data_6P7F # _entry.id 6P7F # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6P7F pdb_00006p7f 10.2210/pdb6p7f/pdb WWPDB D_1000241904 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 6BZR _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6P7F _pdbx_database_status.recvd_initial_deposition_date 2019-06-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zheng, A.' 1 ? 'Thibodeau, P.H.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structures of human ABCC6 NBD1 and NBD2' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zheng, A.' 1 ? primary 'Thibodeau, P.H.' 2 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6P7F _cell.details ? _cell.formula_units_Z ? _cell.length_a 99.340 _cell.length_a_esd ? _cell.length_b 99.340 _cell.length_b_esd ? _cell.length_c 84.000 _cell.length_c_esd ? _cell.volume 828948.590 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6P7F _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall 'P 4abw 2nw' _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Multidrug resistance-associated protein 6' 27003.279 1 ? R1459D 'residues 1254-1503' ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;ATP-binding cassette sub-family C member 6,Anthracycline resistance-associated protein,Multi-specific organic anion transporter E,MOAT-E ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AAQPPWPQGGQIEFRDFGLRYRPELPLAVQGVSFKIHAGEKVGIVGRTGAGKSSLASGLLRLQEAAEGGIWIDGVPIAHV GLHTLRSRISIIPQDPILFPGSLRMNLDLLQEHSDEAIWAALETVQLKALVASLPGQLQYKCADRGEDLSVGQKQLLCLA RALLRKTQILILDEATAAVDPGTELQMQAMLGSWFAQCTVLLIAHDLRSVMDCARVLVMDKGQVAESGSPAQLLAQKGLF YRLAQESGLV ; _entity_poly.pdbx_seq_one_letter_code_can ;AAQPPWPQGGQIEFRDFGLRYRPELPLAVQGVSFKIHAGEKVGIVGRTGAGKSSLASGLLRLQEAAEGGIWIDGVPIAHV GLHTLRSRISIIPQDPILFPGSLRMNLDLLQEHSDEAIWAALETVQLKALVASLPGQLQYKCADRGEDLSVGQKQLLCLA RALLRKTQILILDEATAAVDPGTELQMQAMLGSWFAQCTVLLIAHDLRSVMDCARVLVMDKGQVAESGSPAQLLAQKGLF YRLAQESGLV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ALA n 1 3 GLN n 1 4 PRO n 1 5 PRO n 1 6 TRP n 1 7 PRO n 1 8 GLN n 1 9 GLY n 1 10 GLY n 1 11 GLN n 1 12 ILE n 1 13 GLU n 1 14 PHE n 1 15 ARG n 1 16 ASP n 1 17 PHE n 1 18 GLY n 1 19 LEU n 1 20 ARG n 1 21 TYR n 1 22 ARG n 1 23 PRO n 1 24 GLU n 1 25 LEU n 1 26 PRO n 1 27 LEU n 1 28 ALA n 1 29 VAL n 1 30 GLN n 1 31 GLY n 1 32 VAL n 1 33 SER n 1 34 PHE n 1 35 LYS n 1 36 ILE n 1 37 HIS n 1 38 ALA n 1 39 GLY n 1 40 GLU n 1 41 LYS n 1 42 VAL n 1 43 GLY n 1 44 ILE n 1 45 VAL n 1 46 GLY n 1 47 ARG n 1 48 THR n 1 49 GLY n 1 50 ALA n 1 51 GLY n 1 52 LYS n 1 53 SER n 1 54 SER n 1 55 LEU n 1 56 ALA n 1 57 SER n 1 58 GLY n 1 59 LEU n 1 60 LEU n 1 61 ARG n 1 62 LEU n 1 63 GLN n 1 64 GLU n 1 65 ALA n 1 66 ALA n 1 67 GLU n 1 68 GLY n 1 69 GLY n 1 70 ILE n 1 71 TRP n 1 72 ILE n 1 73 ASP n 1 74 GLY n 1 75 VAL n 1 76 PRO n 1 77 ILE n 1 78 ALA n 1 79 HIS n 1 80 VAL n 1 81 GLY n 1 82 LEU n 1 83 HIS n 1 84 THR n 1 85 LEU n 1 86 ARG n 1 87 SER n 1 88 ARG n 1 89 ILE n 1 90 SER n 1 91 ILE n 1 92 ILE n 1 93 PRO n 1 94 GLN n 1 95 ASP n 1 96 PRO n 1 97 ILE n 1 98 LEU n 1 99 PHE n 1 100 PRO n 1 101 GLY n 1 102 SER n 1 103 LEU n 1 104 ARG n 1 105 MET n 1 106 ASN n 1 107 LEU n 1 108 ASP n 1 109 LEU n 1 110 LEU n 1 111 GLN n 1 112 GLU n 1 113 HIS n 1 114 SER n 1 115 ASP n 1 116 GLU n 1 117 ALA n 1 118 ILE n 1 119 TRP n 1 120 ALA n 1 121 ALA n 1 122 LEU n 1 123 GLU n 1 124 THR n 1 125 VAL n 1 126 GLN n 1 127 LEU n 1 128 LYS n 1 129 ALA n 1 130 LEU n 1 131 VAL n 1 132 ALA n 1 133 SER n 1 134 LEU n 1 135 PRO n 1 136 GLY n 1 137 GLN n 1 138 LEU n 1 139 GLN n 1 140 TYR n 1 141 LYS n 1 142 CYS n 1 143 ALA n 1 144 ASP n 1 145 ARG n 1 146 GLY n 1 147 GLU n 1 148 