 1_655 41.1 ? 31 O ? U HOH . ? B HOH 321 ? 1_545 ZN ? H ZN . ? A ZN 206 ? 1_555 O ? U HOH . ? B HOH 320 ? 1_655 126.2 ? 32 ND1 ? A HIS 38 ? A HIS 65 ? 1_555 ZN ? J ZN . ? A ZN 208 ? 1_555 OE2 ? B GLU 93 ? B GLU 120 ? 1_555 91.1 ? 33 ND1 ? A HIS 38 ? A HIS 65 ? 1_555 ZN ? J ZN . ? A ZN 208 ? 1_555 N3 ? S IMD . ? B IMD 203 ? 1_545 107.0 ? 34 OE2 ? B GLU 93 ? B GLU 120 ? 1_555 ZN ? J ZN . ? A ZN 208 ? 1_555 N3 ? S IMD . ? B IMD 203 ? 1_545 127.9 ? 35 OD1 ? A ASP 39 ? A ASP 66 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 OD2 ? A ASP 39 ? A ASP 66 ? 1_555 55.5 ? 36 OD1 ? A ASP 39 ? A ASP 66 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 OD1 ? B ASP 39 ? B ASP 66 ? 1_555 49.5 ? 37 OD2 ? A ASP 39 ? A ASP 66 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 OD1 ? B ASP 39 ? B ASP 66 ? 1_555 53.5 ? 38 OD1 ? A ASP 39 ? A ASP 66 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 OD2 ? B ASP 39 ? B ASP 66 ? 1_555 48.3 ? 39 OD2 ? A ASP 39 ? A ASP 66 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 OD2 ? B ASP 39 ? B ASP 66 ? 1_555 50.5 ? 40 OD1 ? B ASP 39 ? B ASP 66 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 OD2 ? B ASP 39 ? B ASP 66 ? 1_555 3.0 ? 41 OD1 ? A ASP 39 ? A ASP 66 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 O ? U HOH . ? B HOH 316 ? 1_545 89.4 ? 42 OD2 ? A ASP 39 ? A ASP 66 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 O ? U HOH . ? B HOH 316 ? 1_545 90.2 ? 43 OD1 ? B ASP 39 ? B ASP 66 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 O ? U HOH . ? B HOH 316 ? 1_545 134.8 ? 44 OD2 ? B ASP 39 ? B ASP 66 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 O ? U HOH . ? B HOH 316 ? 1_545 132.4 ? 45 OD1 ? A ASP 39 ? A ASP 66 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 O ? U HOH . ? B HOH 302 ? 1_545 92.6 ? 46 OD2 ? A ASP 39 ? A ASP 66 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 O ? U HOH . ? B HOH 302 ? 1_545 74.4 ? 47 OD1 ? B ASP 39 ? B ASP 66 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 O ? U HOH . ? B HOH 302 ? 1_545 43.2 ? 48 OD2 ? B ASP 39 ? B ASP 66 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 O ? U HOH . ? B HOH 302 ? 1_545 44.4 ? 49 O ? U HOH . ? B HOH 316 ? 1_545 ZN ? D ZN . ? A ZN 202 ? 1_555 O ? U HOH . ? B HOH 302 ? 1_545 159.7 ? 50 OD2 ? A ASP 44 ? A ASP 71 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 1_555 OD2 ? A ASP 47 ? A ASP 74 ? 1_555 100.0 ? 51 OD2 ? A ASP 44 ? A ASP 71 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 1_555 O ? T HOH . ? A HOH 330 ? 8_445 122.6 ? 52 OD2 ? A ASP 47 ? A ASP 74 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 1_555 O ? T HOH . ? A HOH 330 ? 8_445 59.0 ? 53 OE1 ? A GLU 59 ? A GLU 86 ? 1_555 ZN ? F ZN . ? A ZN 204 ? 1_555 N1 ? O IMD . ? A IMD 213 ? 1_555 94.3 ? 54 OE1 ? A GLU 59 ? A GLU 86 ? 1_555 ZN ? F ZN . ? A ZN 204 ? 1_555 OE2 ? B GLU 52 ? B GLU 79 ? 1_555 72.2 ? 55 N1 ? O IMD . ? A IMD 213 ? 1_555 ZN ? F ZN . ? A ZN 204 ? 1_555 OE2 ? B GLU 52 ? B GLU 79 ? 1_555 157.9 ? 56 OE1 ? A GLU 59 ? A GLU 86 ? 1_555 ZN ? F ZN . ? A ZN 204 ? 1_555 O ? U HOH . ? B HOH 319 ? 8_555 118.3 ? 57 N1 ? O IMD . ? A IMD 213 ? 1_555 ZN ? F ZN . ? A ZN 204 ? 1_555 O ? U HOH . ? B HOH 319 ? 8_555 121.4 ? 58 OE2 ? B GLU 52 ? B GLU 79 ? 1_555 ZN ? F ZN . ? A ZN 204 ? 1_555 O ? U HOH . ? B HOH 319 ? 8_555 80.6 ? 59 OE2 ? A GLU 93 ? A GLU 120 ? 1_555 ZN ? G ZN . ? A ZN 205 ? 1_555 ND1 ? B HIS 38 ? B HIS 65 ? 1_555 94.7 ? 60 OE2 ? A GLU 93 ? A GLU 120 ? 1_555 ZN ? G ZN . ? A ZN 205 ? 1_555 N1 ? N IMD . ? A IMD 212 ? 1_565 131.3 ? 61 ND1 ? B HIS 38 ? B HIS 65 ? 1_555 ZN ? G ZN . ? A ZN 205 ? 1_555 N1 ? N IMD . ? A IMD 212 ? 1_565 98.1 ? 62 OD2 ? B ASP 47 ? B ASP 74 ? 1_555 ZN ? Q ZN . ? B ZN 201 ? 1_555 O ? U HOH . ? B HOH 322 ? 1_555 95.1 ? 63 OD2 ? B ASP 47 ? B ASP 74 ? 1_555 ZN ? Q ZN . ? B ZN 201 ? 1_555 OE2 ? B GLU 60 ? B GLU 87 ? 1_555 82.7 ? 64 O ? U HOH . ? B HOH 322 ? 1_555 ZN ? Q ZN . ? B ZN 201 ? 1_555 OE2 ? B GLU 60 ? B GLU 87 ? 1_555 136.4 ? 65 OD2 ? B ASP 47 ? B ASP 74 ? 1_555 ZN ? Q ZN . ? B ZN 201 ? 1_555 NZ ? B LYS 63 ? B LYS 90 ? 1_555 85.7 ? 66 O ? U HOH . ? B HOH 322 ? 1_555 ZN ? Q ZN . ? B ZN 201 ? 1_555 NZ ? B LYS 63 ? B LYS 90 ? 1_555 142.9 ? 67 OE2 ? B GLU 60 ? B GLU 87 ? 1_555 ZN ? Q ZN . ? B ZN 201 ? 1_555 NZ ? B LYS 63 ? B LYS 90 ? 1_555 7.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-05-29 2 'Structure model' 1 1 2019-06-05 3 'Structure model' 2 0 2019-10-09 4 'Structure model' 2 1 2019-11-20 5 'Structure model' 2 2 2019-12-11 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 3 'Structure model' author 'Coordinate replacement' 'Atoms with unrealistic or zero occupancies' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Structure summary' 4 3 'Structure model' 'Atomic model' 5 3 'Structure model' 'Author supporting evidence' 6 3 'Structure model' 'Data collection' 7 3 'Structure model' Other 8 3 'Structure model' 'Refinement description' 9 3 'Structure model' 'Structure summary' 10 4 'Structure model' 'Author supporting evidence' 11 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' audit_author 2 2 'Structure model' citation_author 3 3 'Structure model' atom_site 4 3 'Structure model' cell 5 3 'Structure model' computing 6 3 'Structure model' pdbx_entity_instance_feature 7 3 'Structure model' pdbx_entry_details 8 3 'Structure model' pdbx_refine_tls 9 3 'Structure model' pdbx_refine_tls_group 10 3 'Structure model' refine 11 3 'Structure model' refine_ls_restr 12 3 'Structure model' refine_ls_shell 13 3 'Structure model' reflns 14 3 'Structure