data_6P2E # _entry.id 6P2E # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6P2E pdb_00006p2e 10.2210/pdb6p2e/pdb WWPDB D_1000241291 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-07-31 2 'Structure model' 1 1 2019-12-18 3 'Structure model' 1 2 2020-05-06 4 'Structure model' 1 3 2024-04-03 5 'Structure model' 1 4 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Refinement description' 6 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_initial_refinement_model 8 5 'Structure model' pdbx_entry_details 9 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_citation.country' 3 3 'Structure model' '_citation.journal_abbrev' 4 3 'Structure model' '_citation.journal_id_CSD' 5 3 'Structure model' '_citation.journal_id_ISSN' 6 3 'Structure model' '_citation.journal_volume' 7 3 'Structure model' '_citation.page_first' 8 3 'Structure model' '_citation.page_last' 9 3 'Structure model' '_citation.pdbx_database_id_DOI' 10 3 'Structure model' '_citation.pdbx_database_id_PubMed' 11 3 'Structure model' '_citation.title' 12 3 'Structure model' '_citation.year' 13 4 'Structure model' '_database_2.pdbx_DOI' 14 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6P2E _pdbx_database_status.recvd_initial_deposition_date 2019-05-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'Structure of apo-AeOBP22' 6OG0 unspecified PDB 'Structure of AeOBP22 bound to linoleic acid' 6OGH unspecified PDB 'Structure of AeOBP22 bound to arachidonic acid' 6OII unspecified PDB 'Structure of AeOBP22 bound to palmitoleic acid' 6OMW unspecified PDB 'Structure of AeOBP22 bound to arachidic acid' 6OPB unspecified PDB 'Structure of AeOBP22 bound to benzaldehyde' 6OTL unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jones, D.N.' 1 0000-0002-7586-3543 'Murphy, E.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first 3300 _citation.page_last 3300 _citation.title 'Aedes aegypti Odorant Binding Protein 22 selectively binds fatty acids through a conformational change in its C-terminal tail.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41598-020-60242-9 _citation.pdbx_database_id_PubMed 32094450 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, J.' 1 ? primary 'Murphy, E.J.' 2 ? primary 'Nix, J.C.' 3 ? primary 'Jones, D.N.M.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'OBP22, AAEL005772-PA' 14400.319 1 ? ? ? ? 2 non-polymer syn 'BENZOIC ACID' 122.121 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 2 ? ? ? ? 4 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 5 water nat water 18.015 110 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Odorant binding protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEFTVSTTEDLQRYRTECVSSLNIPADYVEKFKKWEFPEDDTTMCYIKCVFNKMQLFDDTEGPLVDNLVHQLAHGRDAEE VRTEVLKCVDKNTDNNACHWAFRGFKCFQKNNLSLIKASIKKD ; _entity_poly.pdbx_seq_one_letter_code_can ;MEFTVSTTEDLQRYRTECVSSLNIPADYVEKFKKWEFPEDDTTMCYIKCVFNKMQLFDDTEGPLVDNLVHQLAHGRDAEE VRTEVLKCVDKNTDNNACHWAFRGFKCFQKNNLSLIKASIKKD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'BENZOIC ACID' BEZ 3 GLYCEROL GOL 4 'SULFATE ION' SO4 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 PHE n 1 4 THR n 1 5 VAL n 1 6 SER n 1 7 THR n 1 8 THR n 1 9 GLU n 1 10 ASP n 1 11 LEU n 1 12 GLN n 1 13 ARG n 1 14 TYR n 1 15 ARG n 1 16 THR n 1 17 GLU n 1 18 CYS n 1 19 VAL n 1 20 SER n 1 21 SER n 1 22 LEU n 1 23 ASN n 1 24 ILE n 1 25 PRO n 1 26 ALA n 1 27 ASP n 1 28 TYR n 1 29 VAL n 1 30 GLU n 1 31 LYS n 1 32 PHE n 1 33 LYS n 1 34 LYS n 1 35 TRP n 1 36 GLU n 1 37 PHE n 1 38 PRO n 1 39 GLU n 1 40 ASP n 1 41 ASP n 1 42 THR n 1 43 THR n 1 44 MET n 1 45 CYS n 1 46 TYR n 1 47 ILE n 1 48 LYS n 1 49 CYS n 1 50 VAL n 1 51 PHE n 1 52 ASN n 1 53 LYS n 1 54 MET n 1 55 GLN n 1 56 LEU n 1 57 PHE n 1 58 ASP n 1 59 ASP n 1 60 THR n 1 61 GLU n 1 62 GLY n 1 63 PRO n 1 64 LEU n 1 65 VAL n 1 66 ASP n 1 67 ASN n 1 68 LEU n 1 69 VAL n 1 70 HIS n 1 71 GLN n 1 72 LEU n 1 73 ALA n 1 74 HIS n 1 75 GLY n 1 76 ARG n 1 77 ASP n 1 78 ALA n 1 79 GLU n 1 80 GLU n 1 81 VAL n 1 82 ARG n 1 83 THR n 1 84 GLU n 1 85 VAL n 1 86 LEU n 1 87 LYS n 1 88 CYS n 1 89 VAL n 1 90 ASP n 1 91 LYS n 1 92 ASN n 1 93 THR n 1 94 ASP n 1 95 ASN n 1 96 ASN n 1 97 ALA n 1 98 CYS n 1 99 HIS n 1 100 TRP n 1 101 ALA n 1 102 PHE n 1 103 ARG n 1 104 GLY n 1 105 PHE n 1 106 LYS n 1 107 CYS n 1 108 PHE n 1 109 GLN n 1 110 LYS n 1 111 ASN n 1 112 ASN n 1 113 LEU n 1 114 SER n 1 115 LEU n 1 116 ILE n 1 117 LYS n 1 118 ALA n 1 119 SER n 1 120 ILE n 1 121 LYS n 1 122 LYS n 1 123 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 123 _entity_src_gen.gene_src_common_name 'Yellowfever mosquito' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene '5567053, AAEL005772' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue 'Antennal cDNA' _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Aedes aegypti' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7159 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET13a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BEZ non-polymer . 'BENZOIC ACID' ? 'C7 H6 O2' 122.121 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 2 GLU ALA A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 TRP 35 35 35 TRP TRP A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 MET 54 54 54 MET MET A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 HIS 74 74 74 HIS HIS A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 CYS 88 88 88 CYS CYS A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 CYS 98 98 98 CYS CYS A . n A 1 99 HIS 99 99 99 HIS HIS A . n A 1 100 TRP 100 100 100 TRP TRP A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 CYS 107 107 107 CYS CYS A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 ASP 123 123 123 ASP ASP A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 BEZ 1 201 201 BEZ BEZ A . C 3 GOL 1 202 1 GOL GOL A . D 3 GOL 1 203 2 GOL GOL A . E 4 SO4 1 204 1 SO4 SO4 A . F 4 SO4 1 205 2 SO4 SO4 A . G 5 HOH 1 301 40 HOH HOH A . G 5 HOH 2 302 60 HOH HOH A . G 5 HOH 3 303 152 HOH HOH A . G 5 HOH 4 304 21 HOH HOH A . G 5 HOH 5 305 17 HOH HOH A . G 5 HOH 6 306 57 HOH HOH A . G 5 HOH 7 307 53 HOH HOH A . G 5 HOH 8 308 137 HOH HOH A . G 5 HOH 9 309 50 HOH HOH A . G 5 HOH 10 310 136 HOH HOH A . G 5 HOH 11 311 65 HOH HOH A . G 5 HOH 12 312 82 HOH HOH A . G 5 HOH 13 313 119 HOH HOH A . G 5 HOH 14 314 5 HOH HOH A . G 5 HOH 15 315 25 HOH HOH A . G 5 HOH 16 316 62 HOH HOH A . G 5 HOH 17 317 113 HOH HOH A . G 5 HOH 18 318 48 HOH HOH A . G 5 HOH 19 319 147 HOH HOH A . G 5 HOH 20 320 153 HOH HOH A . G 5 HOH 21 321 26 HOH HOH A . G 5 HOH 22 322 8 HOH HOH A . G 5 HOH 23 323 11 HOH HOH A . G 5 HOH 24 324 34 HOH HOH A . G 5 HOH 25 325 71 HOH HOH A . G 5 HOH 26 326 49 HOH HOH A . G 5 HOH 27 327 27 HOH HOH A . G 5 HOH 28 328 43 HOH HOH A . G 5 HOH 29 329 141 HOH HOH A . G 5 HOH 30 330 36 HOH HOH A . G 5 HOH 31 331 70 HOH HOH A . G 5 HOH 32 332 54 HOH HOH A . G 5 HOH 33 333 19 HOH HOH A . G 5 HOH 34 334 31 HOH HOH A . G 5 HOH 35 335 159 HOH HOH A . G 5 HOH 36 336 139 HOH HOH A . G 5 HOH 37 337 142 HOH HOH A . G 5 HOH 38 338 10 HOH HOH A . G 5 HOH 39 339 77 HOH HOH A . G 5 HOH 40 340 138 HOH HOH A . G 5 HOH 41 341 15 HOH HOH A . G 5 HOH 42 342 12 HOH HOH A . G 5 HOH 43 343 163 HOH HOH A . G 5 HOH 44 344 46 HOH HOH A . G 5 HOH 45 345 56 HOH HOH A . G 5 HOH 46 346 74 HOH HOH A . G 5 HOH 47 347 28 HOH HOH A . G 5 HOH 48 348 22 HOH HOH A . G 5 HOH 49 349 45 HOH HOH A . G 5 HOH 50 350 4 HOH HOH A . G 5 HOH 51 351 13 HOH HOH A . G 5 HOH 52 352 67 HOH HOH A . G 5 HOH 53 353 7 HOH HOH A . G 5 HOH 54 354 2 HOH HOH A . G 5 HOH 55 355 160 HOH HOH A . G 5 HOH 56 356 131 HOH HOH A . G 5 HOH 57 357 76 HOH HOH A . G 5 HOH 58 358 91 HOH HOH A . G 5 HOH 59 359 66 HOH HOH A . G 5 HOH 60 360 20 HOH HOH A . G 5 HOH 61 361 24 HOH HOH A . G 5 HOH 62 362 33 HOH HOH A . G 5 HOH 63 363 104 HOH HOH A . G 5 HOH 64 364 9 HOH HOH A . G 5 HOH 65 365 79 HOH HOH A . G 5 HOH 66 366 63 HOH HOH A . G 5 HOH 67 367 55 HOH HOH A . G 5 HOH 68 368 6 HOH HOH A . G 5 HOH 69 369 144 HOH HOH A . G 5 HOH 70 370 14 HOH HOH A . G 5 HOH 71 371 164 HOH HOH A . G 5 HOH 72 372 154 HOH HOH A . G 5 HOH 73 373 44 HOH HOH A . G 5 HOH 74 374 162 HOH HOH A . G 5 HOH 75 375 18 HOH HOH A . G 5 HOH 76 376 23 HOH HOH A . G 5 HOH 77 377 16 HOH HOH A . G 5 HOH 78 378 148 HOH HOH A . G 5 HOH 79 379 155 HOH HOH A . G 5 HOH 80 380 100 HOH HOH A . G 5 HOH 81 381 133 HOH HOH A . G 5 HOH 82 382 114 HOH HOH A . G 5 HOH 83 383 150 HOH HOH A . G 5 HOH 84 384 145 HOH HOH A . G 5 HOH 85 385 140 HOH HOH A . G 5 HOH 86 386 115 HOH HOH A . G 5 HOH 87 387 116 HOH HOH A . G 5 HOH 88 388 146 HOH HOH A . G 5 HOH 89 389 85 HOH HOH A . G 5 HOH 90 390 