data_6P5E # _entry.id 6P5E # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6P5E pdb_00006p5e 10.2210/pdb6p5e/pdb WWPDB D_1000241915 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6P5E _pdbx_database_status.recvd_initial_deposition_date 2019-05-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Pandey, S.' 1 ? 'Schmidt, M.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nat.Methods _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1548-7105 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 17 _citation.language ? _citation.page_first 73 _citation.page_last 78 _citation.title 'Time-resolved serial femtosecond crystallography at the European XFEL.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41592-019-0628-z _citation.pdbx_database_id_PubMed 31740816 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pandey, S.' 1 ? primary 'Bean, R.' 2 ? primary 'Sato, T.' 3 ? primary 'Poudyal, I.' 4 ? primary 'Bielecki, J.' 5 ? primary 'Cruz Villarreal, J.' 6 0000-0002-6762-7348 primary 'Yefanov, O.' 7 ? primary 'Mariani, V.' 8 ? primary 'White, T.A.' 9 0000-0002-8407-0270 primary 'Kupitz, C.' 10 ? primary 'Hunter, M.' 11 ? primary 'Abdellatif, M.H.' 12 0000-0002-3194-7411 primary 'Bajt, S.' 13 0000-0002-7163-7602 primary 'Bondar, V.' 14 ? primary 'Echelmeier, A.' 15 0000-0001-6127-3879 primary 'Doppler, D.' 16 ? primary 'Emons, M.' 17 ? primary 'Frank, M.' 18 0000-0002-5244-0791 primary 'Fromme, R.' 19 0000-0003-4835-1080 primary 'Gevorkov, Y.' 20 0000-0001-9273-7648 primary 'Giovanetti, G.' 21 0000-0002-4804-7006 primary 'Jiang, M.' 22 ? primary 'Kim, D.' 23 ? primary 'Kim, Y.' 24 ? primary 'Kirkwood, H.' 25 0000-0001-6792-3844 primary 'Klimovskaia, A.' 26 ? primary 'Knoska, J.' 27 ? primary 'Koua, F.H.M.' 28 ? primary 'Letrun, R.' 29 0000-0002-0569-5193 primary 'Lisova, S.' 30 ? primary 'Maia, L.' 31 ? primary 'Mazalova, V.' 32 0000-0003-2613-7868 primary 'Meza, D.' 33 ? primary 'Michelat, T.' 34 0000-0002-5689-8759 primary 'Ourmazd, A.' 35 0000-0001-9946-3889 primary 'Palmer, G.' 36 ? primary 'Ramilli, M.' 37 ? primary 'Schubert, R.' 38 0000-0002-6213-2872 primary 'Schwander, P.' 39 ? primary 'Silenzi, A.' 40 ? primary 'Sztuk-Dambietz, J.' 41 ? primary 'Tolstikova, A.' 42 ? primary 'Chapman, H.N.' 43 0000-0002-4655-1743 primary 'Ros, A.' 44 0000-0001-7709-8331 primary 'Barty, A.' 45 ? primary 'Fromme, P.' 46 ? primary 'Mancuso, A.P.' 47 ? primary 'Schmidt, M.' 48 0000-0002-0962-9468 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6P5E _cell.details ? _cell.formula_units_Z ? _cell.length_a 66.900 _cell.length_a_esd ? _cell.length_b 66.900 _cell.length_b_esd ? _cell.length_c 40.800 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6P5E _symmetry.cell_setting ? _symmetry.Int_Tables_number 173 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 63' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Photoactive yellow protein' 14034.718 1 ? ? ? ? 2 water nat water 18.015 92 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name PYP # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAP(60F)TDSPEFY GKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV ; _entity_poly.pdbx_seq_one_letter_code_can ;MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPXTDSPEFYGKFK EGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 HIS n 1 4 VAL n 1 5 ALA n 1 6 PHE n 1 7 GLY n 1 8 SER n 1 9 GLU n 1 10 ASP n 1 11 ILE n 1 12 GLU n 1 13 ASN n 1 14 THR n 1 15 LEU n 1 16 ALA n 1 17 LYS n 1 18 MET n 1 19 ASP n 1 20 ASP n 1 21 GLY n 1 22 GLN n 1 23 LEU n 1 24 ASP n 1 25 GLY n 1 26 LEU n 1 27 ALA n 1 28 PHE n 1 29 GLY n 1 30 ALA n 1 31 ILE n 1 32 GLN n 1 33 LEU n 1 34 ASP n 1 35 GLY n 1 36 ASP n 1 37 GLY n 1 38 ASN n 1 39 ILE n 1 40 LEU n 1 41 GLN n 1 42 TYR n 1 43 ASN n 1 44 ALA n 1 45 ALA n 1 46 GLU n 1 47 GLY n 1 48 ASP n 1 49 ILE n 1 50 THR n 1 51 GLY n 1 52 ARG n 1 53 ASP n 1 54 PRO n 1 55 LYS n 1 56 GLN n 1 57 VAL n 1 58 ILE n 1 59 GLY n 1 60 LYS n 1 61 ASN n 1 62 PHE n 1 63 PHE n 1 64 LYS n 1 65 ASP n 1 66 VAL n 1 67 ALA n 1 68 PRO n 1 69 60F n 1 70 THR n 1 71 ASP n 1 72 SER n 1 73 PRO n 1 74 GLU n 1 75 PHE n 1 76 TYR n 1 77 GLY n 1 78 LYS n 1 79 PHE n 1 80 LYS n 1 81 GLU n 1 82 GLY n 1 83 VAL n 1 84 ALA n 1 85 SER n 1 86 GLY n 1 87 ASN n 1 88 LEU n 1 89 ASN n 1 90 THR n 1 91 MET n 1 92 PHE n 1 93 GLU n 1 94 TYR n 1 95 THR n 1 96 PHE n 1 97 ASP n 1 98 TYR n 1 99 GLN n 1 100 MET n 1 101 THR n 1 102 PRO n 1 103 THR n 1 104 LYS n 1 105 VAL n 1 106 LYS n 1 107 VAL n 1 108 HIS n 1 109 MET n 1 110 LYS n 1 111 LYS n 1 112 ALA n 1 113 LEU n 1 114 SER n 1 115 GLY n 1 116 ASP n 1 117 SER n 1 118 TYR n 1 119 TRP n 1 120 VAL n 1 121 PHE n 1 122 VAL n 1 123 LYS n 1 124 ARG n 1 125 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 125 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene pyp _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Halorhodospira halophila' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1053 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PYP_HALHA _struct_ref.pdbx_db_accession P16113 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFK EGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6P5E _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 125 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P16113 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 125 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 125 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 60F 'L-peptide linking' n '(2~{R})-2-azanyl-3-[(~{E})-3-(4-hydroxyphenyl)prop-2-enoyl]sulfanyl-propanoic acid' ? 'C12 H13 N O4 S' 267.301 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6P5E _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.88 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 34.50 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'SMALL TUBES' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Sodium Malonate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 300 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type AGIPD _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-03-07 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.3 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'FREE ELECTRON LASER' _diffrn_source.target ? _diffrn_source.type 'EUROPEAN XFEL BEAMLINE SPB/SFX' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.3 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline SPB/SFX _diffrn_source.pdbx_synchrotron_site 'European XFEL' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6P5E _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.6 _reflns.d_resolution_low 11.81 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12072 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 91.44 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 156.70 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.30 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.60 _reflns_shell.d_res_low 1.641 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 721 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.03 _refine.aniso_B[1][2] 0.02 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.03 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] -0.10 _refine.B_iso_max ? _refine.B_iso_mean 4.586 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.867 _refine.correlation_coeff_Fo_to_Fc_free 0.810 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6P5E _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.60 _refine.ls_d_res_low 11.81 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12072 _refine.ls_number_reflns_R_free 612 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 91.44 _refine.ls_percent_reflns_R_free 4.8 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.27392 _refine.ls_R_factor_R_free 0.32597 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.27126 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.174 _refine.pdbx_overall_ESU_R_Free 0.166 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 4.636 _refine.overall_SU_ML 0.154 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 1.60 _refine_hist.d_res_low 11.81 _refine_hist.number_atoms_solvent 92 _refine_hist.number_atoms_total 1079 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 987 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.021 0.020 1044 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 967 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.256 1.962 1410 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.967 3.000 2237 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 8.355 5.000 124 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 42.641 25.818 55 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 17.497 15.000 181 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 