model' reflns_shell 15 3 'Structure model' symmetry 16 4 'Structure model' pdbx_audit_support 17 5 'Structure model' citation 18 5 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_audit_author.name' 2 2 'Structure model' '_citation_author.name' 3 3 'Structure model' '_atom_site.B_iso_or_equiv' 4 3 'Structure model' '_atom_site.Cartn_z' 5 3 'Structure model' '_atom_site.occupancy' 6 3 'Structure model' '_cell.volume' 7 3 'Structure model' '_refine.B_iso_mean' 8 3 'Structure model' '_refine.ls_R_factor_R_free' 9 3 'Structure model' '_refine.ls_R_factor_R_work' 10 3 'Structure model' '_refine.ls_R_factor_obs' 11 3 'Structure model' '_refine.overall_SU_ML' 12 3 'Structure model' '_refine.pdbx_overall_phase_error' 13 3 'Structure model' '_refine.pdbx_stereochemistry_target_values' 14 3 'Structure model' '_refine.solvent_model_details' 15 3 'Structure model' '_refine_ls_restr.dev_ideal' 16 3 'Structure model' '_refine_ls_restr.number' 17 3 'Structure model' '_refine_ls_restr.type' 18 3 'Structure model' '_refine_ls_shell.R_factor_R_free' 19 3 'Structure model' '_refine_ls_shell.R_factor_R_work' 20 3 'Structure model' '_refine_ls_shell.d_res_high' 21 3 'Structure model' '_refine_ls_shell.d_res_low' 22 3 'Structure model' '_refine_ls_shell.percent_reflns_obs' 23 3 'Structure model' '_reflns.pdbx_CC_half' 24 3 'Structure model' '_reflns_shell.pdbx_CC_half' 25 3 'Structure model' '_symmetry.space_group_name_Hall' 26 4 'Structure model' '_pdbx_audit_support.funding_organization' 27 5 'Structure model' '_citation.journal_abbrev' 28 5 'Structure model' '_citation.journal_id_CSD' 29 5 'Structure model' '_citation.journal_id_ISSN' 30 5 'Structure model' '_citation.journal_volume' 31 5 'Structure model' '_citation.page_first' 32 5 'Structure model' '_citation.page_last' 33 5 'Structure model' '_citation.pdbx_database_id_DOI' 34 5 'Structure model' '_citation.pdbx_database_id_PubMed' 35 5 'Structure model' '_citation.title' 36 5 'Structure model' '_citation.year' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14_3260 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _pdbx_entry_details.entry_id 6OWY _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HE21 A GLN 40 ? ? OE2 A GLU 44 ? ? 1.56 2 1 O B ASP 31 ? ? O B HOH 301 ? ? 2.02 3 1 OE2 A GLU 44 ? ? O A HOH 301 ? ? 2.10 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 ZN A ZN 208 ? ? 1_555 HN3 B IMD 203 ? ? 1_545 1.37 2 1 ZN A ZN 205 ? ? 1_555 H2 A IMD 212 ? ? 1_565 1.52 3 1 HZ1 B LYS 90 ? ? 1_555 ZN B ZN 201 ? ? 8_555 1.53 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 29 ? ? 44.97 -59.81 2 1 GLN A 49 ? ? -155.29 52.88 3 1 ALA A 69 ? ? -95.28 49.50 4 1 LYS B 30 ? ? -161.02 79.10 5 1 ASP B 31 ? ? -81.37 49.38 6 1 MET B 46 ? A -78.10 44.47 7 1 LYS B 47 ? ? -138.04 -34.58 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 GLN _pdbx_validate_peptide_omega.auth_asym_id_1 B _pdbx_validate_peptide_omega.auth_seq_id_1 49 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 ARG _pdbx_validate_peptide_omega.auth_asym_id_2 B _pdbx_validate_peptide_omega.auth_seq_id_2 50 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 136.15 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A SER 28 ? OG ? A SER 1 OG 2 1 Y 1 A PHE 29 ? CG ? A PHE 2 CG 3 1 Y 1 A PHE 29 ? CD1 ? A PHE 2 CD1 4 1 Y 1 A PHE 29 ? CD2 ? A PHE 2 CD2 5 1 Y 1 A PHE 29 ? CE1 ? A PHE 2 CE1 6 1 Y 1 A PHE 29 ? CE2 ? A PHE 2 CE2 7 1 Y 1 A PHE 29 ? CZ ? A PHE 2 CZ 8 1 Y 1 A LYS 30 ? CG ? A LYS 3 CG 9 1 Y 1 A LYS 30 ? CD ? A LYS 3 CD 10 1 Y 1 A LYS 30 ? CE ? A LYS 3 CE 11 1 Y 1 A LYS 30 ? NZ ? A LYS 3 NZ 12 1 Y 1 A ASP 31 ? CG ? A ASP 4 CG 13 1 Y 1 A ASP 31 ? OD1 ? A ASP 4 OD1 14 1 Y 1 A ASP 31 ? OD2 ? A ASP 4 OD2 15 1 Y 1 A LYS 47 ? CG ? A LYS 20 CG 16 1 Y 1 A LYS 47 ? CD ? A LYS 20 CD 17 1 Y 1 A LYS 47 ? CE ? A LYS 20 CE 18 1 Y 1 A LYS 47 ? NZ ? A LYS 20 NZ 19 1 Y 1 A GLN 49 ? CG ? A GLN 22 CG 20 1 Y 1 A GLN 49 ? CD ? A GLN 22 CD 21 1 Y 1 A GLN 49 ? OE1 ? A GLN 22 OE1 22 1 Y 1 A GLN 49 ? NE2 ? A GLN 22 NE2 23 1 Y 1 A ARG 50 ? CG ? A ARG 23 CG 24 1 Y 1 A ARG 50 ? CD ? A ARG 23 CD 25 1 Y 1 A ARG 50 ? NE ? A ARG 23 NE 26 1 Y 1 A ARG 50 ? CZ ? A ARG 23 CZ 27 1 Y 1 A ARG 50 ? NH1 ? A ARG 23 NH1 28 1 Y 1 A ARG 50 ? NH2 ? A ARG 23 NH2 29 1 Y 1 A GLN 114 ? CG ? A GLN 87 CG 30 1 Y 1 A GLN 114 ? CD ? A GLN 87 CD 31 1 Y 1 A GLN 114 ? OE1 ? A GLN 87 OE1 32 1 Y 1 A GLN 114 ? NE2 ? A GLN 87 NE2 33 1 Y 1 A LYS 121 ? CG ? A LYS 94 CG 34 1 Y 1 A LYS 121 ? CD ? A LYS 94 CD 35 1 Y 1 A LYS 121 ? CE ? A LYS 94 CE 36 1 Y 1 A LYS 121 ? NZ ? A LYS 94 NZ 37 1 Y 1 A ARG 122 ? CG ? A ARG 95 CG 38 1 Y 1 A ARG 122 ? CD ? A ARG 95 CD 39 1 Y 1 A ARG 122 ? NE ? A ARG 95 NE 40 1 Y 1 A ARG 122 ? CZ ? A ARG 95 CZ 41 1 Y 1 A ARG 122 ? NH1 ? A ARG 95 NH1 42 1 Y 1 A ARG 122 ? NH2 ? A ARG 95 NH2 43 1 Y 1 B PHE 29 ? CG ? B PHE 2 CG 44 1 Y 1 B PHE 29 ? CD1 ? B PHE 2 CD1 45 1 Y 1 B PHE 29 ? CD2 ? B PHE 2 CD2 46 1 Y 1 B PHE 29 ? CE1 ? B PHE 2 CE1 47 1 Y 1 B PHE 29 ? CE2 ? B PHE 2 CE2 48 1 Y 1 B PHE 29 ? CZ ? B PHE 2 CZ 49 1 Y 1 B ASP 31 ? CG ? B ASP 4 CG 50 1 Y 1 B ASP 31 ? OD1 ? B ASP 4 OD1 51 1 Y 1 B ASP 31 ? OD2 ? B ASP 4 OD2 52 1 Y 1 B ARG 43 ? CG ? B ARG 16 CG 53 1 Y 1 B ARG 43 ? CD ? B ARG 16 CD 54 1 Y 1 B ARG 43 ? NE ? B ARG 16 NE 55 1 Y 1 B ARG 43 ? CZ ? B ARG 16 CZ 56 1 Y 1 B ARG 43 ? NH1 ? B ARG 16 NH1 57 1 Y 1 B ARG 43 ? NH2 ? B ARG 16 NH2 58 1 Y 1 B LYS 47 ? CG ? B LYS 20 CG 59 1 Y 1 B LYS 47 ? CD ? B LYS 20 CD 60 1 Y 1 B LYS 47 ? CE ? B LYS 20 CE 61 1 Y 1 B LYS 47 ? NZ ? B LYS 20 NZ 62 1 Y 1 B ARG 50 ? CG ? B ARG 23 CG 63 1 Y 1 B ARG 50 ? CD ? B ARG 23 CD 64 1 Y 1 B ARG 50 ? NE ? B ARG 23 NE 65 1 Y 1 B ARG 50 ? CZ ? B ARG 23 CZ 66 1 Y 1 B ARG 50 ? NH1 ? B ARG 23 NH1 67 1 Y 1 B ARG 50 ? NH2 ? B ARG 23 NH2 68 1 Y 1 B ASP 51 ? CG ? B ASP 24 CG 69 1 Y 1 B ASP 51 ? OD1 ? B ASP 24 OD1 70 1 Y 1 B ASP 51 ? OD2 ? B ASP 24 OD2 71 1 Y 1 B LEU 58 ? CG ? B LEU 31 CG 72 1 Y 1 B LEU 58 ? CD1 ? B LEU 31 CD1 73 1 Y 1 B LEU 58 ? CD2 ? B LEU 31 CD2 74 1 Y 1 B GLU 59 ? CG ? B GLU 32 CG 75 1 Y 1 B GLU 59 ? CD ? B GLU 32 CD 76 1 Y 1 B GLU 59 ? OE1 ? B GLU 32 OE1 77 1 Y 1 B GLU 59 ? OE2 ? B GLU 32 OE2 78 1 Y 1 B GLU 60 ? CG ? B GLU 33 CG 79 1 Y 1 B GLU 60 ? CD ? B GLU 33 CD 80 1 Y 1 B GLU 60 ? OE1 ? B GLU 33 OE1 81 1 Y 1 B GLU 60 ? OE2 ? B GLU 33 OE2 82 1 Y 1 B ARG 62 ? CG ? B ARG 35 CG 83 1 Y 1 B ARG 62 ? CD ? B ARG 35 CD 84 1 Y 1 B ARG 62 ? NE ? B ARG 35 NE 85 1 Y 1 B ARG 62 ? CZ ? B ARG 35 CZ 86 1 Y 1 B ARG 62 ? NH1 ? B ARG 35 NH1 87 1 Y 1 B ARG 62 ? NH2 ? B ARG 35 NH2 88 1 Y 1 B LYS 75 ? CG ? B LYS 48 CG 89 1 Y 1 B LYS 75 ? CD ? B LYS 48 CD 90 1 Y 1 B LYS 75 ? CE ? B LYS 48 CE 91 1 Y 1 B LYS 75 ? NZ ? B LYS 48 NZ 92 1 Y 1 B LYS 77 ? CG ? B LYS 50 CG 93 1 Y 1 B LYS 77 ? CD ? B LYS 50 CD 94 1 Y 1 B LYS 77 ? CE ? B LYS 50 CE 95 1 Y 1 B LYS 77 ? NZ ? B LYS 50 NZ 96 1 Y 1 B ARG 122 ? CG ? B ARG 95 CG 97 1 Y 1 B ARG 122 ? CD ? B ARG 95 CD 98 1 Y 1 B ARG 122 ? NE ? B ARG 95 NE 99 1 Y 1 B ARG 122 ? CZ ? B ARG 95 CZ 100 1 Y 1 B ARG 122 ? NH1 ? B ARG 95 NH1 101 1 Y 1 B ARG 122 ? NH2 ? B ARG 95 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASP 51 ? A ASP 24 2 1 Y 1 A GLN 52 ? A GLN 25 3 1 Y 1 A MET 53 ? A MET 26 4 1 Y 1 A LYS 54 ? A LYS 27 5 1 Y 1 A ARG 55 ? A ARG 28 6 1 Y 1 A LEU 123 ? A LEU 96 7 1 Y 1 A THR 124 ? A THR 97 8 1 Y 1 B SER 28 ? B SER 1 9 1 Y 1 B GLN 52 ? B GLN 25 10 1 Y 1 B MET 53 ? B MET 26 11 1 Y 1 B LYS 54 ? B LYS 27 12 1 Y 1 B ARG 55 ? B ARG 28 13 1 Y 1 B PRO 56 ? B PRO 29 14 1 Y 1 B PRO 57 ? B PRO 30 15 1 Y 1 B LEU 123 ? B LEU 96 16 1 Y 1 B THR 124 ? B THR 97 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 'R00 GM120388' 1 'Howard Hughes Medical Institute (HHMI)' 'United States' ? 2 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id IOD _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id IOD _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'CHLORIDE ION' CL 4 IMIDAZOLE IMD 5 'IODIDE ION' IOD 6 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'assay for oligomerization' _pdbx_struct_assembly_auth_evidence.details 'analytical ultracentrifugation' # _space_group.name_H-M_alt 'P 41 2 2' _space_group.name_Hall 'P 4w 2c' _space_group.IT_number 91 _space_group.crystal_system tetragonal _space_group.id 1 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x,z+1/4 3 y,-x,z+3/4 4 x,-y,-z+1/2 5 -x,y,-z 6 -x,-y,z+1/2 7 y,x,-z+3/4 8 -y,-x,-z+1/4 #