ASP n 1 149 LEU n 1 150 SER n 1 151 VAL n 1 152 GLY n 1 153 GLN n 1 154 LYS n 1 155 GLN n 1 156 LEU n 1 157 LEU n 1 158 CYS n 1 159 LEU n 1 160 ALA n 1 161 ARG n 1 162 ALA n 1 163 LEU n 1 164 LEU n 1 165 ARG n 1 166 LYS n 1 167 THR n 1 168 GLN n 1 169 ILE n 1 170 LEU n 1 171 ILE n 1 172 LEU n 1 173 ASP n 1 174 GLU n 1 175 ALA n 1 176 THR n 1 177 ALA n 1 178 ALA n 1 179 VAL n 1 180 ASP n 1 181 PRO n 1 182 GLY n 1 183 THR n 1 184 GLU n 1 185 LEU n 1 186 GLN n 1 187 MET n 1 188 GLN n 1 189 ALA n 1 190 MET n 1 191 LEU n 1 192 GLY n 1 193 SER n 1 194 TRP n 1 195 PHE n 1 196 ALA n 1 197 GLN n 1 198 CYS n 1 199 THR n 1 200 VAL n 1 201 LEU n 1 202 LEU n 1 203 ILE n 1 204 ALA n 1 205 HIS n 1 206 ASP n 1 207 LEU n 1 208 ARG n 1 209 SER n 1 210 VAL n 1 211 MET n 1 212 ASP n 1 213 CYS n 1 214 ALA n 1 215 ARG n 1 216 VAL n 1 217 LEU n 1 218 VAL n 1 219 MET n 1 220 ASP n 1 221 LYS n 1 222 GLY n 1 223 GLN n 1 224 VAL n 1 225 ALA n 1 226 GLU n 1 227 SER n 1 228 GLY n 1 229 SER n 1 230 PRO n 1 231 ALA n 1 232 GLN n 1 233 LEU n 1 234 LEU n 1 235 ALA n 1 236 GLN n 1 237 LYS n 1 238 GLY n 1 239 LEU n 1 240 PHE n 1 241 TYR n 1 242 ARG n 1 243 LEU n 1 244 ALA n 1 245 GLN n 1 246 GLU n 1 247 SER n 1 248 GLY n 1 249 LEU n 1 250 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 250 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ABCC6, ARA, MRP6' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MRP6_HUMAN _struct_ref.pdbx_db_accession O95255 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AAQPPWPQGGQIEFRDFGLRYRPELPLAVQGVSFKIHAGEKVGIVGRTGAGKSSLASGLLRLQEAAEGGIWIDGVPIAHV GLHTLRSRISIIPQDPILFPGSLRMNLDLLQEHSDEAIWAALETVQLKALVASLPGQLQYKCADRGEDLSVGQKQLLCLA RALLRKTQILILDEATAAVDPGTELQMQAMLGSWFAQCTVLLIAHRLRSVMDCARVLVMDKGQVAESGSPAQLLAQKGLF YRLAQESGLV ; _struct_ref.pdbx_align_begin 1254 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6P7F _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 250 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O95255 _struct_ref_seq.db_align_beg 1254 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1503 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1254 _struct_ref_seq.pdbx_auth_seq_align_end 1503 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6P7F _struct_ref_seq_dif.mon_id ASP _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 206 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O95255 _struct_ref_seq_dif.db_mon_id ARG _struct_ref_seq_dif.pdbx_seq_db_seq_num 1459 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 1459 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6P7F _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.86 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 68.17 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M MES pH 6.5, 1.6 M Ammonium sulfate, 10% dioxane' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU SATURN 944' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-05-15 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.541780 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU FR-E SUPERBRIGHT' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.541780 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 61.5039316441 _reflns.entry_id 6P7F _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.85 _reflns.d_resolution_low 44.43 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10293 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 26.3 _reflns.pdbx_Rmerge_I_obs 0.189 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.193 _reflns.pdbx_Rpim_I_all 0.037 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.85 _reflns_shell.d_res_low 2.95 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.6 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1000 _reflns_shell.percent_possible_all 99.7 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.082 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 28.17 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 2.119 _reflns_shell.pdbx_Rpim_I_all 0.392 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.817 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 49.8948860625 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6P7F _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.85003990159 _refine.ls_d_res_low 44.426198577 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10256 _refine.ls_number_reflns_R_free 1026 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.6695821186 _refine.ls_percent_reflns_R_free 10.003900156 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.264349352919 _refine.ls_R_factor_R_free 0.289210880334 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.261702063763 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34350785683 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6BZR _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.8001384992 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.51345447238 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.85003990159 _refine_hist.d_res_low 44.426198577 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1887 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1882 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.00931510168947 ? 1918 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.12886599894 ? 2597 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0691716720655 ? 299 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0059686685782 ? 335 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 23.481607178 ? 711 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.85 3.0003 . . 144 1291 99.7913769124 . . . 0.462186220468 . 0.40820067192 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0003 3.1882 . . 142 1286 100.0 . . . 0.344563282515 . 0.301938350316 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1882 3.4343 . . 145 1302 99.7243280496 . . . 0.32370259476 . 0.275000427328 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4343 3.7797 . . 143 1284 99.3732590529 . . . 0.2909812176 . 0.261555912938 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7797 4.3262 . . 146 1318 99.727520436 . . . 0.250871857492 . 0.227451758962 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.3262 5.4491 . . 148 1331 99.462004035 . . . 0.243703184552 . 0.233265702271 . . . . . . . . . . 'X-RAY DIFFRACTION' 5.4491 44.4316 . . 158 1418 99.6837444655 . . . 0.293133728559 . 0.265447050524 . . . . . . . . . . # _struct.entry_id 6P7F _struct.title 'Human ABCC6 NBD2 R1459D mutant in Apo state' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6P7F _struct_keywords.text 'ABCC6, NBD2, Apo state, ATP-Binding Cassette transporter C6, nucleotide binding domain 2, TRANSPORT PROTEIN' _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 51 ? LEU A 60 ? GLY A 1304 LEU A 1313 1 ? 10 HELX_P HELX_P2 AA2 ALA A 78 ? VAL A 80 ? ALA A 1331 VAL A 1333 5 ? 3 HELX_P HELX_P3 AA3 GLY A 81 ? ARG A 88 ? GLY A 1334 ARG A 1341 1 ? 8 HELX_P HELX_P4 AA4 SER A 102 ? ASP A 108 ? SER A 1355 ASP A 1361 1 ? 7 HELX_P HELX_P5 AA5 SER A 114 ? VAL A 125 ? SER A 1367 VAL A 1378 1 ? 12 HELX_P HELX_P6 AA6 LEU A 127 ? LEU A 134 ? LEU A 1380 LEU A 1387 1 ? 8 HELX_P HELX_P7 AA7 GLY A 136 ? TYR A 140 ? GLY A 1389 TYR A 1393 5 ? 5 HELX_P HELX_P8 AA8 SER A 150 ? LYS A 166 ? SER A 1403 LYS A 1419 1 ? 17 HELX_P HELX_P9 AA9 ASP A 180 ? PHE A 195 ? ASP A 1433 PHE A 1448 1 ? 16 HELX_P HELX_P10 AB1 SER A 229 ? GLN A 236 ? SER A 1482 GLN A 1489 1 ? 8 HELX_P HELX_P11 AB2 GLY A 238 ? SER A 247 ? GLY A 1491 SER A 1500 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel AA2 4 5 ? parallel AA2 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 29 ? ILE A 36 ? VAL A 1282 ILE A 1289 AA1 2 ILE A 12 ? LEU A 19 ? ILE A 1265 LEU A 1272 AA1 3 GLU A 67 ? ILE A 72 ? GLU A 1320 ILE A 1325 AA1 4 VAL A 75 ? PRO A 76 ? VAL A 1328 PRO A 1329 AA2 1 ILE A 89 ? ILE A 92 ? ILE A 1342 ILE A 1345 AA2 2 ILE A 169 ? ASP A 173 ? ILE A 1422 ASP A 1426 AA2 3 THR A 199 ? ILE A 203 ? THR A 1452 ILE A 1456 AA2 4 LYS A 41 ? GLY A 46 ? LYS A 1294 GLY A 1299 AA2 5 ARG A 215 ? ASP A 220 ? ARG A 1468 ASP A 1473 AA2 6 GLN A 223 ? GLY A 228 ? GLN A 1476 GLY A 1481 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O PHE A 34 ? O PHE A 1287 N PHE A 14 ? N PHE A 1267 AA1 2 3 N GLU A 13 ? N GLU A 1266 O TRP A 71 ? O TRP A 1324 AA1 3 4 N ILE A 72 ? N ILE A 1325 O VAL A 75 ? O VAL A 1328 AA2 1 2 N ILE A 92 ? N ILE A 1345 O ILE A 171 ? O ILE A 1424 AA2 2 3 N LEU A 170 ? N LEU A 1423 O LEU A 201 ? O LEU A 1454 AA2 3 4 O LEU A 202 ? O LEU A 1455 N ILE A 44 ? N ILE A 1297 AA2 4 5 N VAL A 45 ? N VAL A 1298 O MET A 219 ? O MET A 1472 AA2 5 6 N VAL A 216 ? N VAL A 1469 O GLY A 228 ? O GLY A 1481 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id SO4 _struct_site.pdbx_auth_seq_id 1601 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'binding site for residue SO4 A 1601' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ARG A 47 ? ARG A 1300 . ? 1_555 ? 2 AC1 6 GLY A 49 ? GLY A 1302 . ? 1_555 ? 3 AC1 6 ALA A 50 ? ALA A 1303 . ? 1_555 ? 4 AC1 6 GLY A 51 ? GLY A 1304 . ? 1_555 ? 5 AC1 6 LYS A 52 ? LYS A 1305 . ? 1_555 ? 6 AC1 6 SER A 53 ? SER A 1306 . ? 1_555 ? # _atom_sites.entry_id 6P7F _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.010066 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010066 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011905 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 25.62398 1.50364 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 19.97189 1.75589 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? 9.05267 ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 1.23737 29.19336 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1254 ? ? ? A . n A 1 2 ALA 2 1255 1255 ALA ALA A . n A 1 3 GLN 3 1256 1256 GLN GLN A . n A 1 4 PRO 4 1257 1257 PRO PRO A . n A 1 5 PRO 5 1258 1258 PRO PRO A . n A 1 6 TRP 6 1259 1259 TRP TRP A . n A 1 7 PRO 7 1260 1260 PRO PRO A . n A 1 8 GLN 8 1261 1261 GLN GLN A . n A 1 9 GLY 9 1262 1262 GLY GLY A . n A 1 10 GLY 10 1263 1263 GLY GLY A . n A 1 11 GLN 11 1264 1264 GLN GLN A . n A 1 12 ILE 12 1265 1265 ILE ILE A . n A 1 13 GLU 13 1266 1266 GLU GLU A . n A 1 14 PHE 14 1267 1267 PHE PHE A . n A 1 15 ARG 15 1268 1268 ARG ARG A . n A 1 16 ASP 16 1269 1269 ASP ASP A . n A 1 17 PHE 17 1270 1270 PHE PHE A . n A 1 18 GLY 18 1271 1271 GLY GLY A . n A 1 19 LEU 19 1272 1272 LEU LEU A . n A 1 20 ARG 20 1273 1273 ARG ARG A . n A 1 21 TYR 21 1274 1274 TYR TYR A . n A 1 22 ARG 22 1275 1275 ARG ARG A . n A 1 23 PRO 23 1276 1276 PRO PRO A . n A 1 24 GLU 24 1277 1277 GLU GLU A . n A 1 25 LEU 25 1278 1278 LEU LEU A . n A 1 26 PRO 26 1279 1279 PRO PRO A . n A 1 27 LEU 27 1280 1280 LEU LEU A . n A 1 28 ALA 28 1281 1281 ALA ALA A . n A 1 29 VAL 29 1282 1282 VAL VAL A . n A 1 30 GLN 30 1283 1283 GLN GLN A . n A 1 31 GLY 31 1284 1284 GLY GLY A . n A 1 32 VAL 32 1285 1285 VAL VAL A . n A 1 33 SER 33 1286 1286 SER SER A . n A 1 34 PHE 34 1287 1287 PHE PHE A . n A 1 35 LYS 35 1288 1288 LYS LYS A . n A 1 36 ILE 36 1289 1289 ILE ILE A . n A 1 37 HIS 37 1290 1290 HIS HIS A . n A 1 38 ALA 38 1291 1291 ALA ALA A . n A 1 39 GLY 39 1292 1292 GLY GLY A . n A 1 40 GLU 40 1293 1293 GLU GLU A . n A 1 41 LYS 41 1294 1294 LYS LYS A . n A 1 42 VAL 42 1295 1295 VAL VAL A . n A 1 43 GLY 43 1296 1296 GLY GLY A . n A 1 44 ILE 44 1297 1297 ILE ILE A . n A 1 45 VAL 45 1298 1298 VAL VAL A . n A 1 46 GLY 46 1299 1299 GLY GLY A . n A 1 47 ARG 47 1300 1300 ARG ARG A . n A 1 48 THR 48 1301 1301 THR THR A . n A 1 49 GLY 49 1302 1302 GLY GLY A . n A 1 50 ALA 50 1303 1303 ALA ALA A . n A 1 51 GLY 51 1304 1304 GLY GLY A . n A 1 52 LYS 52 1305 1305 LYS LYS A . n A 1 53 SER 53 1306 1306 SER SER A . n A 1 54 SER 54 1307 1307 SER SER A . n A 1 55 LEU 55 1308 1308 LEU LEU A . n A 1 56 ALA 56 1309 1309 ALA ALA A . n A 1 57 SER 57 1310 1310 SER SER A . n A 1 58 GLY 58 1311 1311 GLY GLY A . n A 1 59 LEU 59 1312 1312 LEU LEU A . n A 1 60 LEU 60 1313 1313 LEU LEU A . n A 1 61 ARG 61 1314 1314 ARG ARG A . n A 1 62 LEU 62 1315 1315 LEU LEU A . n A 1 63 GLN 63 1316 1316 GLN GLN A . n A 1 64 GLU 64 1317 1317 GLU GLU A . n A 1 65 ALA 65 1318 1318 ALA ALA A . n A 1 66 ALA 66 1319 1319 ALA ALA A . n A 1 67 GLU 67 1320 1320 GLU GLU A . n A 1 68 GLY 68 1321 1321 GLY GLY A . n A 1 69 GLY 69 1322 1322 GLY GLY A . n A 1 70 ILE 70 1323 1323 ILE ILE A . n A 1 71 TRP 71 1324 1324 TRP TRP A . n A 1 72 ILE 72 1325 1325 ILE ILE A . n A 1 73 ASP 73 1326 1326 ASP ASP A . n A 1 74 GLY 74 1327 1327 GLY GLY A . n A 1 75 VAL 75 1328 1328 VAL VAL A . n A 1 76 PRO 76 1329 1329 PRO PRO A . n A 1 77 ILE 77 1330 1330 ILE ILE A . n A 1 78 ALA 78 1331 1331 ALA ALA A . n A 1 79 HIS 79 1332 1332 HIS HIS A . n A 1 80 VAL 80 1333 1333 VAL VAL A . n A 1 81 GLY 81 1334 1334 GLY GLY A . n A 1 82 LEU 82 1335 1335 LEU LEU A . n A 1 83 HIS 83 1336 1336 HIS HIS A . n A 1 84 THR 84 1337 1337 THR THR A . n A 1 85 LEU 85 1338 1338 LEU LEU A . n A 1 86 ARG 86 1339 1339 ARG ARG A . n A 1 87 SER 87 1340 1340 SER SER A . n A 1 88 ARG 88 1341 1341 ARG ARG A . n A 1 89 ILE 89 1342 1342 ILE ILE A . n A 1 90 SER 90 1343 1343 SER SER A . n A 1 91 ILE 91 1344 1344 ILE ILE A . n A 1 92 ILE 92 1345 1345 ILE ILE A . n A 1 93 PRO 93 1346 1346 PRO PRO A . n A 1 94 GLN 94 1347 1347 GLN GLN A . n A 1 95 ASP 95 1348 1348 ASP ASP A . n A 1 96 PRO 96 1349 1349 PRO PRO A . n A 1 97 ILE 97 1350 1350 ILE ILE A . n A 1 98 LEU 98 1351 1351 LEU LEU A . n A 1 99 PHE 99 1352 1352 PHE PHE A . n A 1 100 PRO 100 1353 1353 PRO PRO A . n A 1 101 GLY 101 1354 1354 GLY GLY A . n A 1 102 SER 102 1355 1355 SER SER A . n A 1 103 LEU 103 1356 1356 LEU LEU A . n A 1 104 ARG 104 1357 1357 ARG ARG A . n A 1 105 MET 105 1358 1358 MET MET A . n A 1 106 ASN 106 1359 1359 ASN ASN A . n A 1 107 LEU 107 1360 1360 LEU LEU A . n A 1 108 ASP 108 1361 1361 ASP ASP A . n A 1 109 LEU 109 1362 1362 LEU LEU A . n A 1 110 LEU 110 1363 1363 LEU LEU A . n A 1 111 GLN 111 1364 1364 GLN GLN A . n A 1 112 GLU 112 1365 1365 GLU GLU A . n A 1 113 HIS 113 1366 1366 HIS HIS A . n A 1 114 SER 114 1367 1367 SER SER A . n A 1 115 ASP 115 1368 1368 ASP ASP A . n A 1 116 GLU 116 1369 1369 GLU GLU A . n A 1 117 ALA 117 1370 1370 ALA ALA A . n A 1 118 ILE 118 1371 1371 ILE ILE A . n A 1 119 TRP 119 1372 1372 TRP TRP A . n A 1 120 ALA 120 1373 1373 ALA ALA A . n A 1 121 ALA 121 1374 1374 ALA ALA A . n A 1 122 LEU 122 1375 1375 LEU LEU A . n A 1 123 GLU 123 1376 1376 GLU GLU A . n A 1 124 THR 124 1377 1377 THR THR A . n A 1 125 VAL 125 1378 1378 VAL VAL A . n A 1 126 GLN 126 1379 1379 GLN GLN A . n A 1 127 LEU 127 1380 1380 LEU LEU A . n A 1 128 LYS 128 1381 1381 LYS LYS A . n A 1 129 ALA 129 1382 1382 ALA ALA A . n A 1 130 LEU 130 1383 1383 LEU LEU A . n A 1 131 VAL 131 1384 1384 VAL VAL A . n A 1 132 ALA 132 1385 1385 ALA ALA A . n A 1 133 SER 133 1386 1386 SER SER A . n A 1 134 LEU 134 1387 1387 LEU LEU A . n A 1 135 PRO 135 1388 1388 PRO PRO A . n A 1 136 GLY 136 1389 1389 GLY GLY A . n A 1 137 GLN 137 1390 1390 GLN GLN A . n A 1 138 LEU 138 1391 1391 LEU LEU A . n A 1 139 GLN 139 1392 1392 GLN GLN A . n A 1 140 TYR 140 1393 1393 TYR TYR A . n A 1 141 LYS 141 1394 1394 LYS LYS A . n A 1 142 CYS 142 1395 1395 CYS CYS A . n A 1 143 ALA 143 1396 1396 ALA ALA A . n A 1 144 ASP 144 1397 ? ? ? A . n A 1 145 ARG 145 1398 1398 ARG ARG A . n A 1 146 GLY 146 1399 1399 GLY GLY A . n A 1 147 GLU 147 1400 1400 GLU GLU A . n A 1 148 ASP 148 1401 1401 ASP ASP A . n A 1 149 LEU 149 1402 1402 LEU LEU A . n A 1 150 SER 150 1403 1403 SER SER A . n A 1 151 VAL 151 1404 1404 VAL VAL A . n A 1 152 GLY 152 1405 1405 GLY GLY A . n A 1 153 GLN 153 1406 1406 GLN GLN A . n A 1 154 LYS 154 1407 1407 LYS LYS A . n A 1 155 GLN 155 1408 1408 GLN GLN A . n A 1 156 LEU 156 1409 1409 LEU LEU A . n A 1 157 LEU 157 1410 1410 LEU LEU A . n A 1 158 CYS 158 1411 1411 CYS CYS A . n A 1 159 LEU 159 1412 1412 LEU LEU A . n A 1 160 ALA 160 1413 1413 ALA ALA A . n A 1 161 ARG 161 1414 1414 ARG ARG A . n A 1 162 ALA 162 1415 1415 ALA ALA A . n A 1 163 LEU 163 1416 1416 LEU LEU A . n A 1 164 LEU 164 1417 1417 LEU LEU A . n A 1 165 ARG 165 1418 1418 ARG ARG A . n A 1 166 LYS 166 1419 1419 LYS LYS A . n A 1 167 THR 167 1420 1420 THR THR A . n A 1 168 GLN 168 1421 1421 GLN GLN A . n A 1 169 ILE 169 1422 1422 ILE ILE A . n A 1 170 LEU 170 1423 1423 LEU LEU A . n A 1 171 ILE 171 1424 1424 ILE ILE A . n A 1 172 LEU 172 1425 1425 LEU LEU A . n A 1 173 ASP 173 1426 1426 ASP ASP A . n A 1 174 GLU 174 1427 1427 GLU GLU A . n A 1 175 ALA 175 1428 1428 ALA ALA A . n A 1 176 THR 176 1429 1429 THR THR A . n A 1 177 ALA 177 1430 1430 ALA ALA A . n A 1 178 ALA 178 1431 1431 ALA ALA A . n A 1 179 VAL 179 1432 1432 VAL VAL A . n A 1 180 ASP 180 1433 1433 ASP ASP A . n A 1 181 PRO 181 1434 1434 PRO PRO A . n A 1 182 GLY 182 1435 1435 GLY GLY A . n A 1 183 THR 183 1436 1436 THR THR A . n A 1 184 GLU 184 1437 1437 GLU GLU A . n A 1 185 LEU 185 1438 1438 LEU LEU A . n A 1 186 GLN 186 1439 1439 GLN GLN A . n A 1 187 MET 187 1440 1440 MET MET A . n A 1 188 GLN 188 1441 1441 GLN GLN A . n A 1 189 ALA 189 1442 1442 ALA ALA A . n A 1 190 MET 190 1443 1443 MET MET A . n A 1 191 LEU 191 1444 1444 LEU LEU A . n A 1 192 GLY 192 1445 1445 GLY GLY A . n A 1 193 SER 193 1446 1446 SER SER A . n A 1 194 TRP 194 1447 1447 TRP TRP A . n A 1 195 PHE 195 1448 1448 PHE PHE A . n A 1 196 ALA 196 1449 1449 ALA ALA A . n A 1 197 GLN 197 1450 1450 GLN GLN A . n A 1 198 CYS 198 1451 1451 CYS CYS A . n A 1 199 THR 199 1452 1452 THR THR A . n A 1 200 VAL 200 1453 1453 VAL VAL A . n A 1 201 LEU 201 1454 1454 LEU LEU A . n A 1 202 LEU 202 1455 1455 LEU LEU A . n A 1 203 ILE 203 1456 1456 ILE ILE A . n A 1 204 ALA 204 1457 1457 ALA ALA A . n A 1 205 HIS 205 1458 1458 HIS HIS A . n A 1 206 ASP 206 1459 1459 ASP ASP A . n A 1 207 LEU 207 1460 1460 LEU LEU A . n A 1 208 ARG 208 1461 1461 ARG ARG A . n A 1 209 SER 209 1462 1462 SER SER A . n A 1 210 VAL 210 1463 1463 VAL VAL A . n A 1 211 MET 211 1464 1464 MET MET A . n A 1 212 ASP 212 1465 1465 ASP ASP A . n A 1 213 CYS 213 1466 1466 CYS CYS A . n A 1 214 ALA 214 1467 1467 ALA ALA A . n A 1 215 ARG 215 1468 1468 ARG ARG A . n A 1 216 VAL 216 1469 1469 VAL VAL A . n A 1 217 LEU 217 1470 1470 LEU LEU A . n A 1 218 VAL 218 1471 1471 VAL VAL A . n A 1 219 MET 219 1472 1472 MET MET A . n A 1 220 ASP 220 1473 1473 ASP ASP A . n A 1 221 LYS 221 1474 1474 LYS LYS A . n A 1 222 GLY 222 1475 1475 GLY GLY A . n A 1 223 GLN 223 1476 1476 GLN GLN A . n A 1 224 VAL 224 1477 1477 VAL VAL A . n A 1 225 ALA 225 1478 1478 ALA ALA A . n A 1 226 GLU 226 1479 1479 GLU GLU A . n A 1 227 SER 227 1480 1480 SER SER A . n A 1 228 GLY 228 1481 1481 GLY GLY A . n A 1 229 SER 229 1482 1482 SER SER A . n A 1 230 PRO 230 1483 1483 PRO PRO A . n A 1 231 ALA 231 1484 1484 ALA ALA A . n A 1 232 GLN 232 1485 1485 GLN GLN A . n A 1 233 LEU 233 1486 1486 LEU LEU A . n A 1 234 LEU 234 1487 1487 LEU LEU A . n A 1 235 ALA 235 1488 1488 ALA ALA A . n A 1 236 GLN 236 1489 1489 GLN GLN A . n A 1 237 LYS 237 1490 1490 LYS LYS A . n A 1 238 GLY 238 1491 1491 GLY GLY A . n A 1 239 LEU 239 1492 1492 LEU LEU A . n A 1 240 PHE 240 1493 1493 PHE PHE A . n A 1 241 TYR 241 1494 1494 TYR TYR A . n A 1 242 ARG 242 1495 1495 ARG ARG A . n A 1 243 LEU 243 1496 1496 LEU LEU A . n A 1 244 ALA 244 1497 1497 ALA ALA A . n A 1 245 GLN 245 1498 1498 GLN GLN A . n A 1 246 GLU 246 1499 1499 GLU GLU A . n A 1 247 SER 247 1500 1500 SER SER A . n A 1 248 GLY 248 1501 1501 GLY GLY A . n A 1 249 LEU 249 1502 1502 LEU LEU A . n A 1 250 VAL 250 1503 1503 VAL VAL A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id SO4 _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 1601 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id SO4 _pdbx_nonpoly_scheme.auth_mon_id SO4 _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-06-10 2 'Structure model' 1 1 2023-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+1/4 3 y+1/2,-x+1/2,z+3/4 4 x+1/2,-y+1/2,-z+3/4 5 -x+1/2,y+1/2,-z+1/4 6 -x,-y,z+1/2 7 y,x,-z 8 -y,-x,-z+1/2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1_2575 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 6P7F _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 C _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 PRO _pdbx_validate_rmsd_angle.auth_seq_id_1 1257 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 N _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 PRO _pdbx_validate_rmsd_angle.auth_seq_id_2 1258 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CA _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 PRO _pdbx_validate_rmsd_angle.auth_seq_id_3 1258 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 129.96 _pdbx_validate_rmsd_angle.angle_target_value 119.30 _pdbx_validate_rmsd_angle.angle_deviation 10.66 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.50 _pdbx_validate_rmsd_angle.linker_flag Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 1258 ? ? -53.15 175.09 2 1 GLN A 1390 ? ? 54.31 -120.08 3 1 THR A 1429 ? ? -136.88 -58.88 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 1254 ? A ALA 1 2 1 Y 1 A ASP 1397 ? A ASP 144 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 SO4 S S N N 301 SO4 O1 O N N 302 SO4 O2 O N N 303 SO4 O3 O N N 304 SO4 O4 O N N 305 THR N N N N 306 THR CA C N S 307 THR C C N N 308 THR O O N N 309 THR CB C N R 310 THR OG1 O N N 311 THR CG2 C N N 312 THR OXT O N N 313 THR H H N N 314 THR H2 H N N 315 THR HA H N N 316 THR HB H N N 317 THR HG1 H N N 318 THR HG21 H N N 319 THR HG22 H N N 320 THR HG23 H N N 321 THR HXT H N N 322 TRP N N N N 323 TRP CA C N S 324 TRP C C N N 325 TRP O O N N 326 TRP CB C N N 327 TRP CG C Y N 328 TRP CD1 C Y N 329 TRP CD2 C Y N 330 TRP NE1 N Y N 331 TRP CE2 C Y N 332 TRP CE3 C Y N 333 TRP CZ2 C Y N 334 TRP CZ3 C Y N 335 TRP CH2 C Y N 336 TRP OXT O N N 337 TRP H H N N 338 TRP H2 H N N 339 TRP HA H N N 340 TRP HB2 H N N 341 TRP HB3 H N N 342 TRP HD1 H N N 343 TRP HE1 H N N 344 TRP HE3 H N N 345 TRP HZ2 H N N 346 TRP HZ3 H N N 347 TRP HH2 H N N 348 TRP HXT H N N 349 TYR N N N N 350 TYR CA C N S 351 TYR C C N N 352 TYR O O N N 353 TYR CB C N N 354 TYR CG C Y N 355 TYR CD1 C Y N 356 TYR CD2 C Y N 357 TYR CE1 C Y N 358 TYR CE2 C Y N 359 TYR CZ C Y N 360 TYR OH O N N 361 TYR OXT O N N 362 TYR H H N N 363 TYR H2 H N N 364 TYR HA H N N 365 TYR HB2 H N N 366 TYR HB3 H N N 367 TYR HD1 H N N 368 TYR HD2 H N N 369 TYR HE1 H N N 370 TYR HE2 H N N 371 TYR HH H N N 372 TYR HXT H N N 373 VAL N N N N 374 VAL CA C N S 375 VAL C C N N 376 VAL O O N N 377 VAL CB C N N 378 VAL CG1 C N N 379 VAL CG2 C N N 380 VAL OXT O N N 381 VAL H H N N 382 VAL H2 H N N 383 VAL HA H N N 384 VAL HB H N N 385 VAL HG11 H N N 386 VAL HG12 H N N 387 VAL HG13 H N N 388 VAL HG21 H N N 389 VAL HG22 H N N 390 VAL HG23 H N N 391 VAL HXT H N N 392 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 SO4 S O1 doub N N 288 SO4 S O2 doub N N 289 SO4 S O3 sing N N 290 SO4 S O4 sing N N 291 THR N CA sing N N 292 THR N H sing N N 293 THR N H2 sing N N 294 THR CA C sing N N 295 THR CA CB sing N N 296 THR CA HA sing N N 297 THR C O doub N N 298 THR C OXT sing N N 299 THR CB OG1 sing N N 300 THR CB CG2 sing N N 301 THR CB HB sing N N 302 THR OG1 HG1 sing N N 303 THR CG2 HG21 sing N N 304 THR CG2 HG22 sing N N 305 THR CG2 HG23 sing N N 306 THR OXT HXT sing N N 307 TRP N CA sing N N 308 TRP N H sing N N 309 TRP N H2 sing N N 310 TRP CA C sing N N 311 TRP CA CB sing N N 312 TRP CA HA sing N N 313 TRP C O doub N N 314 TRP C OXT sing N N 315 TRP CB CG sing N N 316 TRP CB HB2 sing N N 317 TRP CB HB3 sing N N 318 TRP CG CD1 doub Y N 319 TRP CG CD2 sing Y N 320 TRP CD1 NE1 sing Y N 321 TRP CD1 HD1 sing N N 322 TRP CD2 CE2 doub Y N 323 TRP CD2 CE3 sing Y N 324 TRP NE1 CE2 sing Y N 325 TRP NE1 HE1 sing N N 326 TRP CE2 CZ2 sing Y N 327 TRP CE3 CZ3 doub Y N 328 TRP CE3 HE3 sing N N 329 TRP CZ2 CH2 doub Y N 330 TRP CZ2 HZ2 sing N N 331 TRP CZ3 CH2 sing Y N 332 TRP CZ3 HZ3 sing N N 333 TRP CH2 HH2 sing N N 334 TRP OXT HXT sing N N 335 TYR N CA sing N N 336 TYR N H sing N N 337 TYR N H2 sing N N 338 TYR CA C sing N N 339 TYR CA CB sing N N 340 TYR CA HA sing N N 341 TYR C O doub N N 342 TYR C OXT sing N N 343 TYR CB CG sing N N 344 TYR CB HB2 sing N N 345 TYR CB HB3 sing N N 346 TYR CG CD1 doub Y N 347 TYR CG CD2 sing Y N 348 TYR CD1 CE1 sing Y N 349 TYR CD1 HD1 sing N N 350 TYR CD2 CE2 doub Y N 351 TYR CD2 HD2 sing N N 352 TYR CE1 CZ doub Y N 353 TYR CE1 HE1 sing N N 354 TYR CE2 CZ sing Y N 355 TYR CE2 HE2 sing N N 356 TYR CZ OH sing N N 357 TYR OH HH sing N N 358 TYR OXT HXT sing N N 359 VAL N CA sing N N 360 VAL N H sing N N 361 VAL N H2 sing N N 362 VAL CA C sing N N 363 VAL CA CB sing N N 364 VAL CA HA sing N N 365 VAL C O doub N N 366 VAL C OXT sing N N 367 VAL CB CG1 sing N N 368 VAL CB CG2 sing N N 369 VAL CB HB sing N N 370 VAL CG1 HG11 sing N N 371 VAL CG1 HG12 sing N N 372 VAL CG1 HG13 sing N N 373 VAL CG2 HG21 sing N N 374 VAL CG2 HG22 sing N N 375 VAL CG2 HG23 sing N N 376 VAL OXT HXT sing N N 377 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number GM122091 _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'SULFATE ION' _pdbx_entity_nonpoly.comp_id SO4 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6BZR _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 41 21 2' _space_group.name_Hall 'P 4abw 2nw' _space_group.IT_number 92 _space_group.crystal_system tetragonal _space_group.id 1 #