data_6P38 # _entry.id 6P38 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6P38 pdb_00006p38 10.2210/pdb6p38/pdb WWPDB D_1000241801 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6P38 _pdbx_database_status.recvd_initial_deposition_date 2019-05-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Seo, H.-S.' 1 ? 'Dhe-Paganon, S.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Med.Chem.Lett.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1948-5875 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first 1443 _citation.page_last 1449 _citation.title 'Dual Inhibition of TAF1 and BET Bromodomains from the BI-2536 Kinase Inhibitor Scaffold.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsmedchemlett.9b00243 _citation.pdbx_database_id_PubMed 31620231 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Remillard, D.' 1 ? primary 'Buckley, D.L.' 2 ? primary 'Seo, H.S.' 3 ? primary 'Ferguson, F.M.' 4 ? primary 'Dhe-Paganon, S.' 5 ? primary 'Bradner, J.E.' 6 ? primary 'Gray, N.S.' 7 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6P38 _cell.details ? _cell.formula_units_Z ? _cell.length_a 95.890 _cell.length_a_esd ? _cell.length_b 95.890 _cell.length_b_esd ? _cell.length_c 94.220 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6P38 _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Transcription initiation factor TFIID subunit 1' 15882.812 1 2.3.1.48,2.7.11.1 ? ? ? 2 non-polymer syn ;4-{[(3R)-4-cyclopentyl-1,3-dimethyl-2-oxo-1,2,3,4-tetrahydropyrido[2,3-b]pyrazin-6-yl]amino}-N-(1-methylpiperidin-4-yl)-3-[(propan-2-yl)oxy]benzamide ; 534.693 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cell cycle gene 1 protein,TBP-associated factor 250 kDa,p250,Transcription initiation factor TFIID 250 kDa subunit,TAFII250' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SMDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILAN SVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEEAELESLD ; _entity_poly.pdbx_seq_one_letter_code_can ;SMDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILAN SVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEEAELESLD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 ASP n 1 4 ASP n 1 5 ASP n 1 6 GLN n 1 7 VAL n 1 8 ALA n 1 9 PHE n 1 10 SER n 1 11 PHE n 1 12 ILE n 1 13 LEU n 1 14 ASP n 1 15 ASN n 1 16 ILE n 1 17 VAL n 1 18 THR n 1 19 GLN n 1 20 LYS n 1 21 MET n 1 22 MET n 1 23 ALA n 1 24 VAL n 1 25 PRO n 1 26 ASP n 1 27 SER n 1 28 TRP n 1 29 PRO n 1 30 PHE n 1 31 HIS n 1 32 HIS n 1 33 PRO n 1 34 VAL n 1 35 ASN n 1 36 LYS n 1 37 LYS n 1 38 PHE n 1 39 VAL n 1 40 PRO n 1 41 ASP n 1 42 TYR n 1 43 TYR n 1 44 LYS n 1 45 VAL n 1 46 ILE n 1 47 VAL n 1 48 ASN n 1 49 PRO n 1 50 MET n 1 51 ASP n 1 52 LEU n 1 53 GLU n 1 54 THR n 1 55 ILE n 1 56 ARG n 1 57 LYS n 1 58 ASN n 1 59 ILE n 1 60 SER n 1 61 LYS n 1 62 HIS n 1 63 LYS n 1 64 TYR n 1 65 GLN n 1 66 SER n 1 67 ARG n 1 68 GLU n 1 69 SER n 1 70 PHE n 1 71 LEU n 1 72 ASP n 1 73 ASP n 1 74 VAL n 1 75 ASN n 1 76 LEU n 1 77 ILE n 1 78 LEU n 1 79 ALA n 1 80 ASN n 1 81 SER n 1 82 VAL n 1 83 LYS n 1 84 TYR n 1 85 ASN n 1 86 GLY n 1 87 PRO n 1 88 GLU n 1 89 SER n 1 90 GLN n 1 91 TYR n 1 92 THR n 1 93 LYS n 1 94 THR n 1 95 ALA n 1 96 GLN n 1 97 GLU n 1 98 ILE n 1 99 VAL n 1 100 ASN n 1 101 VAL n 1 102 CYS n 1 103 TYR n 1 104 GLN n 1 105 THR n 1 106 LEU n 1 107 THR n 1 108 GLU n 1 109 TYR n 1 110 ASP n 1 111 GLU n 1 112 HIS n 1 113 LEU n 1 114 THR n 1 115 GLN n 1 116 LEU n 1 117 GLU n 1 118 LYS n 1 119 ASP n 1 120 ILE n 1 121 CYS n 1 122 THR n 1 123 ALA n 1 124 LYS n 1 125 GLU n 1 126 ALA n 1 127 ALA n 1 128 LEU n 1 129 GLU n 1 130 GLU n 1 131 ALA n 1 132 GLU n 1 133 LEU n 1 134 GLU n 1 135 SER n 1 136 LEU n 1 137 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 137 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TAF1, BA2R, CCG1, CCGS, TAF2A' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TAF1_HUMAN _struct_ref.pdbx_db_accession P21675 _struct_ref.pdbx_db_isoform P21675-12 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSV KYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEEAELESLD ; _struct_ref.pdbx_align_begin 1522 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6P38 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 137 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P21675 _struct_ref_seq.db_align_beg 1522 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1656 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1522 _struct_ref_seq.pdbx_auth_seq_align_end 1656 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6P38 SER A 1 ? UNP P21675 ? ? 'expression tag' 1520 1 1 6P38 MET A 2 ? UNP P21675 ? ? 'expression tag' 1521 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NQV non-polymer . ;4-{[(3R)-4-cyclopentyl-1,3-dimethyl-2-oxo-1,2,3,4-tetrahydropyrido[2,3-b]pyrazin-6-yl]amino}-N-(1-methylpiperidin-4-yl)-3-[(propan-2-yl)oxy]benzamide ; ? 'C30 H42 N6 O3' 534.693 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6P38 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 2000, Trimethylamine N-oxide dihydrate, Tris pH 8.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-08-21 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9791 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9791 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 84.779 _reflns.entry_id 6P38 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.800 _reflns.d_resolution_low 62.300 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12438 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.300 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.700 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.095 _reflns.pdbx_Rpim_I_all 0.039 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 78453 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.800 _reflns_shell.d_res_low 2.850 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.100 _reflns_shell.number_measured_all 4220 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 612 _reflns_shell.percent_possible_all 97.800 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.900 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.618 _reflns_shell.pdbx_Rpim_I_all 0.606 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 198.950 _refine.B_iso_mean 103.5489 _refine.B_iso_min 73.080 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6P38 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.8000 _refine.ls_d_res_low 62.2990 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12428 _refine.ls_number_reflns_R_free 567 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.8400 _refine.ls_percent_reflns_R_free 4.5600 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2064 _refine.ls_R_factor_R_free 0.2193 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2058 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.380 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3UV5 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.7200 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.8000 _refine_hist.d_res_low 62.2990 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1077 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 128 _refine_hist.pdbx_B_iso_mean_ligand 124.05 _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1038 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 39 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.8002 3.0820 3070 . 140 2930 98.0000 . . . 0.3294 0.0000 0.3203 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 3.0820 3.5280 3076 . 152 2924 98.0000 . . . 0.2808 0.0000 0.2643 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 3.5280 4.4447 3101 . 139 2962 98.0000 . . . 0.2618 0.0000 0.2103 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 4.4447 62.3145 3181 . 136 3045 97.0000 . . . 0.1788 0.0000 0.1816 . . . . . . 4 . . . # _struct.entry_id 6P38 _struct.title 'Crystal Structure Analysis of TAF1 Bromodomain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6P38 _struct_keywords.text 'kinase, bromodomain, inhibitor, TRANSCRIPTION, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 3 ? LYS A 20 ? ASP A 1522 LYS A 1539 1 ? 18 HELX_P HELX_P2 AA2 MET A 21 ? VAL A 24 ? MET A 1540 VAL A 1543 5 ? 4 HELX_P HELX_P3 AA3 SER A 27 ? HIS A 31 ? SER A 1546 HIS A 1550 5 ? 5 HELX_P HELX_P4 AA4 ASP A 41 ? ILE A 46 ? ASP A 1560 ILE A 1565 1 ? 6 HELX_P HELX_P5 AA5 ASP A 51 ? LYS A 61 ? ASP A 1570 LYS A 1580 1 ? 11 HELX_P HELX_P6 AA6 SER A 66 ? GLY A 86 ? SER A 1585 GLY A 1605 1 ? 21 HELX_P HELX_P7 AA7 SER A 89 ? TYR A 109 ? SER A 1608 TYR A 1628 1 ? 21 HELX_P HELX_P8 AA8 TYR A 109 ? LEU A 128 ? TYR A 1628 LEU A 1647 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id NQV _struct_site.pdbx_auth_seq_id 4000 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 9 _struct_site.details 'binding site for residue NQV A 4000' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 ASP A 4 ? ASP A 1523 . ? 3_454 ? 2 AC1 9 PHE A 11 ? PHE A 1530 . ? 3_454 ? 3 AC1 9 TRP A 28 ? TRP A 1547 . ? 1_555 ? 4 AC1 9 PRO A 29 ? PRO A 1548 . ? 1_555 ? 5 AC1 9 VAL A 34 ? VAL A 1553 . ? 1_555 ? 6 AC1 9 PHE A 38 ? PHE A 1557 . ? 1_555 ? 7 AC1 9 TYR A 84 ? TYR A 1603 . ? 1_555 ? 8 AC1 9 ASN A 85 ? ASN A 1604 . ? 1_555 ? 9 AC1 9 TYR A 91 ? TYR A 1610 . ? 1_555 ? # _atom_sites.entry_id 6P38 _atom_sites.fract_transf_matrix[1][1] 0.010429 _atom_sites.fract_transf_matrix[1][2] 0.006021 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012042 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010613 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1520 ? ? ? A . n A 1 2 MET 2 1521 1521 MET MET A . n A 1 3 ASP 3 1522 1522 ASP ASP A . n A 1 4 ASP 4 1523 1523 ASP ASP A . n A 1 5 ASP 5 1524 1524 ASP ASP A . n A 1 6 GLN 6 1525 1525 GLN GLN A . n A 1 7 VAL 7 1526 1526 VAL VAL A . n A 1 8 ALA 8 1527 1527 ALA ALA A . n A 1 9 PHE 9 1528 1528 PHE PHE A . n A 1 10 SER 10 1529 1529 SER SER A . n A 1 11 PHE 11 1530 1530 PHE PHE A . n A 1 12 ILE 12 1531 1531 ILE ILE A . n A 1 13 LEU 13 1532 1532 LEU LEU A . n A 1 14 ASP 14 1533 1533 ASP ASP A . n A 1 15 ASN 15 1534 1534 ASN ASN A . n A 1 16 ILE 16 1535 1535 ILE ILE A . n A 1 17 VAL 17 1536 1536 VAL VAL A . n A 1 18 THR 18 1537 1537 THR THR A . n A 1 19 GLN 19 1538 1538 GLN GLN A . n A 1 20 LYS 20 1539 1539 LYS LYS A . n A 1 21 MET 21 1540 1540 MET MET A . n A 1 22 MET 22 1541 1541 MET MET A . n A 1 23 ALA 23 1542 1542 ALA ALA A . n A 1 24 VAL 24 1543 1543 VAL VAL A . n A 1 25 PRO 25 1544 1544 PRO PRO A . n A 1 26 ASP 26 1545 1545 ASP ASP A . n A 1 27 SER 27 1546 1546 SER SER A . n A 1 28 TRP 28 1547 1547 TRP TRP A . n A 1 29 PRO 29 1548 1548 PRO PRO A . n A 1 30 PHE 30 1549 1549 PHE PHE A . n A 1 31 HIS 31 1550 1550 HIS HIS A . n A 1 32 HIS 32 1551 1551 HIS HIS A . n A 1 33 PRO 33 1552 1552 PRO PRO A . n A 1 34 VAL 34 1553 1553 VAL VAL A . n A 1 35 ASN 35 1554 1554 ASN ASN A . n A 1 36 LYS 36 1555 1555 LYS LYS A . n A 1 37 LYS 37 1556 1556 LYS LYS A . n A 1 38 PHE 38 1557 1557 PHE PHE A . n A 1 39 VAL 39 1558 1558 VAL VAL A . n A 1 40 PRO 40 1559 1559 PRO PRO A . n A 1 41 ASP 41 1560 1560 ASP ASP A . n A 1 42 TYR 42 1561 1561 TYR TYR A . n A 1 43 TYR 43 1562 1562 TYR TYR A . n A 1 44 LYS 44 1563 1563 LYS LYS A . n A 1 45 VAL 45 1564 1564 VAL VAL A . n A 1 46 ILE 46 1565 1565 ILE ILE A . n A 1 47 VAL 47 1566 1566 VAL VAL A . n A 1 48 ASN 48 1567 1567 ASN ASN A . n A 1 49 PRO 49 1568 1568 PRO PRO A . n A 1 50 MET 50 1569 1569 MET MET A . n A 1 51 ASP 51 1570 1570 ASP ASP A . n A 1 52 LEU 52 1571 1571 LEU LEU A . n A 1 53 GLU 53 1572 1572 GLU GLU A . n A 1 54 THR 54 1573 1573 THR THR A . n A 1 55 ILE 55 1574 1574 ILE ILE A . n A 1 56 ARG 56 1575 1575 ARG ARG A . n A 1 57 LYS 57 1576 1576 LYS LYS A . n A 1 58 ASN 58 1577 1577 ASN ASN A . n A 1 59 ILE 59 1578 1578 ILE ILE A . n A 1 60 SER 60 1579 1579 SER SER A . n A 1 61 LYS 61 1580 1580 LYS LYS A . n A 1 62 HIS 62 1581 1581 HIS HIS A . n A 1 63 LYS 63 1582 1582 LYS LYS A . n A 1 64 TYR 64 1583 1583 TYR TYR A . n A 1 65 GLN 65 1584 1584 GLN GLN A . n A 1 66 SER 66 1585 1585 SER SER A . n A 1 67 ARG 67 1586 1586 ARG ARG A . n A 1 68 GLU 68 1587 1587 GLU GLU A . n A 1 69 SER 69 1588 1588 SER SER A . n A 1 70 PHE 70 1589 1589 PHE PHE A . n A 1 71 LEU 71 1590 1590 LEU LEU A . n A 1 72 ASP 72 1591 1591 ASP ASP A . n A 1 73 ASP 73 1592 1592 ASP ASP A . n A 1 74 VAL 74 1593 1593 VAL VAL A . n A 1 75 ASN 75 1594 1594 ASN ASN A . n A 1 76 LEU 76 1595 1595 LEU LEU A . n A 1 77 ILE 77 1596 1596 ILE ILE A . n A 1 78 LEU 78 1597 1597 LEU LEU A . n A 1 79 ALA 79 1598 1598 ALA ALA A . n A 1 80 ASN 80 1599 1599 ASN ASN A . n A 1 81 SER 81 1600 1600 SER SER A . n A 1 82 VAL 82 1601 1601 VAL VAL A . n A 1 83 LYS 83 1602 1602 LYS LYS A . n A 1 84 TYR 84 1603 1603 TYR TYR A . n A 1 85 ASN 85 1604 1604 ASN ASN A . n A 1 86 GLY 86 1605 1605 GLY GLY A . n A 1 87 PRO 87 1606 1606 PRO PRO A . n A 1 88 GLU 88 1607 1607 GLU GLU A . n A 1 89 SER 89 1608 1608 SER SER A . n A 1 90 GLN 90 1609 1609 GLN GLN A . n A 1 91 TYR 91 1610 1610 TYR TYR A . n A 1 92 THR 92 1611 1611 THR THR A . n A 1 93 LYS 93 1612 1612 LYS LYS A . n A 1 94 THR 94 1613 1613 THR THR A . n A 1 95 ALA 95 1614 1614 ALA ALA A . n A 1 96 GLN 96 1615 1615 GLN GLN A . n A 1 97 GLU 97 1616 1616 GLU GLU A . n A 1 98 ILE 98 1617 1617 ILE ILE A . n A 1 99 VAL 99 1618 1618 VAL VAL A . n A 1 100 ASN 100 1619 1619 ASN ASN A . n A 1 101 VAL 101 1620 1620 VAL VAL A . n A 1 102 CYS 102 1621 1621 CYS CYS A . n A 1 103 TYR 103 1622 1622 TYR TYR A . n A 1 104 GLN 104 1623 1623 GLN GLN A . n A 1 105 THR 105 1624 1624 THR THR A . n A 1 106 LEU 106 1625 1625 LEU LEU A . n A 1 107 THR 107 1626 1626 THR THR A . n A 1 108 GLU 108 1627 1627 GLU GLU A . n A 1 109 TYR 109 1628 1628 TYR TYR A . n A 1 110 ASP 110 1629 1629 ASP ASP A . n A 1 111 GLU 111 1630 1630 GLU GLU A . n A 1 112 HIS 112 1631 1631 HIS HIS A . n A 1 113 LEU 113 1632 1632 LEU LEU A . n A 1 114 THR 114 1633 1633 THR THR A . n A 1 115 GLN 115 1634 1634 GLN GLN A . n A 1 116 LEU 116 1635 1635 LEU LEU A . n A 1 117 GLU 117 1636 1636 GLU GLU A . n A 1 118 LYS 118 1637 1637 LYS LYS A . n A 1 119 ASP 119 1638 1638 ASP ASP A . n A 1 120 ILE 120 1639 1639 ILE ILE A . n A 1 121 CYS 121 1640 1640 CYS CYS A . n A 1 122 THR 122 1641 1641 THR THR A . n A 1 123 ALA 123 1642 1642 ALA ALA A . n A 1 124 LYS 124 1643 1643 LYS LYS A . n A 1 125 GLU 125 1644 1644 GLU GLU A . n A 1 126 ALA 126 1645 1645 ALA ALA A . n A 1 127 ALA 127 1646 1646 ALA ALA A . n A 1 128 LEU 128 1647 1647 LEU LEU A . n A 1 129 GLU 129 1648 1648 GLU GLU A . n A 1 130 GLU 130 1649 ? ? ? A . n A 1 131 ALA 131 1650 ? ? ? A . n A 1 132 GLU 132 1651 ? ? ? A . n A 1 133 LEU 133 1652 ? ? ? A . n A 1 134 GLU 134 1653 ? ? ? A . n A 1 135 SER 135 1654 ? ? ? A . n A 1 136 LEU 136 1655 ? ? ? A . n A 1 137 ASP 137 1656 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id NQV _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 4000 _pdbx_nonpoly_scheme.auth_seq_num 4000 _pdbx_nonpoly_scheme.pdb_mon_id NQV _pdbx_nonpoly_scheme.auth_mon_id DRG _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id CYS _pdbx_struct_special_symmetry.auth_seq_id 1640 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id A _pdbx_struct_special_symmetry.label_comp_id CYS _pdbx_struct_special_symmetry.label_seq_id 121 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-05-27 2 'Structure model' 1 1 2020-12-09 3 'Structure model' 1 2 2023-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_database_2.pdbx_DOI' 13 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -54.5218 _pdbx_refine_tls.origin_y 17.1840 _pdbx_refine_tls.origin_z -28.4111 _pdbx_refine_tls.T[1][1] 0.9198 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0141 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0001 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.8791 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0746 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.9884 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 2.3423 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.7459 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 1.4854 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 5.4399 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -3.5940 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 5.2291 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.0903 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.2558 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.1706 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0875 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0937 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.0900 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.0360 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.1405 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.0768 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 1521 _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 4000 _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.15.2_3472 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 OD1 A ASP 1523 ? ? 1_555 C16 A NQV 4000 ? ? 2_565 1.38 2 1 CB A CYS 1640 ? ? 1_555 SG A CYS 1640 ? ? 5_554 2.03 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CB _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 CYS _pdbx_validate_rmsd_bond.auth_seq_id_1 1640 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 SG _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 CYS _pdbx_validate_rmsd_bond.auth_seq_id_2 1640 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 2.026 _pdbx_validate_rmsd_bond.bond_target_value 1.818 _pdbx_validate_rmsd_bond.bond_deviation 0.208 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.017 _pdbx_validate_rmsd_bond.linker_flag N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id LEU _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 1647 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -92.45 _pdbx_validate_torsion.psi 50.05 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A MET 1521 ? CG ? A MET 2 CG 2 1 Y 1 A MET 1521 ? SD ? A MET 2 SD 3 1 Y 1 A MET 1521 ? CE ? A MET 2 CE 4 1 Y 1 A LYS 1555 ? NZ ? A LYS 36 NZ 5 1 Y 1 A GLU 1644 ? CG ? A GLU 125 CG 6 1 Y 1 A GLU 1644 ? CD ? A GLU 125 CD 7 1 Y 1 A GLU 1644 ? OE1 ? A GLU 125 OE1 8 1 Y 1 A GLU 1644 ? OE2 ? A GLU 125 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1520 ? A SER 1 2 1 Y 1 A GLU 1649 ? A GLU 130 3 1 Y 1 A ALA 1650 ? A ALA 131 4 1 Y 1 A GLU 1651 ? A GLU 132 5 1 Y 1 A LEU 1652 ? A LEU 133 6 1 Y 1 A GLU 1653 ? A GLU 134 7 1 Y 1 A SER 1654 ? A SER 135 8 1 Y 1 A LEU 1655 ? A LEU 136 9 1 Y 1 A ASP 1656 ? A ASP 137 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 NQV C4 C Y N 247 NQV C14 C N N 248 NQV C5 C Y N 249 NQV C6 C Y N 250 NQV C11 C N N 251 NQV C7 C Y N 252 NQV C8 C Y N 253 NQV C9 C Y N 254 NQV C10 C Y N 255 NQV C12 C N N 256 NQV C13 C N N 257 NQV N1 N N N 258 NQV N2 N N N 259 NQV C3 C Y N 260 NQV N3 N N N 261 NQV C1 C N N 262 NQV C15 C N N 263 NQV C16 C N N 264 NQV C17 C N N 265 NQV C18 C Y N 266 NQV C19 C Y N 267 NQV C2 C N N 268 NQV C20 C N N 269 NQV C21 C N N 270 NQV C22 C N N 271 NQV C23 C Y N 272 NQV C24 C N N 273 NQV C25 C N N 274 NQV C26 C N N 275 NQV C27 C N N 276 NQV C28 C N N 277 NQV C29 C N R 278 NQV C30 C N N 279 NQV N4 N N N 280 NQV N5 N Y N 281 NQV N6 N N N 282 NQV O1 O N N 283 NQV O2 O N N 284 NQV O3 O N N 285 NQV H1 H N N 286 NQV H2 H N N 287 NQV H3 H N N 288 NQV H4 H N N 289 NQV H5 H N N 290 NQV H6 H N N 291 NQV H7 H N N 292 NQV H8 H N N 293 NQV H9 H N N 294 NQV H10 H N N 295 NQV H11 H N N 296 NQV H12 H N N 297 NQV H13 H N N 298 NQV H14 H N N 299 NQV H15 H N N 300 NQV H16 H N N 301 NQV H17 H N N 302 NQV H18 H N N 303 NQV H19 H N N 304 NQV H20 H N N 305 NQV H21 H N N 306 NQV H22 H N N 307 NQV H23 H N N 308 NQV H24 H N N 309 NQV H25 H N N 310 NQV H26 H N N 311 NQV H27 H N N 312 NQV H28 H N N 313 NQV H29 H N N 314 NQV H30 H N N 315 NQV H31 H N N 316 NQV H32 H N N 317 NQV H33 H N N 318 NQV H34 H N N 319 NQV H35 H N N 320 NQV H36 H N N 321 NQV H37 H N N 322 NQV H38 H N N 323 NQV H39 H N N 324 NQV H40 H N N 325 NQV H41 H N N 326 NQV H42 H N N 327 PHE N N N N 328 PHE CA C N S 329 PHE C C N N 330 PHE O O N N 331 PHE CB C N N 332 PHE CG C Y N 333 PHE CD1 C Y N 334 PHE CD2 C Y N 335 PHE CE1 C Y N 336 PHE CE2 C Y N 337 PHE CZ C Y N 338 PHE OXT O N N 339 PHE H H N N 340 PHE H2 H N N 341 PHE HA H N N 342 PHE HB2 H N N 343 PHE HB3 H N N 344 PHE HD1 H N N 345 PHE HD2 H N N 346 PHE HE1 H N N 347 PHE HE2 H N N 348 PHE HZ H N N 349 PHE HXT H N N 350 PRO N N N N 351 PRO CA C N S 352 PRO C C N N 353 PRO O O N N 354 PRO CB C N N 355 PRO CG C N N 356 PRO CD C N N 357 PRO OXT O N N 358 PRO H H N N 359 PRO HA H N N 360 PRO HB2 H N N 361 PRO HB3 H N N 362 PRO HG2 H N N 363 PRO HG3 H N N 364 PRO HD2 H N N 365 PRO HD3 H N N 366 PRO HXT H N N 367 SER N N N N 368 SER CA C N S 369 SER C C N N 370 SER O O N N 371 SER CB C N N 372 SER OG O N N 373 SER OXT O N N 374 SER H H N N 375 SER H2 H N N 376 SER HA H N N 377 SER HB2 H N N 378 SER HB3 H N N 379 SER HG H N N 380 SER HXT H N N 381 THR N N N N 382 THR CA C N S 383 THR C C N N 384 THR O O N N 385 THR CB C N R 386 THR OG1 O N N 387 THR CG2 C N N 388 THR OXT O N N 389 THR H H N N 390 THR H2 H N N 391 THR HA H N N 392 THR HB H N N 393 THR HG1 H N N 394 THR HG21 H N N 395 THR HG22 H N N 396 THR HG23 H N N 397 THR HXT H N N 398 TRP N N N N 399 TRP CA C N S 400 TRP C C N N 401 TRP O O N N 402 TRP CB C N N 403 TRP CG C Y N 404 TRP CD1 C Y N 405 TRP CD2 C Y N 406 TRP NE1 N Y N 407 TRP CE2 C Y N 408 TRP CE3 C Y N 409 TRP CZ2 C Y N 410 TRP CZ3 C Y N 411 TRP CH2 C Y N 412 TRP OXT O N N 413 TRP H H N N 414 TRP H2 H N N 415 TRP HA H N N 416 TRP HB2 H N N 417 TRP HB3 H N N 418 TRP HD1 H N N 419 TRP HE1 H N N 420 TRP HE3 H N N 421 TRP HZ2 H N N 422 TRP HZ3 H N N 423 TRP HH2 H N N 424 TRP HXT H N N 425 TYR N N N N 426 TYR CA C N S 427 TYR C C N N 428 TYR O O N N 429 TYR CB C N N 430 TYR CG C Y N 431 TYR CD1 C Y N 432 TYR CD2 C Y N 433 TYR CE1 C Y N 434 TYR CE2 C Y N 435 TYR CZ C Y N 436 TYR OH O N N 437 TYR OXT O N N 438 TYR H H N N 439 TYR H2 H N N 440 TYR HA H N N 441 TYR HB2 H N N 442 TYR HB3 H N N 443 TYR HD1 H N N 444 TYR HD2 H N N 445 TYR HE1 H N N 446 TYR HE2 H N N 447 TYR HH H N N 448 TYR HXT H N N 449 VAL N N N N 450 VAL CA C N S 451 VAL C C N N 452 VAL O O N N 453 VAL CB C N N 454 VAL CG1 C N N 455 VAL CG2 C N N 456 VAL OXT O N N 457 VAL H H N N 458 VAL H2 H N N 459 VAL HA H N N 460 VAL HB H N N 461 VAL HG11 H N N 462 VAL HG12 H N N 463 VAL HG13 H N N 464 VAL HG21 H N N 465 VAL HG22 H N N 466 VAL HG23 H N N 467 VAL HXT H N N 468 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 NQV C26 C27 sing N N 235 NQV C26 C25 sing N N 236 NQV C27 C28 sing N N 237 NQV C25 C24 sing N N 238 NQV C28 C24 sing N N 239 NQV C24 N6 sing N N 240 NQV C30 C29 sing N N 241 NQV C29 N6 sing N N 242 NQV C29 C1 sing N N 243 NQV N6 C23 sing N N 244 NQV C22 C20 sing N N 245 NQV O1 C1 doub N N 246 NQV C1 N1 sing N N 247 NQV N5 C23 doub Y N 248 NQV N5 C6 sing Y N 249 NQV C23 C3 sing Y N 250 NQV C20 O3 sing N N 251 NQV C20 C21 sing N N 252 NQV O3 C19 sing N N 253 NQV N2 C6 sing N N 254 NQV N2 C7 sing N N 255 NQV N1 C3 sing N N 256 NQV N1 C2 sing N N 257 NQV C6 C5 doub Y N 258 NQV C3 C4 doub Y N 259 NQV C19 C7 doub Y N 260 NQV C19 C18 sing Y N 261 NQV C7 C8 sing Y N 262 NQV C5 C4 sing Y N 263 NQV C18 C10 doub Y N 264 NQV C8 C9 doub Y N 265 NQV C10 C9 sing Y N 266 NQV C10 C11 sing N N 267 NQV O2 C11 doub N N 268 NQV C11 N3 sing N N 269 NQV N3 C12 sing N N 270 NQV C17 C12 sing N N 271 NQV C17 C16 sing N N 272 NQV C12 C13 sing N N 273 NQV C16 N4 sing N N 274 NQV C13 C14 sing N N 275 NQV N4 C14 sing N N 276 NQV N4 C15 sing N N 277 NQV C4 H1 sing N N 278 NQV C14 H2 sing N N 279 NQV C14 H3 sing N N 280 NQV C5 H4 sing N N 281 NQV C8 H5 sing N N 282 NQV C9 H6 sing N N 283 NQV C12 H7 sing N N 284 NQV C13 H8 sing N N 285 NQV C13 H9 sing N N 286 NQV N2 H10 sing N N 287 NQV N3 H11 sing N N 288 NQV C15 H12 sing N N 289 NQV C15 H13 sing N N 290 NQV C15 H14 sing N N 291 NQV C16 H15 sing N N 292 NQV C16 H16 sing N N 293 NQV C17 H17 sing N N 294 NQV C17 H18 sing N N 295 NQV C18 H19 sing N N 296 NQV C2 H20 sing N N 297 NQV C2 H21 sing N N 298 NQV C2 H22 sing N N 299 NQV C20 H23 sing N N 300 NQV C21 H24 sing N N 301 NQV C21 H25 sing N N 302 NQV C21 H26 sing N N 303 NQV C22 H27 sing N N 304 NQV C22 H28 sing N N 305 NQV C22 H29 sing N N 306 NQV C24 H30 sing N N 307 NQV C25 H31 sing N N 308 NQV C25 H32 sing N N 309 NQV C26 H33 sing N N 310 NQV C26 H34 sing N N 311 NQV C27 H35 sing N N 312 NQV C27 H36 sing N N 313 NQV C28 H37 sing N N 314 NQV C28 H38 sing N N 315 NQV C29 H39 sing N N 316 NQV C30 H40 sing N N 317 NQV C30 H41 sing N N 318 NQV C30 H42 sing N N 319 PHE N CA sing N N 320 PHE N H sing N N 321 PHE N H2 sing N N 322 PHE CA C sing N N 323 PHE CA CB sing N N 324 PHE CA HA sing N N 325 PHE C O doub N N 326 PHE C OXT sing N N 327 PHE CB CG sing N N 328 PHE CB HB2 sing N N 329 PHE CB HB3 sing N N 330 PHE CG CD1 doub Y N 331 PHE CG CD2 sing Y N 332 PHE CD1 CE1 sing Y N 333 PHE CD1 HD1 sing N N 334 PHE CD2 CE2 doub Y N 335 PHE CD2 HD2 sing N N 336 PHE CE1 CZ doub Y N 337 PHE CE1 HE1 sing N N 338 PHE CE2 CZ sing Y N 339 PHE CE2 HE2 sing N N 340 PHE CZ HZ sing N N 341 PHE OXT HXT sing N N 342 PRO N CA sing N N 343 PRO N CD sing N N 344 PRO N H sing N N 345 PRO CA C sing N N 346 PRO CA CB sing N N 347 PRO CA HA sing N N 348 PRO C O doub N N 349 PRO C OXT sing N N 350 PRO CB CG sing N N 351 PRO CB HB2 sing N N 352 PRO CB HB3 sing N N 353 PRO CG CD sing N N 354 PRO CG HG2 sing N N 355 PRO CG HG3 sing N N 356 PRO CD HD2 sing N N 357 PRO CD HD3 sing N N 358 PRO OXT HXT sing N N 359 SER N CA sing N N 360 SER N H sing N N 361 SER N H2 sing N N 362 SER CA C sing N N 363 SER CA CB sing N N 364 SER CA HA sing N N 365 SER C O doub N N 366 SER C OXT sing N N 367 SER CB OG sing N N 368 SER CB HB2 sing N N 369 SER CB HB3 sing N N 370 SER OG HG sing N N 371 SER OXT HXT sing N N 372 THR N CA sing N N 373 THR N H sing N N 374 THR N H2 sing N N 375 THR CA C sing N N 376 THR CA CB sing N N 377 THR CA HA sing N N 378 THR C O doub N N 379 THR C OXT sing N N 380 THR CB OG1 sing N N 381 THR CB CG2 sing N N 382 THR CB HB sing N N 383 THR OG1 HG1 sing N N 384 THR CG2 HG21 sing N N 385 THR CG2 HG22 sing N N 386 THR CG2 HG23 sing N N 387 THR OXT HXT sing N N 388 TRP N CA sing N N 389 TRP N H sing N N 390 TRP N H2 sing N N 391 TRP CA C sing N N 392 TRP CA CB sing N N 393 TRP CA HA sing N N 394 TRP C O doub N N 395 TRP C OXT sing N N 396 TRP CB CG sing N N 397 TRP CB HB2 sing N N 398 TRP CB HB3 sing N N 399 TRP CG CD1 doub Y N 400 TRP CG CD2 sing Y N 401 TRP CD1 NE1 sing Y N 402 TRP CD1 HD1 sing N N 403 TRP CD2 CE2 doub Y N 404 TRP CD2 CE3 sing Y N 405 TRP NE1 CE2 sing Y N 406 TRP NE1 HE1 sing N N 407 TRP CE2 CZ2 sing Y N 408 TRP CE3 CZ3 doub Y N 409 TRP CE3 HE3 sing N N 410 TRP CZ2 CH2 doub Y N 411 TRP CZ2 HZ2 sing N N 412 TRP CZ3 CH2 sing Y N 413 TRP CZ3 HZ3 sing N N 414 TRP CH2 HH2 sing N N 415 TRP OXT HXT sing N N 416 TYR N CA sing N N 417 TYR N H sing N N 418 TYR N H2 sing N N 419 TYR CA C sing N N 420 TYR CA CB sing N N 421 TYR CA HA sing N N 422 TYR C O doub N N 423 TYR C OXT sing N N 424 TYR CB CG sing N N 425 TYR CB HB2 sing N N 426 TYR CB HB3 sing N N 427 TYR CG CD1 doub Y N 428 TYR CG CD2 sing Y N 429 TYR CD1 CE1 sing Y N 430 TYR CD1 HD1 sing N N 431 TYR CD2 CE2 doub Y N 432 TYR CD2 HD2 sing N N 433 TYR CE1 CZ doub Y N 434 TYR CE1 HE1 sing N N 435 TYR CE2 CZ sing Y N 436 TYR CE2 HE2 sing N N 437 TYR CZ OH sing N N 438 TYR OH HH sing N N 439 TYR OXT HXT sing N N 440 VAL N CA sing N N 441 VAL N H sing N N 442 VAL N H2 sing N N 443 VAL CA C sing N N 444 VAL CA CB sing N N 445 VAL CA HA sing N N 446 VAL C O doub N N 447 VAL C OXT sing N N 448 VAL CB CG1 sing N N 449 VAL CB CG2 sing N N 450 VAL CB HB sing N N 451 VAL CG1 HG11 sing N N 452 VAL CG1 HG12 sing N N 453 VAL CG1 HG13 sing N N 454 VAL CG2 HG21 sing N N 455 VAL CG2 HG22 sing N N 456 VAL CG2 HG23 sing N N 457 VAL OXT HXT sing N N 458 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Cancer Institute (NIH/NCI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id NQV _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id NQV _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name ;4-{[(3R)-4-cyclopentyl-1,3-dimethyl-2-oxo-1,2,3,4-tetrahydropyrido[2,3-b]pyrazin-6-yl]amino}-N-(1-methylpiperidin-4-yl)-3-[(propan-2-yl)oxy]benzamide ; _pdbx_entity_nonpoly.comp_id NQV # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3UV5 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #