data_6P7J # _entry.id 6P7J # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.324 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6P7J WWPDB D_1000242035 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6P7J _pdbx_database_status.recvd_initial_deposition_date 2019-06-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Stachowski, T.R.' 1 0000-0002-6097-4857 'Snell, M.E.' 2 ? 'Snell, E.H.' 3 0000-0001-8714-3191 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Iucrj _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2052-2525 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 7 _citation.language ? _citation.page_first 238 _citation.page_last 252 _citation.title ;Structural insights into conformational switching in latency-associated peptide between transforming growth factor beta-1 bound and unbound states ; _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S205225251901707X _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Stachowski, T.R.' 1 0000-0002-6097-4857 primary 'Snell, M.E.' 2 ? primary 'Snell, E.H.' 3 0000-0001-8714-3191 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6P7J _cell.details ? _cell.formula_units_Z ? _cell.length_a 51.060 _cell.length_a_esd ? _cell.length_b 154.900 _cell.length_b_esd ? _cell.length_c 62.250 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6P7J _symmetry.cell_setting ? _symmetry.Int_Tables_number 21 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Transforming growth factor beta-1 proprotein' _entity.formula_weight 29274.240 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation R249A _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;LSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVT RVLMVETHNEIYDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAP SDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQ HLQSSRHRAHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;LSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVT RVLMVETHNEIYDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAP SDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQ HLQSSRHRAHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 SER n 1 3 THR n 1 4 CYS n 1 5 LYS n 1 6 THR n 1 7 ILE n 1 8 ASP n 1 9 MET n 1 10 GLU n 1 11 LEU n 1 12 VAL n 1 13 LYS n 1 14 ARG n 1 15 LYS n 1 16 ARG n 1 17 ILE n 1 18 GLU n 1 19 ALA n 1 20 ILE n 1 21 ARG n 1 22 GLY n 1 23 GLN n 1 24 ILE n 1 25 LEU n 1 26 SER n 1 27 LYS n 1 28 LEU n 1 29 ARG n 1 30 LEU n 1 31 ALA n 1 32 SER n 1 33 PRO n 1 34 PRO n 1 35 SER n 1 36 GLN n 1 37 GLY n 1 38 GLU n 1 39 VAL n 1 40 PRO n 1 41 PRO n 1 42 GLY n 1 43 PRO n 1 44 LEU n 1 45 PRO n 1 46 GLU n 1 47 ALA n 1 48 VAL n 1 49 LEU n 1 50 ALA n 1 51 LEU n 1 52 TYR n 1 53 ASN n 1 54 SER n 1 55 THR n 1 56 ARG n 1 57 ASP n 1 58 ARG n 1 59 VAL n 1 60 ALA n 1 61 GLY n 1 62 GLU n 1 63 SER n 1 64 ALA n 1 65 GLU n 1 66 PRO n 1 67 GLU n 1 68 PRO n 1 69 GLU n 1 70 PRO n 1 71 GLU n 1 72 ALA n 1 73 ASP n 1 74 TYR n 1 75 TYR n 1 76 ALA n 1 77 LYS n 1 78 GLU n 1 79 VAL n 1 80 THR n 1 81 ARG n 1 82 VAL n 1 83 LEU n 1 84 MET n 1 85 VAL n 1 86 GLU n 1 87 THR n 1 88 HIS n 1 89 ASN n 1 90 GLU n 1 91 ILE n 1 92 TYR n 1 93 ASP n 1 94 LYS n 1 95 PHE n 1 96 LYS n 1 97 GLN n 1 98 SER n 1 99 THR n 1 100 HIS n 1 101 SER n 1 102 ILE n 1 103 TYR n 1 104 MET n 1 105 PHE n 1 106 PHE n 1 107 ASN n 1 108 THR n 1 109 SER n 1 110 GLU n 1 111 LEU n 1 112 ARG n 1 113 GLU n 1 114 ALA n 1 115 VAL n 1 116 PRO n 1 117 GLU n 1 118 PRO n 1 119 VAL n 1 120 LEU n 1 121 LEU n 1 122 SER n 1 123 ARG n 1 124 ALA n 1 125 GLU n 1 126 LEU n 1 127 ARG n 1 128 LEU n 1 129 LEU n 1 130 ARG n 1 131 LEU n 1 132 LYS n 1 133 LEU n 1 134 LYS n 1 135 VAL n 1 136 GLU n 1 137 GLN n 1 138 HIS n 1 139 VAL n 1 140 GLU n 1 141 LEU n 1 142 TYR n 1 143 GLN n 1 144 LYS n 1 145 TYR n 1 146 SER n 1 147 ASN n 1 148 ASN n 1 149 SER n 1 150 TRP n 1 151 ARG n 1 152 TYR n 1 153 LEU n 1 154 SER n 1 155 ASN n 1 156 ARG n 1 157 LEU n 1 158 LEU n 1 159 ALA n 1 160 PRO n 1 161 SER n 1 162 ASP n 1 163 SER n 1 164 PRO n 1 165 GLU n 1 166 TRP n 1 167 LEU n 1 168 SER n 1 169 PHE n 1 170 ASP n 1 171 VAL n 1 172 THR n 1 173 GLY n 1 174 VAL n 1 175 VAL n 1 176 ARG n 1 177 GLN n 1 178 TRP n 1 179 LEU n 1 180 SER n 1 181 ARG n 1 182 GLY n 1 183 GLY n 1 184 GLU n 1 185 ILE n 1 186 GLU n 1 187 GLY n 1 188 PHE n 1 189 ARG n 1 190 LEU n 1 191 SER n 1 192 ALA n 1 193 HIS n 1 194 CYS n 1 195 SER n 1 196 CYS n 1 197 ASP n 1 198 SER n 1 199 ARG n 1 200 ASP n 1 201 ASN n 1 202 THR n 1 203 LEU n 1 204 GLN n 1 205 VAL n 1 206 ASP n 1 207 ILE n 1 208 ASN n 1 209 GLY n 1 210 PHE n 1 211 THR n 1 212 THR n 1 213 GLY n 1 214 ARG n 1 215 ARG n 1 216 GLY n 1 217 ASP n 1 218 LEU n 1 219 ALA n 1 220 THR n 1 221 ILE n 1 222 HIS n 1 223 GLY n 1 224 MET n 1 225 ASN n 1 226 ARG n 1 227 PRO n 1 228 PHE n 1 229 LEU n 1 230 LEU n 1 231 LEU n 1 232 MET n 1 233 ALA n 1 234 THR n 1 235 PRO n 1 236 LEU n 1 237 GLU n 1 238 ARG n 1 239 ALA n 1 240 GLN n 1 241 HIS n 1 242 LEU n 1 243 GLN n 1 244 SER n 1 245 SER n 1 246 ARG n 1 247 HIS n 1 248 ARG n 1 249 ALA n 1 250 HIS n 1 251 HIS n 1 252 HIS n 1 253 HIS n 1 254 HIS n 1 255 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 255 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TGFB1, TGFB' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name human _entity_src_gen.pdbx_host_org_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 9606 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell HEK293 _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pTT3 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TGFB1_HUMAN _struct_ref.pdbx_db_accession P01137 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVT RVLMVETHNEIYDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAP SDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQ HLQSSRHRR ; _struct_ref.pdbx_align_begin 30 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6P7J _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 249 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01137 _struct_ref_seq.db_align_beg 30 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 278 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 248 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6P7J ALA A 249 ? UNP P01137 ARG 278 'engineered mutation' 248 1 1 6P7J HIS A 250 ? UNP P01137 ? ? 'expression tag' 249 2 1 6P7J HIS A 251 ? UNP P01137 ? ? 'expression tag' 250 3 1 6P7J HIS A 252 ? UNP P01137 ? ? 'expression tag' 251 4 1 6P7J HIS A 253 ? UNP P01137 ? ? 'expression tag' 252 5 1 6P7J HIS A 254 ? UNP P01137 ? ? 'expression tag' 253 6 1 6P7J HIS A 255 ? UNP P01137 ? ? 'expression tag' 254 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6P7J _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.03 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.42 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'BATCH MODE' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Reservoir composition: 20% PEG3350, 300 mM NaAc pH 4.6' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-11-11 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 17-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6P7J _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.500 _reflns.d_resolution_low 36.310 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 3332 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.600 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.700 _reflns.pdbx_Rmerge_I_obs 0.345 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 3.100 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 46 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.406 _reflns.pdbx_Rpim_I_all 0.209 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 12411 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.899 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 3.500 3.830 ? ? 2668 ? ? ? 773 99.500 ? ? ? ? 1.690 ? ? ? ? ? ? ? ? 3.500 ? ? ? 1.100 2.034 1.106 ? 1 1 0.467 ? 8.570 36.310 ? ? 986 ? ? ? 256 98.300 ? ? ? ? 0.076 ? ? ? ? ? ? ? ? 3.900 ? ? ? 6.700 0.087 0.042 ? 2 1 0.988 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 224.460 _refine.B_iso_mean 111.1007 _refine.B_iso_min 40.770 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6P7J _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.5010 _refine.ls_d_res_low 36.31 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 3329 _refine.ls_number_reflns_R_free 160 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.4900 _refine.ls_percent_reflns_R_free 4.8100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2897 _refine.ls_R_factor_R_free 0.3215 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2881 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5VQP _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.5400 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4900 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 3.5010 _refine_hist.d_res_low 36.31 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1298 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 159 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1298 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 3.501 _refine_ls_shell.d_res_low 3.625 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 12 _refine_ls_shell.number_reflns_R_work 324 _refine_ls_shell.percent_reflns_obs 99.0000 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3315 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3296 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6P7J _struct.title 'Crystal structure of Latency Associated Peptide unbound to TGF-beta1' _struct.pdbx_descriptor 'Transforming growth factor beta-1 proprotein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6P7J _struct_keywords.text 'pro-domain, latency, cancer, transforming, CYTOKINE' _struct_keywords.pdbx_keywords CYTOKINE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 108 ? ARG A 112 ? THR A 107 ARG A 111 5 ? 5 HELX_P HELX_P2 AA2 VAL A 171 ? ARG A 181 ? VAL A 170 ARG A 180 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 194 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 196 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 193 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 195 _struct_conn.ptnr2_symmetry 3_556 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.412 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 80 ? VAL A 85 ? THR A 79 VAL A 84 AA1 2 PHE A 228 ? ALA A 233 ? PHE A 227 ALA A 232 AA1 3 LEU A 121 ? ARG A 130 ? LEU A 120 ARG A 129 AA1 4 GLU A 165 ? ASP A 170 ? GLU A 164 ASP A 169 AA2 1 MET A 104 ? ASN A 107 ? MET A 103 ASN A 106 AA2 2 GLU A 186 ? ALA A 192 ? GLU A 185 ALA A 191 AA2 3 GLN A 137 ? LYS A 144 ? GLN A 136 LYS A 143 AA2 4 TRP A 150 ? LEU A 158 ? TRP A 149 LEU A 157 AA3 1 CYS A 194 ? ARG A 199 ? CYS A 193 ARG A 198 AA3 2 THR A 202 ? ILE A 207 ? THR A 201 ILE A 206 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N MET A 84 ? N MET A 83 O LEU A 229 ? O LEU A 228 AA1 2 3 O MET A 232 ? O MET A 231 N SER A 122 ? N SER A 121 AA1 3 4 N LEU A 128 ? N LEU A 127 O LEU A 167 ? O LEU A 166 AA2 1 2 N ASN A 107 ? N ASN A 106 O GLU A 186 ? O GLU A 185 AA2 2 3 O ARG A 189 ? O ARG A 188 N TYR A 142 ? N TYR A 141 AA2 3 4 N LEU A 141 ? N LEU A 140 O LEU A 153 ? O LEU A 152 AA3 1 2 N ARG A 199 ? N ARG A 198 O THR A 202 ? O THR A 201 # _atom_sites.entry_id 6P7J _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.019585 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006456 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016064 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 0 ? ? ? A . n A 1 2 SER 2 1 ? ? ? A . n A 1 3 THR 3 2 ? ? ? A . n A 1 4 CYS 4 3 ? ? ? A . n A 1 5 LYS 5 4 ? ? ? A . n A 1 6 THR 6 5 ? ? ? A . n A 1 7 ILE 7 6 ? ? ? A . n A 1 8 ASP 8 7 ? ? ? A . n A 1 9 MET 9 8 ? ? ? A . n A 1 10 GLU 10 9 ? ? ? A . n A 1 11 LEU 11 10 ? ? ? A . n A 1 12 VAL 12 11 ? ? ? A . n A 1 13 LYS 13 12 ? ? ? A . n A 1 14 ARG 14 13 ? ? ? A . n A 1 15 LYS 15 14 ? ? ? A . n A 1 16 ARG 16 15 ? ? ? A . n A 1 17 ILE 17 16 ? ? ? A . n A 1 18 GLU 18 17 ? ? ? A . n A 1 19 ALA 19 18 ? ? ? A . n A 1 20 ILE 20 19 ? ? ? A . n A 1 21 ARG 21 20 ? ? ? A . n A 1 22 GLY 22 21 ? ? ? A . n A 1 23 GLN 23 22 ? ? ? A . n A 1 24 ILE 24 23 ? ? ? A . n A 1 25 LEU 25 24 ? ? ? A . n A 1 26 SER 26 25 ? ? ? A . n A 1 27 LYS 27 26 ? ? ? A . n A 1 28 LEU 28 27 ? ? ? A . n A 1 29 ARG 29 28 ? ? ? A . n A 1 30 LEU 30 29 ? ? ? A . n A 1 31 ALA 31 30 ? ? ? A . n A 1 32 SER 32 31 ? ? ? A . n A 1 33 PRO 33 32 ? ? ? A . n A 1 34 PRO 34 33 ? ? ? A . n A 1 35 SER 35 34 ? ? ? A . n A 1 36 GLN 36 35 ? ? ? A . n A 1 37 GLY 37 36 ? ? ? A . n A 1 38 GLU 38 37 ? ? ? A . n A 1 39 VAL 39 38 ? ? ? A . n A 1 40 PRO 40 39 ? ? ? A . n A 1 41 PRO 41 40 ? ? ? A . n A 1 42 GLY 42 41 ? ? ? A . n A 1 43 PRO 43 42 ? ? ? A . n A 1 44 LEU 44 43 ? ? ? A . n A 1 45 PRO 45 44 ? ? ? A . n A 1 46 GLU 46 45 ? ? ? A . n A 1 47 ALA 47 46 ? ? ? A . n A 1 48 VAL 48 47 ? ? ? A . n A 1 49 LEU 49 48 ? ? ? A . n A 1 50 ALA 50 49 ? ? ? A . n A 1 51 LEU 51 50 ? ? ? A . n A 1 52 TYR 52 51 ? ? ? A . n A 1 53 ASN 53 52 ? ? ? A . n A 1 54 SER 54 53 ? ? ? A . n A 1 55 THR 55 54 ? ? ? A . n A 1 56 ARG 56 55 ? ? ? A . n A 1 57 ASP 57 56 ? ? ? A . n A 1 58 ARG 58 57 ? ? ? A . n A 1 59 VAL 59 58 ? ? ? A . n A 1 60 ALA 60 59 ? ? ? A . n A 1 61 GLY 61 60 ? ? ? A . n A 1 62 GLU 62 61 ? ? ? A . n A 1 63 SER 63 62 ? ? ? A . n A 1 64 ALA 64 63 ? ? ? A . n A 1 65 GLU 65 64 ? ? ? A . n A 1 66 PRO 66 65 ? ? ? A . n A 1 67 GLU 67 66 ? ? ? A . n A 1 68 PRO 68 67 ? ? ? A . n A 1 69 GLU 69 68 ? ? ? A . n A 1 70 PRO 70 69 ? ? ? A . n A 1 71 GLU 71 70 ? ? ? A . n A 1 72 ALA 72 71 ? ? ? A . n A 1 73 ASP 73 72 ? ? ? A . n A 1 74 TYR 74 73 ? ? ? A . n A 1 75 TYR 75 74 ? ? ? A . n A 1 76 ALA 76 75 ? ? ? A . n A 1 77 LYS 77 76 76 LYS LYS A . n A 1 78 GLU 78 77 77 GLU GLU A . n A 1 79 VAL 79 78 78 VAL VAL A . n A 1 80 THR 80 79 79 THR THR A . n A 1 81 ARG 81 80 80 ARG ARG A . n A 1 82 VAL 82 81 81 VAL VAL A . n A 1 83 LEU 83 82 82 LEU LEU A . n A 1 84 MET 84 83 83 MET MET A . n A 1 85 VAL 85 84 84 VAL VAL A . n A 1 86 GLU 86 85 85 GLU GLU A . n A 1 87 THR 87 86 86 THR THR A . n A 1 88 HIS 88 87 87 HIS HIS A . n A 1 89 ASN 89 88 88 ASN ASN A . n A 1 90 GLU 90 89 89 GLU GLU A . n A 1 91 ILE 91 90 90 ILE ILE A . n A 1 92 TYR 92 91 91 TYR TYR A . n A 1 93 ASP 93 92 92 ASP ASP A . n A 1 94 LYS 94 93 93 LYS LYS A . n A 1 95 PHE 95 94 94 PHE PHE A . n A 1 96 LYS 96 95 95 LYS LYS A . n A 1 97 GLN 97 96 96 GLN GLN A . n A 1 98 SER 98 97 ? ? ? A . n A 1 99 THR 99 98 ? ? ? A . n A 1 100 HIS 100 99 99 HIS HIS A . n A 1 101 SER 101 100 100 SER SER A . n A 1 102 ILE 102 101 101 ILE ILE A . n A 1 103 TYR 103 102 102 TYR TYR A . n A 1 104 MET 104 103 103 MET MET A . n A 1 105 PHE 105 104 104 PHE PHE A . n A 1 106 PHE 106 105 105 PHE PHE A . n A 1 107 ASN 107 106 106 ASN ASN A . n A 1 108 THR 108 107 107 THR THR A . n A 1 109 SER 109 108 108 SER SER A . n A 1 110 GLU 110 109 109 GLU GLU A . n A 1 111 LEU 111 110 110 LEU LEU A . n A 1 112 ARG 112 111 111 ARG ARG A . n A 1 113 GLU 113 112 112 GLU GLU A . n A 1 114 ALA 114 113 113 ALA ALA A . n A 1 115 VAL 115 114 114 VAL VAL A . n A 1 116 PRO 116 115 115 PRO PRO A . n A 1 117 GLU 117 116 116 GLU GLU A . n A 1 118 PRO 118 117 117 PRO PRO A . n A 1 119 VAL 119 118 118 VAL VAL A . n A 1 120 LEU 120 119 119 LEU LEU A . n A 1 121 LEU 121 120 120 LEU LEU A . n A 1 122 SER 122 121 121 SER SER A . n A 1 123 ARG 123 122 122 ARG ARG A . n A 1 124 ALA 124 123 123 ALA ALA A . n A 1 125 GLU 125 124 124 GLU GLU A . n A 1 126 LEU 126 125 125 LEU LEU A . n A 1 127 ARG 127 126 126 ARG ARG A . n A 1 128 LEU 128 127 127 LEU LEU A . n A 1 129 LEU 129 128 128 LEU LEU A . n A 1 130 ARG 130 129 129 ARG ARG A . n A 1 131 LEU 131 130 130 LEU LEU A . n A 1 132 LYS 132 131 131 LYS LYS A . n A 1 133 LEU 133 132 132 LEU LEU A . n A 1 134 LYS 134 133 133 LYS LYS A . n A 1 135 VAL 135 134 134 VAL VAL A . n A 1 136 GLU 136 135 135 GLU GLU A . n A 1 137 GLN 137 136 136 GLN GLN A . n A 1 138 HIS 138 137 137 HIS HIS A . n A 1 139 VAL 139 138 138 VAL VAL A . n A 1 140 GLU 140 139 139 GLU GLU A . n A 1 141 LEU 141 140 140 LEU LEU A . n A 1 142 TYR 142 141 141 TYR TYR A . n A 1 143 GLN 143 142 142 GLN GLN A . n A 1 144 LYS 144 143 143 LYS LYS A . n A 1 145 TYR 145 144 144 TYR TYR A . n A 1 146 SER 146 145 145 SER SER A . n A 1 147 ASN 147 146 146 ASN ASN A . n A 1 148 ASN 148 147 147 ASN ASN A . n A 1 149 SER 149 148 148 SER SER A . n A 1 150 TRP 150 149 149 TRP TRP A . n A 1 151 ARG 151 150 150 ARG ARG A . n A 1 152 TYR 152 151 151 TYR TYR A . n A 1 153 LEU 153 152 152 LEU LEU A . n A 1 154 SER 154 153 153 SER SER A . n A 1 155 ASN 155 154 154 ASN ASN A . n A 1 156 ARG 156 155 155 ARG ARG A . n A 1 157 LEU 157 156 156 LEU LEU A . n A 1 158 LEU 158 157 157 LEU LEU A . n A 1 159 ALA 159 158 158 ALA ALA A . n A 1 160 PRO 160 159 159 PRO PRO A . n A 1 161 SER 161 160 160 SER SER A . n A 1 162 ASP 162 161 161 ASP ASP A . n A 1 163 SER 163 162 162 SER SER A . n A 1 164 PRO 164 163 163 PRO PRO A . n A 1 165 GLU 165 164 164 GLU GLU A . n A 1 166 TRP 166 165 165 TRP TRP A . n A 1 167 LEU 167 166 166 LEU LEU A . n A 1 168 SER 168 167 167 SER SER A . n A 1 169 PHE 169 168 168 PHE PHE A . n A 1 170 ASP 170 169 169 ASP ASP A . n A 1 171 VAL 171 170 170 VAL VAL A . n A 1 172 THR 172 171 171 THR THR A . n A 1 173 GLY 173 172 172 GLY GLY A . n A 1 174 VAL 174 173 173 VAL VAL A . n A 1 175 VAL 175 174 174 VAL VAL A . n A 1 176 ARG 176 175 175 ARG ARG A . n A 1 177 GLN 177 176 176 GLN GLN A . n A 1 178 TRP 178 177 177 TRP TRP A . n A 1 179 LEU 179 178 178 LEU LEU A . n A 1 180 SER 180 179 179 SER SER A . n A 1 181 ARG 181 180 180 ARG ARG A . n A 1 182 GLY 182 181 181 GLY GLY A . n A 1 183 GLY 183 182 182 GLY GLY A . n A 1 184 GLU 184 183 183 GLU GLU A . n A 1 185 ILE 185 184 184 ILE ILE A . n A 1 186 GLU 186 185 185 GLU GLU A . n A 1 187 GLY 187 186 186 GLY GLY A . n A 1 188 PHE 188 187 187 PHE PHE A . n A 1 189 ARG 189 188 188 ARG ARG A . n A 1 190 LEU 190 189 189 LEU LEU A . n A 1 191 SER 191 190 190 SER SER A . n A 1 192 ALA 192 191 191 ALA ALA A . n A 1 193 HIS 193 192 192 HIS HIS A . n A 1 194 CYS 194 193 193 CYS CYS A . n A 1 195 SER 195 194 194 SER SER A . n A 1 196 CYS 196 195 195 CYS CYS A . n A 1 197 ASP 197 196 196 ASP ASP A . n A 1 198 SER 198 197 197 SER SER A . n A 1 199 ARG 199 198 198 ARG ARG A . n A 1 200 ASP 200 199 199 ASP ASP A . n A 1 201 ASN 201 200 200 ASN ASN A . n A 1 202 THR 202 201 201 THR THR A . n A 1 203 LEU 203 202 202 LEU LEU A . n A 1 204 GLN 204 203 203 GLN GLN A . n A 1 205 VAL 205 204 204 VAL VAL A . n A 1 206 ASP 206 205 205 ASP ASP A . n A 1 207 ILE 207 206 206 ILE ILE A . n A 1 208 ASN 208 207 207 ASN ASN A . n A 1 209 GLY 209 208 208 GLY GLY A . n A 1 210 PHE 210 209 209 PHE PHE A . n A 1 211 THR 211 210 210 THR THR A . n A 1 212 THR 212 211 211 THR THR A . n A 1 213 GLY 213 212 ? ? ? A . n A 1 214 ARG 214 213 ? ? ? A . n A 1 215 ARG 215 214 214 ARG ARG A . n A 1 216 GLY 216 215 215 GLY GLY A . n A 1 217 ASP 217 216 216 ASP ASP A . n A 1 218 LEU 218 217 217 LEU LEU A . n A 1 219 ALA 219 218 218 ALA ALA A . n A 1 220 THR 220 219 219 THR THR A . n A 1 221 ILE 221 220 220 ILE ILE A . n A 1 222 HIS 222 221 221 HIS HIS A . n A 1 223 GLY 223 222 222 GLY GLY A . n A 1 224 MET 224 223 223 MET MET A . n A 1 225 ASN 225 224 224 ASN ASN A . n A 1 226 ARG 226 225 225 ARG ARG A . n A 1 227 PRO 227 226 226 PRO PRO A . n A 1 228 PHE 228 227 227 PHE PHE A . n A 1 229 LEU 229 228 228 LEU LEU A . n A 1 230 LEU 230 229 229 LEU LEU A . n A 1 231 LEU 231 230 230 LEU LEU A . n A 1 232 MET 232 231 231 MET MET A . n A 1 233 ALA 233 232 232 ALA ALA A . n A 1 234 THR 234 233 233 THR THR A . n A 1 235 PRO 235 234 234 PRO PRO A . n A 1 236 LEU 236 235 235 LEU LEU A . n A 1 237 GLU 237 236 236 GLU GLU A . n A 1 238 ARG 238 237 237 ARG ARG A . n A 1 239 ALA 239 238 238 ALA ALA A . n A 1 240 GLN 240 239 ? ? ? A . n A 1 241 HIS 241 240 ? ? ? A . n A 1 242 LEU 242 241 ? ? ? A . n A 1 243 GLN 243 242 ? ? ? A . n A 1 244 SER 244 243 ? ? ? A . n A 1 245 SER 245 244 ? ? ? A . n A 1 246 ARG 246 245 ? ? ? A . n A 1 247 HIS 247 246 ? ? ? A . n A 1 248 ARG 248 247 ? ? ? A . n A 1 249 ALA 249 248 ? ? ? A . n A 1 250 HIS 250 249 ? ? ? A . n A 1 251 HIS 251 250 ? ? ? A . n A 1 252 HIS 252 251 ? ? ? A . n A 1 253 HIS 253 252 ? ? ? A . n A 1 254 HIS 254 253 ? ? ? A . n A 1 255 HIS 255 254 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2230 ? 1 MORE -1 ? 1 'SSA (A^2)' 17590 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_556 -x,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 62.2500000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2020-03-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.15rc3_3435 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? MR-Rosetta ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.3 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 86 ? ? 179.15 177.81 2 1 ILE A 90 ? ? -127.92 -169.50 3 1 TYR A 91 ? ? -67.87 62.91 4 1 VAL A 114 ? ? 59.64 72.98 5 1 LEU A 130 ? ? -140.20 25.69 6 1 ASN A 146 ? ? -48.26 150.70 7 1 ASP A 216 ? ? -142.11 22.79 8 1 PRO A 226 ? ? -48.96 151.72 9 1 LEU A 235 ? ? 70.82 -7.43 10 1 GLU A 236 ? ? 172.68 163.57 11 1 ARG A 237 ? ? -144.58 39.42 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 236 ? CG ? A GLU 237 CG 2 1 Y 1 A GLU 236 ? CD ? A GLU 237 CD 3 1 Y 1 A GLU 236 ? OE1 ? A GLU 237 OE1 4 1 Y 1 A GLU 236 ? OE2 ? A GLU 237 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 0 ? A LEU 1 2 1 Y 1 A SER 1 ? A SER 2 3 1 Y 1 A THR 2 ? A THR 3 4 1 Y 1 A CYS 3 ? A CYS 4 5 1 Y 1 A LYS 4 ? A LYS 5 6 1 Y 1 A THR 5 ? A THR 6 7 1 Y 1 A ILE 6 ? A ILE 7 8 1 Y 1 A ASP 7 ? A ASP 8 9 1 Y 1 A MET 8 ? A MET 9 10 1 Y 1 A GLU 9 ? A GLU 10 11 1 Y 1 A LEU 10 ? A LEU 11 12 1 Y 1 A VAL 11 ? A VAL 12 13 1 Y 1 A LYS 12 ? A LYS 13 14 1 Y 1 A ARG 13 ? A ARG 14 15 1 Y 1 A LYS 14 ? A LYS 15 16 1 Y 1 A ARG 15 ? A ARG 16 17 1 Y 1 A ILE 16 ? A ILE 17 18 1 Y 1 A GLU 17 ? A GLU 18 19 1 Y 1 A ALA 18 ? A ALA 19 20 1 Y 1 A ILE 19 ? A ILE 20 21 1 Y 1 A ARG 20 ? A ARG 21 22 1 Y 1 A GLY 21 ? A GLY 22 23 1 Y 1 A GLN 22 ? A GLN 23 24 1 Y 1 A ILE 23 ? A ILE 24 25 1 Y 1 A LEU 24 ? A LEU 25 26 1 Y 1 A SER 25 ? A SER 26 27 1 Y 1 A LYS 26 ? A LYS 27 28 1 Y 1 A LEU 27 ? A LEU 28 29 1 Y 1 A ARG 28 ? A ARG 29 30 1 Y 1 A LEU 29 ? A LEU 30 31 1 Y 1 A ALA 30 ? A ALA 31 32 1 Y 1 A SER 31 ? A SER 32 33 1 Y 1 A PRO 32 ? A PRO 33 34 1 Y 1 A PRO 33 ? A PRO 34 35 1 Y 1 A SER 34 ? A SER 35 36 1 Y 1 A GLN 35 ? A GLN 36 37 1 Y 1 A GLY 36 ? A GLY 37 38 1 Y 1 A GLU 37 ? A GLU 38 39 1 Y 1 A VAL 38 ? A VAL 39 40 1 Y 1 A PRO 39 ? A PRO 40 41 1 Y 1 A PRO 40 ? A PRO 41 42 1 Y 1 A GLY 41 ? A GLY 42 43 1 Y 1 A PRO 42 ? A PRO 43 44 1 Y 1 A LEU 43 ? A LEU 44 45 1 Y 1 A PRO 44 ? A PRO 45 46 1 Y 1 A GLU 45 ? A GLU 46 47 1 Y 1 A ALA 46 ? A ALA 47 48 1 Y 1 A VAL 47 ? A VAL 48 49 1 Y 1 A LEU 48 ? A LEU 49 50 1 Y 1 A ALA 49 ? A ALA 50 51 1 Y 1 A LEU 50 ? A LEU 51 52 1 Y 1 A TYR 51 ? A TYR 52 53 1 Y 1 A ASN 52 ? A ASN 53 54 1 Y 1 A SER 53 ? A SER 54 55 1 Y 1 A THR 54 ? A THR 55 56 1 Y 1 A ARG 55 ? A ARG 56 57 1 Y 1 A ASP 56 ? A ASP 57 58 1 Y 1 A ARG 57 ? A ARG 58 59 1 Y 1 A VAL 58 ? A VAL 59 60 1 Y 1 A ALA 59 ? A ALA 60 61 1 Y 1 A GLY 60 ? A GLY 61 62 1 Y 1 A GLU 61 ? A GLU 62 63 1 Y 1 A SER 62 ? A SER 63 64 1 Y 1 A ALA 63 ? A ALA 64 65 1 Y 1 A GLU 64 ? A GLU 65 66 1 Y 1 A PRO 65 ? A PRO 66 67 1 Y 1 A GLU 66 ? A GLU 67 68 1 Y 1 A PRO 67 ? A PRO 68 69 1 Y 1 A GLU 68 ? A GLU 69 70 1 Y 1 A PRO 69 ? A PRO 70 71 1 Y 1 A GLU 70 ? A GLU 71 72 1 Y 1 A ALA 71 ? A ALA 72 73 1 Y 1 A ASP 72 ? A ASP 73 74 1 Y 1 A TYR 73 ? A TYR 74 75 1 Y 1 A TYR 74 ? A TYR 75 76 1 Y 1 A ALA 75 ? A ALA 76 77 1 Y 1 A SER 97 ? A SER 98 78 1 Y 1 A THR 98 ? A THR 99 79 1 Y 1 A GLY 212 ? A GLY 213 80 1 Y 1 A ARG 213 ? A ARG 214 81 1 Y 1 A GLN 239 ? A GLN 240 82 1 Y 1 A HIS 240 ? A HIS 241 83 1 Y 1 A LEU 241 ? A LEU 242 84 1 Y 1 A GLN 242 ? A GLN 243 85 1 Y 1 A SER 243 ? A SER 244 86 1 Y 1 A SER 244 ? A SER 245 87 1 Y 1 A ARG 245 ? A ARG 246 88 1 Y 1 A HIS 246 ? A HIS 247 89 1 Y 1 A ARG 247 ? A ARG 248 90 1 Y 1 A ALA 248 ? A ALA 249 91 1 Y 1 A HIS 249 ? A HIS 250 92 1 Y 1 A HIS 250 ? A HIS 251 93 1 Y 1 A HIS 251 ? A HIS 252 94 1 Y 1 A HIS 252 ? A HIS 253 95 1 Y 1 A HIS 253 ? A HIS 254 96 1 Y 1 A HIS 254 ? A HIS 255 # _pdbx_audit_support.funding_organization 'National Science Foundation (NSF, United States)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 1231306 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support SAXS _pdbx_struct_assembly_auth_evidence.details ? #