158 HOH HOH A . G 5 HOH 91 391 134 HOH HOH A . G 5 HOH 92 392 87 HOH HOH A . G 5 HOH 93 393 156 HOH HOH A . G 5 HOH 94 394 59 HOH HOH A . G 5 HOH 95 395 157 HOH HOH A . G 5 HOH 96 396 101 HOH HOH A . G 5 HOH 97 397 102 HOH HOH A . G 5 HOH 98 398 151 HOH HOH A . G 5 HOH 99 399 117 HOH HOH A . G 5 HOH 100 400 112 HOH HOH A . G 5 HOH 101 401 68 HOH HOH A . G 5 HOH 102 402 94 HOH HOH A . G 5 HOH 103 403 29 HOH HOH A . G 5 HOH 104 404 51 HOH HOH A . G 5 HOH 105 405 135 HOH HOH A . G 5 HOH 106 406 108 HOH HOH A . G 5 HOH 107 407 107 HOH HOH A . G 5 HOH 108 408 161 HOH HOH A . G 5 HOH 109 409 73 HOH HOH A . G 5 HOH 110 410 123 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 2 ? CG ? A GLU 2 CG 2 1 Y 1 A GLU 2 ? CD ? A GLU 2 CD 3 1 Y 1 A GLU 2 ? OE1 ? A GLU 2 OE1 4 1 Y 1 A GLU 2 ? OE2 ? A GLU 2 OE2 5 1 Y 1 A LYS 122 ? CG ? A LYS 122 CG 6 1 Y 1 A LYS 122 ? CD ? A LYS 122 CD 7 1 Y 1 A LYS 122 ? CE ? A LYS 122 CE 8 1 Y 1 A LYS 122 ? NZ ? A LYS 122 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0238 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6P2E _cell.details ? _cell.formula_units_Z ? _cell.length_a 86.934 _cell.length_a_esd ? _cell.length_b 86.934 _cell.length_b_esd ? _cell.length_c 58.515 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6P2E _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6P2E _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.61 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 73.4 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2M Ammonium sulfate, 0.1 M sodium citrate, 0.2M sodium potassium tartrate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details 'Rosenbaum-Rock monochromator' _diffrn_detector.detector CMOS _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RDI CMOS_8M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-09-13 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 4.2.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 4.2.2 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 30.72 _reflns.entry_id 6P2E _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.9 _reflns.d_resolution_low 35 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 40781 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.69 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.0 _reflns.pdbx_Rmerge_I_obs 0.01588 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 25.63 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.02246 _reflns.pdbx_Rpim_I_all 0.01588 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.9 _reflns_shell.d_res_low 1.968 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.16 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2001 _reflns_shell.percent_possible_all 99.85 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.2494 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.0 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.3528 _reflns_shell.pdbx_Rpim_I_all 0.2494 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.889 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.00 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.00 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -0.01 _refine.B_iso_max ? _refine.B_iso_mean 35.491 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.961 _refine.correlation_coeff_Fo_to_Fc_free 0.952 _refine.details 'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6P2E _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.90 _refine.ls_d_res_low 35.00 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 18421 _refine.ls_number_reflns_R_free 1997 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.57 _refine.ls_percent_reflns_R_free 9.8 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.18464 _refine.ls_R_factor_R_free 0.20013 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.18294 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'OBP22 structure solved by tantalum SAD' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.105 _refine.pdbx_overall_ESU_R_Free 0.099 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.269 _refine.overall_SU_ML 0.066 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 1.90 _refine_hist.d_res_low 35.00 _refine_hist.number_atoms_solvent 110 _refine_hist.number_atoms_total 1131 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 990 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 31 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.012 1086 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.018 1015 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.132 1.638 1472 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.395 1.591 2314 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.327 5.000 131 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 42.987 23.387 62 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 11.661 15.000 190 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 22.353 15.000 6 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.059 0.200 137 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 1242 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 268 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 2.260 3.210 509 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.263 3.200 508 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 3.390 4.785 642 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.387 4.798 643 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 3.150 3.632 577 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 3.123 3.584 570 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 4.973 5.220 818 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 6.585 38.475 1292 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 6.582 38.484 1293 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.898 _refine_ls_shell.d_res_low 1.947 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 141 _refine_ls_shell.number_reflns_R_work 1322 _refine_ls_shell.percent_reflns_obs 97.99 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.253 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.255 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6P2E _struct.title 'Structure of Aedes aegypti OBP22 in the complex with benzaldehyde' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6P2E _struct_keywords.text 'Odorant binding protein, Chemo-sensory signaling, TRANSPORT PROTEIN' _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 4 ? G N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q1HRL7_AEDAE _struct_ref.pdbx_db_accession Q1HRL7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EFTVSTTEDLQRYRTECVSSLNIPADYVEKFKKWEFPEDDTTMCYIKCVFNKMQLFDDTEGPLVDNLVHQLAHGRDAEEV RTEVLKCVDKNTDNNACHWAFRGFKCFQKNNLSLIKASIKKD ; _struct_ref.pdbx_align_begin 17 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6P2E _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 123 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q1HRL7 _struct_ref_seq.db_align_beg 17 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 138 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 123 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6P2E _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q1HRL7 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'assay for oligomerization' _pdbx_struct_assembly_auth_evidence.details ;NMR relaxation experiments establish the overall correlation time is consistent with the presence of a monomeric species in solution. The dimeric form appears to be a crystallization artifact. ; # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 7 ? LEU A 22 ? THR A 7 LEU A 22 1 ? 16 HELX_P HELX_P2 AA2 PRO A 25 ? LYS A 34 ? PRO A 25 LYS A 34 1 ? 10 HELX_P HELX_P3 AA3 ASP A 40 ? MET A 54 ? ASP A 40 MET A 54 1 ? 15 HELX_P HELX_P4 AA4 LEU A 64 ? HIS A 74 ? LEU A 64 HIS A 74 1 ? 11 HELX_P HELX_P5 AA5 ASP A 77 ? CYS A 88 ? ASP A 77 CYS A 88 1 ? 12 HELX_P HELX_P6 AA6 ASN A 96 ? ASN A 111 ? ASN A 96 ASN A 111 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 18 SG ? ? ? 1_555 A CYS 49 SG ? ? A CYS 18 A CYS 49 1_555 ? ? ? ? ? ? ? 2.103 ? ? disulf2 disulf ? ? A CYS 45 SG ? ? ? 1_555 A CYS 98 SG ? ? A CYS 45 A CYS 98 1_555 ? ? ? ? ? ? ? 2.196 ? ? disulf3 disulf ? ? A CYS 88 SG ? ? ? 1_555 A CYS 107 SG ? ? A CYS 88 A CYS 107 1_555 ? ? ? ? ? ? ? 2.151 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 18 ? CYS A 49 ? CYS A 18 ? 1_555 CYS A 49 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 45 ? CYS A 98 ? CYS A 45 ? 1_555 CYS A 98 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 88 ? CYS A 107 ? CYS A 88 ? 1_555 CYS A 107 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 57 ? ASP A 58 ? PHE A 57 ASP A 58 AA1 2 GLY A 62 ? PRO A 63 ? GLY A 62 PRO A 63 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ASP _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 58 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ASP _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 58 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id GLY _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 62 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id GLY _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 62 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A BEZ 201 ? 8 'binding site for residue BEZ A 201' AC2 Software A GOL 202 ? 8 'binding site for residue GOL A 202' AC3 Software A GOL 203 ? 9 'binding site for residue GOL A 203' AC4 Software A SO4 204 ? 5 'binding site for residue SO4 A 204' AC5 Software A SO4 205 ? 2 'binding site for residue SO4 A 205' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 LEU A 11 ? LEU A 11 . ? 1_555 ? 2 AC1 8 TRP A 35 ? TRP A 35 . ? 1_555 ? 3 AC1 8 PHE A 37 ? PHE A 37 . ? 1_555 ? 4 AC1 8 VAL A 50 ? VAL A 50 . ? 1_555 ? 5 AC1 8 PHE A 51 ? PHE A 51 . ? 1_555 ? 6 AC1 8 MET A 54 ? MET A 54 . ? 1_555 ? 7 AC1 8 ILE A 116 ? ILE A 116 . ? 1_555 ? 8 AC1 8 GOL C . ? GOL A 202 . ? 1_555 ? 9 AC2 8 GLN A 109 ? GLN A 109 . ? 1_555 ? 10 AC2 8 SER A 114 ? SER A 114 . ? 1_555 ? 11 AC2 8 LEU A 115 ? LEU A 115 . ? 1_555 ? 12 AC2 8 ILE A 116 ? ILE A 116 . ? 1_555 ? 13 AC2 8 LYS A 117 ? LYS A 117 . ? 6_555 ? 14 AC2 8 ALA A 118 ? ALA A 118 . ? 6_555 ? 15 AC2 8 BEZ B . ? BEZ A 201 . ? 1_555 ? 16 AC2 8 HOH G . ? HOH A 310 . ? 1_555 ? 17 AC3 9 SER A 6 ? SER A 6 . ? 1_555 ? 18 AC3 9 GLN A 71 ? GLN A 71 . ? 1_555 ? 19 AC3 9 HIS A 74 ? HIS A 74 . ? 1_555 ? 20 AC3 9 LEU A 115 ? LEU A 115 . ? 1_555 ? 21 AC3 9 ILE A 116 ? ILE A 116 . ? 1_555 ? 22 AC3 9 LYS A 117 ? LYS A 117 . ? 1_555 ? 23 AC3 9 HOH G . ? HOH A 305 . ? 1_555 ? 24 AC3 9 HOH G . ? HOH A 338 . ? 6_555 ? 25 AC3 9 HOH G . ? HOH A 351 . ? 1_555 ? 26 AC4 5 HIS A 74 ? HIS A 74 . ? 1_555 ? 27 AC4 5 ARG A 76 ? ARG A 76 . ? 1_555 ? 28 AC4 5 GLN A 109 ? GLN A 109 . ? 6_555 ? 29 AC4 5 SER A 119 ? SER A 119 . ? 1_555 ? 30 AC4 5 ILE A 120 ? ILE A 120 . ? 1_555 ? 31 AC5 2 ASN A 112 ? ASN A 112 . ? 1_555 ? 32 AC5 2 ASN A 112 ? ASN A 112 . ? 6_555 ? # _pdbx_entry_details.entry_id 6P2E _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A SO4 205 ? F SO4 . 2 1 A HOH 308 ? G HOH . 3 1 A HOH 341 ? G HOH . # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id MET _pdbx_unobs_or_zero_occ_residues.auth_seq_id 1 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id MET _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BEZ C C N N 74 BEZ O1 O N N 75 BEZ O2 O N N 76 BEZ C1 C Y N 77 BEZ C2 C Y N 78 BEZ C3 C Y N 79 BEZ C4 C Y N 80 BEZ C5 C Y N 81 BEZ C6 C Y N 82 BEZ HO2 H N N 83 BEZ H2 H N N 84 BEZ H3 H N N 85 BEZ H4 H N N 86 BEZ H5 H N N 87 BEZ H6 H N N 88 CYS N N N N 89 CYS CA C N R 90 CYS C C N N 91 CYS O O N N 92 CYS CB C N N 93 CYS SG S N N 94 CYS OXT O N N 95 CYS H H N N 96 CYS H2 H N N 97 CYS HA H N N 98 CYS HB2 H N N 99 CYS HB3 H N N 100 CYS HG H N N 101 CYS HXT H N N 102 GLN N N N N 103 GLN CA C N S 104 GLN C C N N 105 GLN O O N N 106 GLN CB C N N 107 GLN CG C N N 108 GLN CD C N N 109 GLN OE1 O N N 110 GLN NE2 N N N 111 GLN OXT O N N 112 GLN H H N N 113 GLN H2 H N N 114 GLN HA H N N 115 GLN HB2 H N N 116 GLN HB3 H N N 117 GLN HG2 H N N 118 GLN HG3 H N N 119 GLN HE21 H N N 120 GLN HE22 H N N 121 GLN HXT H N N 122 GLU N N N N 123 GLU CA C N S 124 GLU C C N N 125 GLU O O N N 126 GLU CB C N N 127 GLU CG C N N 128 GLU CD C N N 129 GLU OE1 O N N 130 GLU OE2 O N N 131 GLU OXT O N N 132 GLU H H N N 133 GLU H2 H N N 134 GLU HA H N N 135 GLU HB2 H N N 136 GLU HB3 H N N 137 GLU HG2 H N N 138 GLU HG3 H N N 139 GLU HE2 H N N 140 GLU HXT H N N 141 GLY N N N N 142 GLY CA C N N 143 GLY C C N N 144 GLY O O N N 145 GLY OXT O N N 146 GLY H H N N 147 GLY H2 H N N 148 GLY HA2 H N N 149 GLY HA3 H N N 150 GLY HXT H N N 151 GOL C1 C N N 152 GOL O1 O N N 153 GOL C2 C N N 154 GOL O2 O N N 155 GOL C3 C N N 156 GOL O3 O N N 157 GOL H11 H N N 158 GOL H12 H N N 159 GOL HO1 H N N 160 GOL H2 H N N 161 GOL HO2 H N N 162 GOL H31 H N N 163 GOL H32 H N N 164 GOL HO3 H N N 165 HIS N N N N 166 HIS CA C N S 167 HIS C C N N 168 HIS O O N N 169 HIS CB C N N 170 HIS CG C Y N 171 HIS ND1 N Y N 172 HIS CD2 C Y N 173 HIS CE1 C Y N 174 HIS NE2 N Y N 175 HIS OXT O N N 176 HIS H H N N 177 HIS H2 H N N 178 HIS HA H N N 179 HIS HB2 H N N 180 HIS HB3 H N N 181 HIS HD1 H N N 182 HIS HD2 H N N 183 HIS HE1 H N N 184 HIS HE2 H N N 185 HIS HXT H N N 186 HOH O O N N 187 HOH H1 H N N 188 HOH H2 H N N 189 ILE N N N N 190 ILE CA C N S 191 ILE C C N N 192 ILE O O N N 193 ILE CB C N S 194 ILE CG1 C N N 195 ILE CG2 C N N 196 ILE CD1 C N N 197 ILE OXT O N N 198 ILE H H N N 199 ILE H2 H N N 200 ILE HA H N N 201 ILE HB H N N 202 ILE HG12 H N N 203 ILE HG13 H N N 204 ILE HG21 H N N 205 ILE HG22 H N N 206 ILE HG23 H N N 207 ILE HD11 H N N 208 ILE HD12 H N N 209 ILE HD13 H N N 210 ILE HXT H N N 211 LEU N N N N 212 LEU CA C N S 213 LEU C C N N 214 LEU O O N N 215 LEU CB C N N 216 LEU CG C N N 217 LEU CD1 C N N 218 LEU CD2 C N N 219 LEU OXT O N N 220 LEU H H N N 221 LEU H2 H N N 222 LEU HA H N N 223 LEU HB2 H N N 224 LEU HB3 H N N 225 LEU HG H N N 226 LEU HD11 H N N 227 LEU HD12 H N N 228 LEU HD13 H N N 229 LEU HD21 H N N 230 LEU HD22 H N N 231 LEU HD23 H N N 232 LEU HXT H N N 233 LYS N N N N 234 LYS CA C N S 235 LYS C C N N 236 LYS O O N N 237 LYS CB C N N 238 LYS CG C N N 239 LYS CD C N N 240 LYS CE C N N 241 LYS NZ N N N 242 LYS OXT O N N 243 LYS H H N N 244 LYS H2 H N N 245 LYS HA H N N 246 LYS HB2 H N N 247 LYS HB3 H N N 248 LYS HG2 H N N 249 LYS HG3 H N N 250 LYS HD2 H N N 251 LYS HD3 H N N 252 LYS HE2 H N N 253 LYS HE3 H N N 254 LYS HZ1 H N N 255 LYS HZ2 H N N 256 LYS HZ3 H N N 257 LYS HXT H N N 258 MET N N N N 259 MET CA C N S 260 MET C C N N 261 MET O O N N 262 MET CB C N N 263 MET CG C N N 264 MET SD S N N 265 MET CE C N N 266 MET OXT O N N 267 MET H H N N 268 MET H2 H N N 269 MET HA H N N 270 MET HB2 H N N 271 MET HB3 H N N 272 MET HG2 H N N 273 MET HG3 H N N 274 MET HE1 H N N 275 MET HE2 H N N 276 MET HE3 H N N 277 MET HXT H N N 278 PHE N N N N 279 PHE CA C N S 280 PHE C C N N 281 PHE O O N N 282 PHE CB C N N 283 PHE CG C Y N 284 PHE CD1 C Y N 285 PHE CD2 C Y N 286 PHE CE1 C Y N 287 PHE CE2 C Y N 288 PHE CZ C Y N 289 PHE OXT O N N 290 PHE H H N N 291 PHE H2 H N N 292 PHE HA H N N 293 PHE HB2 H N N 294 PHE HB3 H N N 295 PHE HD1 H N N 296 PHE HD2 H N N 297 PHE HE1 H N N 298 PHE HE2 H N N 299 PHE HZ H N N 300 PHE HXT H N N 301 PRO N N N N 302 PRO CA C N S 303 PRO C C N N 304 PRO O O N N 305 PRO CB C N N 306 PRO CG C N N 307 PRO CD C N N 308 PRO OXT O N N 309 PRO H H N N 310 PRO HA H N N 311 PRO HB2 H N N 312 PRO HB3 H N N 313 PRO HG2 H N N 314 PRO HG3 H N N 315 PRO HD2 H N N 316 PRO HD3 H N N 317 PRO HXT H N N 318 SER N N N N 319 SER CA C N S 320 SER C C N N 321 SER O O N N 322 SER CB C N N 323 SER OG O N N 324 SER OXT O N N 325 SER H H N N 326 SER H2 H N N 327 SER HA H N N 328 SER HB2 H N N 329 SER HB3 H N N 330 SER HG H N N 331 SER HXT H N N 332 SO4 S S N N 333 SO4 O1 O N N 334 SO4 O2 O N N 335 SO4 O3 O N N 336 SO4 O4 O N N 337 THR N N N N 338 THR CA C N S 339 THR C C N N 340 THR O O N N 341 THR CB C N R 342 THR OG1 O N N 343 THR CG2 C N N 344 THR OXT O N N 345 THR H H N N 346 THR H2 H N N 347 THR HA H N N 348 THR HB H N N 349 THR HG1 H N N 350 THR HG21 H N N 351 THR HG22 H N N 352 THR HG23 H N N 353 THR HXT H N N 354 TRP N N N N 355 TRP CA C N S 356 TRP C C N N 357 TRP O O N N 358 TRP CB C N N 359 TRP CG C Y N 360 TRP CD1 C Y N 361 TRP CD2 C Y N 362 TRP NE1 N Y N 363 TRP CE2 C Y N 364 TRP CE3 C Y N 365 TRP CZ2 C Y N 366 TRP CZ3 C Y N 367 TRP CH2 C Y N 368 TRP OXT O N N 369 TRP H H N N 370 TRP H2 H N N 371 TRP HA H N N 372 TRP HB2 H N N 373 TRP HB3 H N N 374 TRP HD1 H N N 375 TRP HE1 H N N 376 TRP HE3 H N N 377 TRP HZ2 H N N 378 TRP HZ3 H N N 379 TRP HH2 H N N 380 TRP HXT H N N 381 TYR N N N N 382 TYR CA C N S 383 TYR C C N N 384 TYR O O N N 385 TYR CB C N N 386 TYR CG C Y N 387 TYR CD1 C Y N 388 TYR CD2 C Y N 389 TYR CE1 C Y N 390 TYR CE2 C Y N 391 TYR CZ C Y N 392 TYR OH O N N 393 TYR OXT O N N 394 TYR H H N N 395 TYR H2 H N N 396 TYR HA H N N 397 TYR HB2 H N N 398 TYR HB3 H N N 399 TYR HD1 H N N 400 TYR HD2 H N N 401 TYR HE1 H N N 402 TYR HE2 H N N 403 TYR HH H N N 404 TYR HXT H N N 405 VAL N N N N 406 VAL CA C N S 407 VAL C C N N 408 VAL O O N N 409 VAL CB C N N 410 VAL CG1 C N N 411 VAL CG2 C N N 412 VAL OXT O N N 413 VAL H H N N 414 VAL H2 H N N 415 VAL HA H N N 416 VAL HB H N N 417 VAL HG11 H N N 418 VAL HG12 H N N 419 VAL HG13 H N N 420 VAL HG21 H N N 421 VAL HG22 H N N 422 VAL HG23 H N N 423 VAL HXT H N N 424 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BEZ C O1 doub N N 70 BEZ C O2 sing N N 71 BEZ C C1 sing N N 72 BEZ O2 HO2 sing N N 73 BEZ C1 C2 doub Y N 74 BEZ C1 C6 sing Y N 75 BEZ C2 C3 sing Y N 76 BEZ C2 H2 sing N N 77 BEZ C3 C4 doub Y N 78 BEZ C3 H3 sing N N 79 BEZ C4 C5 sing Y N 80 BEZ C4 H4 sing N N 81 BEZ C5 C6 doub Y N 82 BEZ C5 H5 sing N N 83 BEZ C6 H6 sing N N 84 CYS N CA sing N N 85 CYS N H sing N N 86 CYS N H2 sing N N 87 CYS CA C sing N N 88 CYS CA CB sing N N 89 CYS CA HA sing N N 90 CYS C O doub N N 91 CYS C OXT sing N N 92 CYS CB SG sing N N 93 CYS CB HB2 sing N N 94 CYS CB HB3 sing N N 95 CYS SG HG sing N N 96 CYS OXT HXT sing N N 97 GLN N CA sing N N 98 GLN N H sing N N 99 GLN N H2 sing N N 100 GLN CA C sing N N 101 GLN CA CB sing N N 102 GLN CA HA sing N N 103 GLN C O doub N N 104 GLN C OXT sing N N 105 GLN CB CG sing N N 106 GLN CB HB2 sing N N 107 GLN CB HB3 sing N N 108 GLN CG CD sing N N 109 GLN CG HG2 sing N N 110 GLN CG HG3 sing N N 111 GLN CD OE1 doub N N 112 GLN CD NE2 sing N N 113 GLN NE2 HE21 sing N N 114 GLN NE2 HE22 sing N N 115 GLN OXT HXT sing N N 116 GLU N CA sing N N 117 GLU N H sing N N 118 GLU N H2 sing N N 119 GLU CA C sing N N 120 GLU CA CB sing N N 121 GLU CA HA sing N N 122 GLU C O doub N N 123 GLU C OXT sing N N 124 GLU CB CG sing N N 125 GLU CB HB2 sing N N 126 GLU CB HB3 sing N N 127 GLU CG CD sing N N 128 GLU CG HG2 sing N N 129 GLU CG HG3 sing N N 130 GLU CD OE1 doub N N 131 GLU CD OE2 sing N N 132 GLU OE2 HE2 sing N N 133 GLU OXT HXT sing N N 134 GLY N CA sing N N 135 GLY N H sing N N 136 GLY N H2 sing N N 137 GLY CA C sing N N 138 GLY CA HA2 sing N N 139 GLY CA HA3 sing N N 140 GLY C O doub N N 141 GLY C OXT sing N N 142 GLY OXT HXT sing N N 143 GOL C1 O1 sing N N 144 GOL C1 C2 sing N N 145 GOL C1 H11 sing N N 146 GOL C1 H12 sing N N 147 GOL O1 HO1 sing N N 148 GOL C2 O2 sing N N 149 GOL C2 C3 sing N N 150 GOL C2 H2 sing N N 151 GOL O2 HO2 sing N N 152 GOL C3 O3 sing N N 153 GOL C3 H31 sing N N 154 GOL C3 H32 sing N N 155 GOL O3 HO3 sing N N 156 HIS N CA sing N N 157 HIS N H sing N N 158 HIS N H2 sing N N 159 HIS CA C sing N N 160 HIS CA CB sing N N 161 HIS CA HA sing N N 162 HIS C O doub N N 163 HIS C OXT sing N N 164 HIS CB CG sing N N 165 HIS CB HB2 sing N N 166 HIS CB HB3 sing N N 167 HIS CG ND1 sing Y N 168 HIS CG CD2 doub Y N 169 HIS ND1 CE1 doub Y N 170 HIS ND1 HD1 sing N N 171 HIS CD2 NE2 sing Y N 172 HIS CD2 HD2 sing N N 173 HIS CE1 NE2 sing Y N 174 HIS CE1 HE1 sing N N 175 HIS NE2 HE2 sing N N 176 HIS OXT HXT sing N N 177 HOH O H1 sing N N 178 HOH O H2 sing N N 179 ILE N CA sing N N 180 ILE N H sing N N 181 ILE N H2 sing N N 182 ILE CA C sing N N 183 ILE CA CB sing N N 184 ILE CA HA sing N N 185 ILE C O doub N N 186 ILE C OXT sing N N 187 ILE CB CG1 sing N N 188 ILE CB CG2 sing N N 189 ILE CB HB sing N N 190 ILE CG1 CD1 sing N N 191 ILE CG1 HG12 sing N N 192 ILE CG1 HG13 sing N N 193 ILE CG2 HG21 sing N N 194 ILE CG2 HG22 sing N N 195 ILE CG2 HG23 sing N N 196 ILE CD1 HD11 sing N N 197 ILE CD1 HD12 sing N N 198 ILE CD1 HD13 sing N N 199 ILE OXT HXT sing N N 200 LEU N CA sing N N 201 LEU N H sing N N 202 LEU N H2 sing N N 203 LEU CA C sing N N 204 LEU CA CB sing N N 205 LEU CA HA sing N N 206 LEU C O doub N N 207 LEU C OXT sing N N 208 LEU CB CG sing N N 209 LEU CB HB2 sing N N 210 LEU CB HB3 sing N N 211 LEU CG CD1 sing N N 212 LEU CG CD2 sing N N 213 LEU CG HG sing N N 214 LEU CD1 HD11 sing N N 215 LEU CD1 HD12 sing N N 216 LEU CD1 HD13 sing N N 217 LEU CD2 HD21 sing N N 218 LEU CD2 HD22 sing N N 219 LEU CD2 HD23 sing N N 220 LEU OXT HXT sing N N 221 LYS N CA sing N N 222 LYS N H sing N N 223 LYS N H2 sing N N 224 LYS CA C sing N N 225 LYS CA CB sing N N 226 LYS CA HA sing N N 227 LYS C O doub N N 228 LYS C OXT sing N N 229 LYS CB CG sing N N 230 LYS CB HB2 sing N N 231 LYS CB HB3 sing N N 232 LYS CG CD sing N N 233 LYS CG HG2 sing N N 234 LYS CG HG3 sing N N 235 LYS CD CE sing N N 236 LYS CD HD2 sing N N 237 LYS CD HD3 sing N N 238 LYS CE NZ sing N N 239 LYS CE HE2 sing N N 240 LYS CE HE3 sing N N 241 LYS NZ HZ1 sing N N 242 LYS NZ HZ2 sing N N 243 LYS NZ HZ3 sing N N 244 LYS OXT HXT sing N N 245 MET N CA sing N N 246 MET N H sing N N 247 MET N H2 sing N N 248 MET CA C sing N N 249 MET CA CB sing N N 250 MET CA HA sing N N 251 MET C O doub N N 252 MET C OXT sing N N 253 MET CB CG sing N N 254 MET CB HB2 sing N N 255 MET CB HB3 sing N N 256 MET CG SD sing N N 257 MET CG HG2 sing N N 258 MET CG HG3 sing N N 259 MET SD CE sing N N 260 MET CE HE1 sing N N 261 MET CE HE2 sing N N 262 MET CE HE3 sing N N 263 MET OXT HXT sing N N 264 PHE N CA sing N N 265 PHE N H sing N N 266 PHE N H2 sing N N 267 PHE CA C sing N N 268 PHE CA CB sing N N 269 PHE CA HA sing N N 270 PHE C O doub N N 271 PHE C OXT sing N N 272 PHE CB CG sing N N 273 PHE CB HB2 sing N N 274 PHE CB HB3 sing N N 275 PHE CG CD1 doub Y N 276 PHE CG CD2 sing Y N 277 PHE CD1 CE1 sing Y N 278 PHE CD1 HD1 sing N N 279 PHE CD2 CE2 doub Y N 280 PHE CD2 HD2 sing N N 281 PHE CE1 CZ doub Y N 282 PHE CE1 HE1 sing N N 283 PHE CE2 CZ sing Y N 284 PHE CE2 HE2 sing N N 285 PHE CZ HZ sing N N 286 PHE OXT HXT sing N N 287 PRO N CA sing N N 288 PRO N CD sing N N 289 PRO N H sing N N 290 PRO CA C sing N N 291 PRO CA CB sing N N 292 PRO CA HA sing N N 293 PRO C O doub N N 294 PRO C OXT sing N N 295 PRO CB CG sing N N 296 PRO CB HB2 sing N N 297 PRO CB HB3 sing N N 298 PRO CG CD sing N N 299 PRO CG HG2 sing N N 300 PRO CG HG3 sing N N 301 PRO CD HD2 sing N N 302 PRO CD HD3 sing N N 303 PRO OXT HXT sing N N 304 SER N CA sing N N 305 SER N H sing N N 306 SER N H2 sing N N 307 SER CA C sing N N 308 SER CA CB sing N N 309 SER CA HA sing N N 310 SER C O doub N N 311 SER C OXT sing N N 312 SER CB OG sing N N 313 SER CB HB2 sing N N 314 SER CB HB3 sing N N 315 SER OG HG sing N N 316 SER OXT HXT sing N N 317 SO4 S O1 doub N N 318 SO4 S O2 doub N N 319 SO4 S O3 sing N N 320 SO4 S O4 sing N N 321 THR N CA sing N N 322 THR N H sing N N 323 THR N H2 sing N N 324 THR CA C sing N N 325 THR CA CB sing N N 326 THR CA HA sing N N 327 THR C O doub N N 328 THR C OXT sing N N 329 THR CB OG1 sing N N 330 THR CB CG2 sing N N 331 THR CB HB sing N N 332 THR OG1 HG1 sing N N 333 THR CG2 HG21 sing N N 334 THR CG2 HG22 sing N N 335 THR CG2 HG23 sing N N 336 THR OXT HXT sing N N 337 TRP N CA sing N N 338 TRP N H sing N N 339 TRP N H2 sing N N 340 TRP CA C sing N N 341 TRP CA CB sing N N 342 TRP CA HA sing N N 343 TRP C O doub N N 344 TRP C OXT sing N N 345 TRP CB CG sing N N 346 TRP CB HB2 sing N N 347 TRP CB HB3 sing N N 348 TRP CG CD1 doub Y N 349 TRP CG CD2 sing Y N 350 TRP CD1 NE1 sing Y N 351 TRP CD1 HD1 sing N N 352 TRP CD2 CE2 doub Y N 353 TRP CD2 CE3 sing Y N 354 TRP NE1 CE2 sing Y N 355 TRP NE1 HE1 sing N N 356 TRP CE2 CZ2 sing Y N 357 TRP CE3 CZ3 doub Y N 358 TRP CE3 HE3 sing N N 359 TRP CZ2 CH2 doub Y N 360 TRP CZ2 HZ2 sing N N 361 TRP CZ3 CH2 sing Y N 362 TRP CZ3 HZ3 sing N N 363 TRP CH2 HH2 sing N N 364 TRP OXT HXT sing N N 365 TYR N CA sing N N 366 TYR N H sing N N 367 TYR N H2 sing N N 368 TYR CA C sing N N 369 TYR CA CB sing N N 370 TYR CA HA sing N N 371 TYR C O doub N N 372 TYR C OXT sing N N 373 TYR CB CG sing N N 374 TYR CB HB2 sing N N 375 TYR CB HB3 sing N N 376 TYR CG CD1 doub Y N 377 TYR CG CD2 sing Y N 378 TYR CD1 CE1 sing Y N 379 TYR CD1 HD1 sing N N 380 TYR CD2 CE2 doub Y N 381 TYR CD2 HD2 sing N N 382 TYR CE1 CZ doub Y N 383 TYR CE1 HE1 sing N N 384 TYR CE2 CZ sing Y N 385 TYR CE2 HE2 sing N N 386 TYR CZ OH sing N N 387 TYR OH HH sing N N 388 TYR OXT HXT sing N N 389 VAL N CA sing N N 390 VAL N H sing N N 391 VAL N H2 sing N N 392 VAL CA C sing N N 393 VAL CA CB sing N N 394 VAL CA HA sing N N 395 VAL C O doub N N 396 VAL C OXT sing N N 397 VAL CB CG1 sing N N 398 VAL CB CG2 sing N N 399 VAL CB HB sing N N 400 VAL CG1 HG11 sing N N 401 VAL CG1 HG12 sing N N 402 VAL CG1 HG13 sing N N 403 VAL CG2 HG21 sing N N 404 VAL CG2 HG22 sing N N 405 VAL CG2 HG23 sing N N 406 VAL OXT HXT sing N N 407 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number AI121253 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.details 'OBP22 structure solved by tantalum SAD' # _atom_sites.entry_id 6P2E _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011503 _atom_sites.fract_transf_matrix[1][2] 0.006641 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013282 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017090 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_