10.544 15.000 3 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.122 0.200 150 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.011 0.020 1198 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 241 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 0.267 0.465 499 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 0.267 0.466 498 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 0.451 0.697 622 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 0.450 0.697 623 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 0.195 0.439 545 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 0.195 0.439 545 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 0.315 0.658 788 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 1.453 3.527 1226 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 1.012 3.508 1202 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.600 _refine_ls_shell.d_res_low 1.641 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 34 _refine_ls_shell.number_reflns_R_work 721 _refine_ls_shell.percent_reflns_obs 76.11 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.447 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.389 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6P5E _struct.title 'Photoactive Yellow Protein PYP 80ps' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6P5E _struct_keywords.text 'PYP, 10ps, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 10 ? LYS A 17 ? ASP A 10 LYS A 17 1 ? 8 HELX_P HELX_P2 AA2 ASP A 19 ? ASP A 24 ? ASP A 19 ASP A 24 1 ? 6 HELX_P HELX_P3 AA3 ASN A 43 ? GLY A 51 ? ASN A 43 GLY A 51 1 ? 9 HELX_P HELX_P4 AA4 ASP A 53 ? ILE A 58 ? ASP A 53 ILE A 58 1 ? 6 HELX_P HELX_P5 AA5 ALA A 67 ? ASP A 71 ? ALA A 67 ASP A 71 5 ? 5 HELX_P HELX_P6 AA6 PHE A 75 ? GLY A 86 ? PHE A 75 GLY A 86 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A PRO 68 C ? ? ? 1_555 A 60F 69 N ? ? A PRO 68 A 60F 69 1_555 ? ? ? ? ? ? ? 1.311 ? ? covale2 covale both ? A 60F 69 C ? ? ? 1_555 A THR 70 N ? ? A 60F 69 A THR 70 1_555 ? ? ? ? ? ? ? 1.368 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 39 ? TYR A 42 ? ILE A 39 TYR A 42 AA1 2 GLY A 29 ? ASP A 34 ? GLY A 29 ASP A 34 AA1 3 SER A 117 ? ARG A 124 ? SER A 117 ARG A 124 AA1 4 THR A 103 ? LYS A 111 ? THR A 103 LYS A 111 AA1 5 ASN A 89 ? PHE A 96 ? ASN A 89 PHE A 96 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU A 40 ? O LEU A 40 N GLN A 32 ? N GLN A 32 AA1 2 3 N GLY A 29 ? N GLY A 29 O VAL A 122 ? O VAL A 122 AA1 3 4 O TRP A 119 ? O TRP A 119 N LYS A 110 ? N LYS A 110 AA1 4 5 O VAL A 107 ? O VAL A 107 N PHE A 92 ? N PHE A 92 # _atom_sites.entry_id 6P5E _atom_sites.fract_transf_matrix[1][1] 0.014948 _atom_sites.fract_transf_matrix[1][2] 0.008630 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017260 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.024510 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 60F 69 69 69 60F HCC A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 MET 91 91 91 MET MET A . n A 1 92 PHE 92 92 92 PHE PHE A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 TYR 94 94 94 TYR TYR A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 TYR 98 98 98 TYR TYR A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 MET 100 100 100 MET MET A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 HIS 108 108 108 HIS HIS A . n A 1 109 MET 109 109 109 MET MET A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 TRP 119 119 119 TRP TRP A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 PHE 121 121 121 PHE PHE A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 VAL 125 125 125 VAL VAL A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 246 HOH HOH A . B 2 HOH 2 202 244 HOH HOH A . B 2 HOH 3 203 226 HOH HOH A . B 2 HOH 4 204 229 HOH HOH A . B 2 HOH 5 205 257 HOH HOH A . B 2 HOH 6 206 268 HOH HOH A . B 2 HOH 7 207 206 HOH HOH A . B 2 HOH 8 208 284 HOH HOH A . B 2 HOH 9 209 208 HOH HOH A . B 2 HOH 10 210 253 HOH HOH A . B 2 HOH 11 211 290 HOH HOH A . B 2 HOH 12 212 275 HOH HOH A . B 2 HOH 13 213 217 HOH HOH A . B 2 HOH 14 214 225 HOH HOH A . B 2 HOH 15 215 249 HOH HOH A . B 2 HOH 16 216 250 HOH HOH A . B 2 HOH 17 217 224 HOH HOH A . B 2 HOH 18 218 242 HOH HOH A . B 2 HOH 19 219 228 HOH HOH A . B 2 HOH 20 220 278 HOH HOH A . B 2 HOH 21 221 200 HOH HOH A . B 2 HOH 22 222 233 HOH HOH A . B 2 HOH 23 223 239 HOH HOH A . B 2 HOH 24 224 235 HOH HOH A . B 2 HOH 25 225 277 HOH HOH A . B 2 HOH 26 226 221 HOH HOH A . B 2 HOH 27 227 218 HOH HOH A . B 2 HOH 28 228 201 HOH HOH A . B 2 HOH 29 229 223 HOH HOH A . B 2 HOH 30 230 211 HOH HOH A . B 2 HOH 31 231 210 HOH HOH A . B 2 HOH 32 232 254 HOH HOH A . B 2 HOH 33 233 289 HOH HOH A . B 2 HOH 34 234 283 HOH HOH A . B 2 HOH 35 235 260 HOH HOH A . B 2 HOH 36 236 241 HOH HOH A . B 2 HOH 37 237 240 HOH HOH A . B 2 HOH 38 238 212 HOH HOH A . B 2 HOH 39 239 232 HOH HOH A . B 2 HOH 40 240 234 HOH HOH A . B 2 HOH 41 241 237 HOH HOH A . B 2 HOH 42 242 230 HOH HOH A . B 2 HOH 43 243 271 HOH HOH A . B 2 HOH 44 244 274 HOH HOH A . B 2 HOH 45 245 213 HOH HOH A . B 2 HOH 46 246 264 HOH HOH A . B 2 HOH 47 247 216 HOH HOH A . B 2 HOH 48 248 280 HOH HOH A . B 2 HOH 49 249 248 HOH HOH A . B 2 HOH 50 250 222 HOH HOH A . B 2 HOH 51 251 219 HOH HOH A . B 2 HOH 52 252 203 HOH HOH A . B 2 HOH 53 253 272 HOH HOH A . B 2 HOH 54 254 207 HOH HOH A . B 2 HOH 55 255 256 HOH HOH A . B 2 HOH 56 256 245 HOH HOH A . B 2 HOH 57 257 247 HOH HOH A . B 2 HOH 58 258 214 HOH HOH A . B 2 HOH 59 259 236 HOH HOH A . B 2 HOH 60 260 251 HOH HOH A . B 2 HOH 61 261 231 HOH HOH A . B 2 HOH 62 262 255 HOH HOH A . B 2 HOH 63 263 204 HOH HOH A . B 2 HOH 64 264 261 HOH HOH A . B 2 HOH 65 265 243 HOH HOH A . B 2 HOH 66 266 281 HOH HOH A . B 2 HOH 67 267 252 HOH HOH A . B 2 HOH 68 268 287 HOH HOH A . B 2 HOH 69 269 266 HOH HOH A . B 2 HOH 70 270 202 HOH HOH A . B 2 HOH 71 271 269 HOH HOH A . B 2 HOH 72 272 265 HOH HOH A . B 2 HOH 73 273 263 HOH HOH A . B 2 HOH 74 274 282 HOH HOH A . B 2 HOH 75 275 262 HOH HOH A . B 2 HOH 76 276 205 HOH HOH A . B 2 HOH 77 277 267 HOH HOH A . B 2 HOH 78 278 279 HOH HOH A . B 2 HOH 79 279 273 HOH HOH A . B 2 HOH 80 280 285 HOH HOH A . B 2 HOH 81 281 220 HOH HOH A . B 2 HOH 82 282 288 HOH HOH A . B 2 HOH 83 283 258 HOH HOH A . B 2 HOH 84 284 291 HOH HOH A . B 2 HOH 85 285 276 HOH HOH A . B 2 HOH 86 286 259 HOH HOH A . B 2 HOH 87 287 238 HOH HOH A . B 2 HOH 88 288 215 HOH HOH A . B 2 HOH 89 289 227 HOH HOH A . B 2 HOH 90 290 270 HOH HOH A . B 2 HOH 91 291 209 HOH HOH A . B 2 HOH 92 292 286 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id 60F _pdbx_struct_mod_residue.label_seq_id 69 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id 60F _pdbx_struct_mod_residue.auth_seq_id 69 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id CYS _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 6370 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-09-18 2 'Structure model' 1 1 2019-11-27 3 'Structure model' 1 2 2019-12-04 4 'Structure model' 1 3 2020-01-15 5 'Structure model' 1 4 2023-08-16 6 'Structure model' 1 5 2023-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 6 'Structure model' 'Data collection' 7 6 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' citation 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_related_exp_data_set 9 6 'Structure model' chem_comp_atom 10 6 'Structure model' chem_comp_bond 11 6 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_citation.country' 3 3 'Structure model' '_citation.journal_abbrev' 4 3 'Structure model' '_citation.journal_id_CSD' 5 3 'Structure model' '_citation.journal_id_ISSN' 6 3 'Structure model' '_citation.pdbx_database_id_DOI' 7 3 'Structure model' '_citation.pdbx_database_id_PubMed' 8 3 'Structure model' '_citation.title' 9 3 'Structure model' '_citation.year' 10 4 'Structure model' '_citation.journal_volume' 11 4 'Structure model' '_citation.page_first' 12 4 'Structure model' '_citation.page_last' 13 4 'Structure model' '_citation.year' 14 5 'Structure model' '_database_2.pdbx_DOI' 15 5 'Structure model' '_database_2.pdbx_database_accession' 16 6 'Structure model' '_chem_comp_atom.atom_id' 17 6 'Structure model' '_chem_comp_bond.atom_id_1' 18 6 'Structure model' '_chem_comp_bond.atom_id_2' 19 6 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0069 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? CrystFEL ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? CrystFEL ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD2 A ASP 48 ? ? O A HOH 201 ? ? 1.50 2 1 NE2 A GLN 99 ? ? O A HOH 202 ? ? 1.86 3 1 O A HOH 282 ? ? O A HOH 289 ? ? 1.93 4 1 O A HOH 283 ? ? O A HOH 286 ? ? 2.00 5 1 O A ARG 52 ? ? O A HOH 203 ? ? 2.09 6 1 OE1 A GLN 99 ? ? O A HOH 204 ? ? 2.10 7 1 O A HOH 234 ? ? O A HOH 246 ? ? 2.19 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 273 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 273 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 3_555 _pdbx_validate_symm_contact.dist 1.43 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 75 ? ? -120.17 -77.66 2 1 ASP A 97 ? ? -152.01 21.34 3 1 ASP A 116 ? ? -105.26 69.19 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 SER _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 114 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 GLY _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 115 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 135.74 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 60F C1 C N N 1 60F C2 C N N 2 60F C3 C N N 3 60F O1 O N N 4 60F "C1'" C Y N 5 60F "C6'" C Y N 6 60F "C5'" C Y N 7 60F "C4'" C Y N 8 60F "O4'" O N N 9 60F "C3'" C Y N 10 60F "C2'" C Y N 11 60F N N N N 12 60F CA C N R 13 60F CB C N N 14 60F SG S N N 15 60F C C N N 16 60F O O N N 17 60F H1 H N N 18 60F H10 H N N 19 60F H3 H N N 20 60F H4 H N N 21 60F H5 H N N 22 60F H6 H N N 23 60F H7 H N N 24 60F H H N N 25 60F H2 H N N 26 60F HA H N N 27 60F H12 H N N 28 60F H13 H N N 29 60F OXT O N N 30 60F HXT H N N 31 ALA N N N N 32 ALA CA C N S 33 ALA C C N N 34 ALA O O N N 35 ALA CB C N N 36 ALA OXT O N N 37 ALA H H N N 38 ALA H2 H N N 39 ALA HA H N N 40 ALA HB1 H N N 41 ALA HB2 H N N 42 ALA HB3 H N N 43 ALA HXT H N N 44 ARG N N N N 45 ARG CA C N S 46 ARG C C N N 47 ARG O O N N 48 ARG CB C N N 49 ARG CG C N N 50 ARG CD C N N 51 ARG NE N N N 52 ARG CZ C N N 53 ARG NH1 N N N 54 ARG NH2 N N N 55 ARG OXT O N N 56 ARG H H N N 57 ARG H2 H N N 58 ARG HA H N N 59 ARG HB2 H N N 60 ARG HB3 H N N 61 ARG HG2 H N N 62 ARG HG3 H N N 63 ARG HD2 H N N 64 ARG HD3 H N N 65 ARG HE H N N 66 ARG HH11 H N N 67 ARG HH12 H N N 68 ARG HH21 H N N 69 ARG HH22 H N N 70 ARG HXT H N N 71 ASN N N N N 72 ASN CA C N S 73 ASN C C N N 74 ASN O O N N 75 ASN CB C N N 76 ASN CG C N N 77 ASN OD1 O N N 78 ASN ND2 N N N 79 ASN OXT O N N 80 ASN H H N N 81 ASN H2 H N N 82 ASN HA H N N 83 ASN HB2 H N N 84 ASN HB3 H N N 85 ASN HD21 H N N 86 ASN HD22 H N N 87 ASN HXT H N N 88 ASP N N N N 89 ASP CA C N S 90 ASP C C N N 91 ASP O O N N 92 ASP CB C N N 93 ASP CG C N N 94 ASP OD1 O N N 95 ASP OD2 O N N 96 ASP OXT O N N 97 ASP H H N N 98 ASP H2 H N N 99 ASP HA H N N 100 ASP HB2 H N N 101 ASP HB3 H N N 102 ASP HD2 H N N 103 ASP HXT H N N 104 GLN N N N N 105 GLN CA C N S 106 GLN C C N N 107 GLN O O N N 108 GLN CB C N N 109 GLN CG C N N 110 GLN CD C N N 111 GLN OE1 O N N 112 GLN NE2 N N N 113 GLN OXT O N N 114 GLN H H N N 115 GLN H2 H N N 116 GLN HA H N N 117 GLN HB2 H N N 118 GLN HB3 H N N 119 GLN HG2 H N N 120 GLN HG3 H N N 121 GLN HE21 H N N 122 GLN HE22 H N N 123 GLN HXT H N N 124 GLU N N N N 125 GLU CA C N S 126 GLU C C N N 127 GLU O O N N 128 GLU CB C N N 129 GLU CG C N N 130 GLU CD C N N 131 GLU OE1 O N N 132 GLU OE2 O N N 133 GLU OXT O N N 134 GLU H H N N 135 GLU H2 H N N 136 GLU HA H N N 137 GLU HB2 H N N 138 GLU HB3 H N N 139 GLU HG2 H N N 140 GLU HG3 H N N 141 GLU HE2 H N N 142 GLU HXT H N N 143 GLY N N N N 144 GLY CA C N N 145 GLY C C N N 146 GLY O O N N 147 GLY OXT O N N 148 GLY H H N N 149 GLY H2 H N N 150 GLY HA2 H N N 151 GLY HA3 H N N 152 GLY HXT H N N 153 HIS N N N N 154 HIS CA C N S 155 HIS C C N N 156 HIS O O N N 157 HIS CB C N N 158 HIS CG C Y N 159 HIS ND1 N Y N 160 HIS CD2 C Y N 161 HIS CE1 C Y N 162 HIS NE2 N Y N 163 HIS OXT O N N 164 HIS H H N N 165 HIS H2 H N N 166 HIS HA H N N 167 HIS HB2 H N N 168 HIS HB3 H N N 169 HIS HD1 H N N 170 HIS HD2 H N N 171 HIS HE1 H N N 172 HIS HE2 H N N 173 HIS HXT H N N 174 HOH O O N N 175 HOH H1 H N N 176 HOH H2 H N N 177 ILE N N N N 178 ILE CA C N S 179 ILE C C N N 180 ILE O O N N 181 ILE CB C N S 182 ILE CG1 C N N 183 ILE CG2 C N N 184 ILE CD1 C N N 185 ILE OXT O N N 186 ILE H H N N 187 ILE H2 H N N 188 ILE HA H N N 189 ILE HB H N N 190 ILE HG12 H N N 191 ILE HG13 H N N 192 ILE HG21 H N N 193 ILE HG22 H N N 194 ILE HG23 H N N 195 ILE HD11 H N N 196 ILE HD12 H N N 197 ILE HD13 H N N 198 ILE HXT H N N 199 LEU N N N N 200 LEU CA C N S 201 LEU C C N N 202 LEU O O N N 203 LEU CB C N N 204 LEU CG C N N 205 LEU CD1 C N N 206 LEU CD2 C N N 207 LEU OXT O N N 208 LEU H H N N 209 LEU H2 H N N 210 LEU HA H N N 211 LEU HB2 H N N 212 LEU HB3 H N N 213 LEU HG H N N 214 LEU HD11 H N N 215 LEU HD12 H N N 216 LEU HD13 H N N 217 LEU HD21 H N N 218 LEU HD22 H N N 219 LEU HD23 H N N 220 LEU HXT H N N 221 LYS N N N N 222 LYS CA C N S 223 LYS C C N N 224 LYS O O N N 225 LYS CB C N N 226 LYS CG C N N 227 LYS CD C N N 228 LYS CE C N N 229 LYS NZ N N N 230 LYS OXT O N N 231 LYS H H N N 232 LYS H2 H N N 233 LYS HA H N N 234 LYS HB2 H N N 235 LYS HB3 H N N 236 LYS HG2 H N N 237 LYS HG3 H N N 238 LYS HD2 H N N 239 LYS HD3 H N N 240 LYS HE2 H N N 241 LYS HE3 H N N 242 LYS HZ1 H N N 243 LYS HZ2 H N N 244 LYS HZ3 H N N 245 LYS HXT H N N 246 MET N N N N 247 MET CA C N S 248 MET C C N N 249 MET O O N N 250 MET CB C N N 251 MET CG C N N 252 MET SD S N N 253 MET CE C N N 254 MET OXT O N N 255 MET H H N N 256 MET H2 H N N 257 MET HA H N N 258 MET HB2 H N N 259 MET HB3 H N N 260 MET HG2 H N N 261 MET HG3 H N N 262 MET HE1 H N N 263 MET HE2 H N N 264 MET HE3 H N N 265 MET HXT H N N 266 PHE N N N N 267 PHE CA C N S 268 PHE C C N N 269 PHE O O N N 270 PHE CB C N N 271 PHE CG C Y N 272 PHE CD1 C Y N 273 PHE CD2 C Y N 274 PHE CE1 C Y N 275 PHE CE2 C Y N 276 PHE CZ C Y N 277 PHE OXT O N N 278 PHE H H N N 279 PHE H2 H N N 280 PHE HA H N N 281 PHE HB2 H N N 282 PHE HB3 H N N 283 PHE HD1 H N N 284 PHE HD2 H N N 285 PHE HE1 H N N 286 PHE HE2 H N N 287 PHE HZ H N N 288 PHE HXT H N N 289 PRO N N N N 290 PRO CA C N S 291 PRO C C N N 292 PRO O O N N 293 PRO CB C N N 294 PRO CG C N N 295 PRO CD C N N 296 PRO OXT O N N 297 PRO H H N N 298 PRO HA H N N 299 PRO HB2 H N N 300 PRO HB3 H N N 301 PRO HG2 H N N 302 PRO HG3 H N N 303 PRO HD2 H N N 304 PRO HD3 H N N 305 PRO HXT H N N 306 SER N N N N 307 SER CA C N S 308 SER C C N N 309 SER O O N N 310 SER CB C N N 311 SER OG O N N 312 SER OXT O N N 313 SER H H N N 314 SER H2 H N N 315 SER HA H N N 316 SER HB2 H N N 317 SER HB3 H N N 318 SER HG H N N 319 SER HXT H N N 320 THR N N N N 321 THR CA C N S 322 THR C C N N 323 THR O O N N 324 THR CB C N R 325 THR OG1 O N N 326 THR CG2 C N N 327 THR OXT O N N 328 THR H H N N 329 THR H2 H N N 330 THR HA H N N 331 THR HB H N N 332 THR HG1 H N N 333 THR HG21 H N N 334 THR HG22 H N N 335 THR HG23 H N N 336 THR HXT H N N 337 TRP N N N N 338 TRP CA C N S 339 TRP C C N N 340 TRP O O N N 341 TRP CB C N N 342 TRP CG C Y N 343 TRP CD1 C Y N 344 TRP CD2 C Y N 345 TRP NE1 N Y N 346 TRP CE2 C Y N 347 TRP CE3 C Y N 348 TRP CZ2 C Y N 349 TRP CZ3 C Y N 350 TRP CH2 C Y N 351 TRP OXT O N N 352 TRP H H N N 353 TRP H2 H N N 354 TRP HA H N N 355 TRP HB2 H N N 356 TRP HB3 H N N 357 TRP HD1 H N N 358 TRP HE1 H N N 359 TRP HE3 H N N 360 TRP HZ2 H N N 361 TRP HZ3 H N N 362 TRP HH2 H N N 363 TRP HXT H N N 364 TYR N N N N 365 TYR CA C N S 366 TYR C C N N 367 TYR O O N N 368 TYR CB C N N 369 TYR CG C Y N 370 TYR CD1 C Y N 371 TYR CD2 C Y N 372 TYR CE1 C Y N 373 TYR CE2 C Y N 374 TYR CZ C Y N 375 TYR OH O N N 376 TYR OXT O N N 377 TYR H H N N 378 TYR H2 H N N 379 TYR HA H N N 380 TYR HB2 H N N 381 TYR HB3 H N N 382 TYR HD1 H N N 383 TYR HD2 H N N 384 TYR HE1 H N N 385 TYR HE2 H N N 386 TYR HH H N N 387 TYR HXT H N N 388 VAL N N N N 389 VAL CA C N S 390 VAL C C N N 391 VAL O O N N 392 VAL CB C N N 393 VAL CG1 C N N 394 VAL CG2 C N N 395 VAL OXT O N N 396 VAL H H N N 397 VAL H2 H N N 398 VAL HA H N N 399 VAL HB H N N 400 VAL HG11 H N N 401 VAL HG12 H N N 402 VAL HG13 H N N 403 VAL HG21 H N N 404 VAL HG22 H N N 405 VAL HG23 H N N 406 VAL HXT H N N 407 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 60F N CA sing N N 1 60F O1 C1 doub N N 2 60F CA CB sing N N 3 60F CA C sing N N 4 60F CB SG sing N N 5 60F "C2'" "C3'" doub Y N 6 60F "C2'" "C1'" sing Y N 7 60F C1 C2 sing N N 8 60F C1 SG sing N N 9 60F C3 C2 doub N E 10 60F C3 "C1'" sing N N 11 60F "C3'" "C4'" sing Y N 12 60F C O doub N N 13 60F "C1'" "C6'" doub Y N 14 60F "C4'" "O4'" sing N N 15 60F "C4'" "C5'" doub Y N 16 60F "C6'" "C5'" sing Y N 17 60F C2 H1 sing N N 18 60F C3 H10 sing N N 19 60F "C6'" H3 sing N N 20 60F "C5'" H4 sing N N 21 60F "O4'" H5 sing N N 22 60F "C3'" H6 sing N N 23 60F "C2'" H7 sing N N 24 60F N H sing N N 25 60F N H2 sing N N 26 60F CA HA sing N N 27 60F CB H12 sing N N 28 60F CB H13 sing N N 29 60F C OXT sing N N 30 60F OXT HXT sing N N 31 ALA N CA sing N N 32 ALA N H sing N N 33 ALA N H2 sing N N 34 ALA CA C sing N N 35 ALA CA CB sing N N 36 ALA CA HA sing N N 37 ALA C O doub N N 38 ALA C OXT sing N N 39 ALA CB HB1 sing N N 40 ALA CB HB2 sing N N 41 ALA CB HB3 sing N N 42 ALA OXT HXT sing N N 43 ARG N CA sing N N 44 ARG N H sing N N 45 ARG N H2 sing N N 46 ARG CA C sing N N 47 ARG CA CB sing N N 48 ARG CA HA sing N N 49 ARG C O doub N N 50 ARG C OXT sing N N 51 ARG CB CG sing N N 52 ARG CB HB2 sing N N 53 ARG CB HB3 sing N N 54 ARG CG CD sing N N 55 ARG CG HG2 sing N N 56 ARG CG HG3 sing N N 57 ARG CD NE sing N N 58 ARG CD HD2 sing N N 59 ARG CD HD3 sing N N 60 ARG NE CZ sing N N 61 ARG NE HE sing N N 62 ARG CZ NH1 sing N N 63 ARG CZ NH2 doub N N 64 ARG NH1 HH11 sing N N 65 ARG NH1 HH12 sing N N 66 ARG NH2 HH21 sing N N 67 ARG NH2 HH22 sing N N 68 ARG OXT HXT sing N N 69 ASN N CA sing N N 70 ASN N H sing N N 71 ASN N H2 sing N N 72 ASN CA C sing N N 73 ASN CA CB sing N N 74 ASN CA HA sing N N 75 ASN C O doub N N 76 ASN C OXT sing N N 77 ASN CB CG sing N N 78 ASN CB HB2 sing N N 79 ASN CB HB3 sing N N 80 ASN CG OD1 doub N N 81 ASN CG ND2 sing N N 82 ASN ND2 HD21 sing N N 83 ASN ND2 HD22 sing N N 84 ASN OXT HXT sing N N 85 ASP N CA sing N N 86 ASP N H sing N N 87 ASP N H2 sing N N 88 ASP CA C sing N N 89 ASP CA CB sing N N 90 ASP CA HA sing N N 91 ASP C O doub N N 92 ASP C OXT sing N N 93 ASP CB CG sing N N 94 ASP CB HB2 sing N N 95 ASP CB HB3 sing N N 96 ASP CG OD1 doub N N 97 ASP CG OD2 sing N N 98 ASP OD2 HD2 sing N N 99 ASP OXT HXT sing N N 100 GLN N CA sing N N 101 GLN N H sing N N 102 GLN N H2 sing N N 103 GLN CA C sing N N 104 GLN CA CB sing N N 105 GLN CA HA sing N N 106 GLN C O doub N N 107 GLN C OXT sing N N 108 GLN CB CG sing N N 109 GLN CB HB2 sing N N 110 GLN CB HB3 sing N N 111 GLN CG CD sing N N 112 GLN CG HG2 sing N N 113 GLN CG HG3 sing N N 114 GLN CD OE1 doub N N 115 GLN CD NE2 sing N N 116 GLN NE2 HE21 sing N N 117 GLN NE2 HE22 sing N N 118 GLN OXT HXT sing N N 119 GLU N CA sing N N 120 GLU N H sing N N 121 GLU N H2 sing N N 122 GLU CA C sing N N 123 GLU CA CB sing N N 124 GLU CA HA sing N N 125 GLU C O doub N N 126 GLU C OXT sing N N 127 GLU CB CG sing N N 128 GLU CB HB2 sing N N 129 GLU CB HB3 sing N N 130 GLU CG CD sing N N 131 GLU CG HG2 sing N N 132 GLU CG HG3 sing N N 133 GLU CD OE1 doub N N 134 GLU CD OE2 sing N N 135 GLU OE2 HE2 sing N N 136 GLU OXT HXT sing N N 137 GLY N CA sing N N 138 GLY N H sing N N 139 GLY N H2 sing N N 140 GLY CA C sing N N 141 GLY CA HA2 sing N N 142 GLY CA HA3 sing N N 143 GLY C O doub N N 144 GLY C OXT sing N N 145 GLY OXT HXT sing N N 146 HIS N CA sing N N 147 HIS N H sing N N 148 HIS N H2 sing N N 149 HIS CA C sing N N 150 HIS CA CB sing N N 151 HIS CA HA sing N N 152 HIS C O doub N N 153 HIS C OXT sing N N 154 HIS CB CG sing N N 155 HIS CB HB2 sing N N 156 HIS CB HB3 sing N N 157 HIS CG ND1 sing Y N 158 HIS CG CD2 doub Y N 159 HIS ND1 CE1 doub Y N 160 HIS ND1 HD1 sing N N 161 HIS CD2 NE2 sing Y N 162 HIS CD2 HD2 sing N N 163 HIS CE1 NE2 sing Y N 164 HIS CE1 HE1 sing N N 165 HIS NE2 HE2 sing N N 166 HIS OXT HXT sing N N 167 HOH O H1 sing N N 168 HOH O H2 sing N N 169 ILE N CA sing N N 170 ILE N H sing N N 171 ILE N H2 sing N N 172 ILE CA C sing N N 173 ILE CA CB sing N N 174 ILE CA HA sing N N 175 ILE C O doub N N 176 ILE C OXT sing N N 177 ILE CB CG1 sing N N 178 ILE CB CG2 sing N N 179 ILE CB HB sing N N 180 ILE CG1 CD1 sing N N 181 ILE CG1 HG12 sing N N 182 ILE CG1 HG13 sing N N 183 ILE CG2 HG21 sing N N 184 ILE CG2 HG22 sing N N 185 ILE CG2 HG23 sing N N 186 ILE CD1 HD11 sing N N 187 ILE CD1 HD12 sing N N 188 ILE CD1 HD13 sing N N 189 ILE OXT HXT sing N N 190 LEU N CA sing N N 191 LEU N H sing N N 192 LEU N H2 sing N N 193 LEU CA C sing N N 194 LEU CA CB sing N N 195 LEU CA HA sing N N 196 LEU C O doub N N 197 LEU C OXT sing N N 198 LEU CB CG sing N N 199 LEU CB HB2 sing N N 200 LEU CB HB3 sing N N 201 LEU CG CD1 sing N N 202 LEU CG CD2 sing N N 203 LEU CG HG sing N N 204 LEU CD1 HD11 sing N N 205 LEU CD1 HD12 sing N N 206 LEU CD1 HD13 sing N N 207 LEU CD2 HD21 sing N N 208 LEU CD2 HD22 sing N N 209 LEU CD2 HD23 sing N N 210 LEU OXT HXT sing N N 211 LYS N CA sing N N 212 LYS N H sing N N 213 LYS N H2 sing N N 214 LYS CA C sing N N 215 LYS CA CB sing N N 216 LYS CA HA sing N N 217 LYS C O doub N N 218 LYS C OXT sing N N 219 LYS CB CG sing N N 220 LYS CB HB2 sing N N 221 LYS CB HB3 sing N N 222 LYS CG CD sing N N 223 LYS CG HG2 sing N N 224 LYS CG HG3 sing N N 225 LYS CD CE sing N N 226 LYS CD HD2 sing N N 227 LYS CD HD3 sing N N 228 LYS CE NZ sing N N 229 LYS CE HE2 sing N N 230 LYS CE HE3 sing N N 231 LYS NZ HZ1 sing N N 232 LYS NZ HZ2 sing N N 233 LYS NZ HZ3 sing N N 234 LYS OXT HXT sing N N 235 MET N CA sing N N 236 MET N H sing N N 237 MET N H2 sing N N 238 MET CA C sing N N 239 MET CA CB sing N N 240 MET CA HA sing N N 241 MET C O doub N N 242 MET C OXT sing N N 243 MET CB CG sing N N 244 MET CB HB2 sing N N 245 MET CB HB3 sing N N 246 MET CG SD sing N N 247 MET CG HG2 sing N N 248 MET CG HG3 sing N N 249 MET SD CE sing N N 250 MET CE HE1 sing N N 251 MET CE HE2 sing N N 252 MET CE HE3 sing N N 253 MET OXT HXT sing N N 254 PHE N CA sing N N 255 PHE N H sing N N 256 PHE N H2 sing N N 257 PHE CA C sing N N 258 PHE CA CB sing N N 259 PHE CA HA sing N N 260 PHE C O doub N N 261 PHE C OXT sing N N 262 PHE CB CG sing N N 263 PHE CB HB2 sing N N 264 PHE CB HB3 sing N N 265 PHE CG CD1 doub Y N 266 PHE CG CD2 sing Y N 267 PHE CD1 CE1 sing Y N 268 PHE CD1 HD1 sing N N 269 PHE CD2 CE2 doub Y N 270 PHE CD2 HD2 sing N N 271 PHE CE1 CZ doub Y N 272 PHE CE1 HE1 sing N N 273 PHE CE2 CZ sing Y N 274 PHE CE2 HE2 sing N N 275 PHE CZ HZ sing N N 276 PHE OXT HXT sing N N 277 PRO N CA sing N N 278 PRO N CD sing N N 279 PRO N H sing N N 280 PRO CA C sing N N 281 PRO CA CB sing N N 282 PRO CA HA sing N N 283 PRO C O doub N N 284 PRO C OXT sing N N 285 PRO CB CG sing N N 286 PRO CB HB2 sing N N 287 PRO CB HB3 sing N N 288 PRO CG CD sing N N 289 PRO CG HG2 sing N N 290 PRO CG HG3 sing N N 291 PRO CD HD2 sing N N 292 PRO CD HD3 sing N N 293 PRO OXT HXT sing N N 294 SER N CA sing N N 295 SER N H sing N N 296 SER N H2 sing N N 297 SER CA C sing N N 298 SER CA CB sing N N 299 SER CA HA sing N N 300 SER C O doub N N 301 SER C OXT sing N N 302 SER CB OG sing N N 303 SER CB HB2 sing N N 304 SER CB HB3 sing N N 305 SER OG HG sing N N 306 SER OXT HXT sing N N 307 THR N CA sing N N 308 THR N H sing N N 309 THR N H2 sing N N 310 THR CA C sing N N 311 THR CA CB sing N N 312 THR CA HA sing N N 313 THR C O doub N N 314 THR C OXT sing N N 315 THR CB OG1 sing N N 316 THR CB CG2 sing N N 317 THR CB HB sing N N 318 THR OG1 HG1 sing N N 319 THR CG2 HG21 sing N N 320 THR CG2 HG22 sing N N 321 THR CG2 HG23 sing N N 322 THR OXT HXT sing N N 323 TRP N CA sing N N 324 TRP N H sing N N 325 TRP N H2 sing N N 326 TRP CA C sing N N 327 TRP CA CB sing N N 328 TRP CA HA sing N N 329 TRP C O doub N N 330 TRP C OXT sing N N 331 TRP CB CG sing N N 332 TRP CB HB2 sing N N 333 TRP CB HB3 sing N N 334 TRP CG CD1 doub Y N 335 TRP CG CD2 sing Y N 336 TRP CD1 NE1 sing Y N 337 TRP CD1 HD1 sing N N 338 TRP CD2 CE2 doub Y N 339 TRP CD2 CE3 sing Y N 340 TRP NE1 CE2 sing Y N 341 TRP NE1 HE1 sing N N 342 TRP CE2 CZ2 sing Y N 343 TRP CE3 CZ3 doub Y N 344 TRP CE3 HE3 sing N N 345 TRP CZ2 CH2 doub Y N 346 TRP CZ2 HZ2 sing N N 347 TRP CZ3 CH2 sing Y N 348 TRP CZ3 HZ3 sing N N 349 TRP CH2 HH2 sing N N 350 TRP OXT HXT sing N N 351 TYR N CA sing N N 352 TYR N H sing N N 353 TYR N H2 sing N N 354 TYR CA C sing N N 355 TYR CA CB sing N N 356 TYR CA HA sing N N 357 TYR C O doub N N 358 TYR C OXT sing N N 359 TYR CB CG sing N N 360 TYR CB HB2 sing N N 361 TYR CB HB3 sing N N 362 TYR CG CD1 doub Y N 363 TYR CG CD2 sing Y N 364 TYR CD1 CE1 sing Y N 365 TYR CD1 HD1 sing N N 366 TYR CD2 CE2 doub Y N 367 TYR CD2 HD2 sing N N 368 TYR CE1 CZ doub Y N 369 TYR CE1 HE1 sing N N 370 TYR CE2 CZ sing Y N 371 TYR CE2 HE2 sing N N 372 TYR CZ OH sing N N 373 TYR OH HH sing N N 374 TYR OXT HXT sing N N 375 VAL N CA sing N N 376 VAL N H sing N N 377 VAL N H2 sing N N 378 VAL CA C sing N N 379 VAL CA CB sing N N 380 VAL CA HA sing N N 381 VAL C O doub N N 382 VAL C OXT sing N N 383 VAL CB CG1 sing N N 384 VAL CB CG2 sing N N 385 VAL CB HB sing N N 386 VAL CG1 HG11 sing N N 387 VAL CG1 HG12 sing N N 388 VAL CG1 HG13 sing N N 389 VAL CG2 HG21 sing N N 390 VAL CG2 HG22 sing N N 391 VAL CG2 HG23 sing N N 392 VAL OXT HXT sing N N 393 # _pdbx_audit_support.funding_organization 'National Science Foundation (NSF, United States)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 1231306 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 60F _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 60F _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_related_exp_data_set.ordinal 1 _pdbx_related_exp_data_set.data_set_type 'diffraction image data' _pdbx_related_exp_data_set.data_reference 10.11577/1577287 _pdbx_related_exp_data_set.metadata_reference ? _pdbx_related_exp_data_set.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #