data_6PL1 # _entry.id 6PL1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.317 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6PL1 WWPDB D_1000242699 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6PL1 _pdbx_database_status.recvd_initial_deposition_date 2019-06-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Subramanian, G.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Bioorg.Med.Chem.Lett. _citation.journal_id_ASTM BMCLE8 _citation.journal_id_CSD 1127 _citation.journal_id_ISSN 1464-3405 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 29 _citation.language ? _citation.page_first 126680 _citation.page_last 126680 _citation.title 'Lead identification and characterization of hTrkA type 2 inhibitors.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bmcl.2019.126680 _citation.pdbx_database_id_PubMed 31610943 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Subramanian, G.' 1 ? primary 'Zhu, Y.' 2 ? primary 'Bowen, S.J.' 3 ? primary 'Roush, N.' 4 ? primary 'White, J.A.' 5 ? primary 'Huczek, D.' 6 ? primary 'Zachary, T.' 7 ? primary 'Javens, C.' 8 ? primary 'Williams, T.' 9 ? primary 'Janssen, A.' 10 ? primary 'Gonzales, A.' 11 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6PL1 _cell.details ? _cell.formula_units_Z ? _cell.length_a 51.915 _cell.length_a_esd ? _cell.length_b 51.915 _cell.length_b_esd ? _cell.length_c 229.322 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6PL1 _symmetry.cell_setting ? _symmetry.Int_Tables_number 151 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 1 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'High affinity nerve growth factor receptor' 35428.723 1 2.7.10.1 ? 'KINASE DOMAIN' ? 2 non-polymer syn "N-(5-{[(7-methyl-4-oxo-4H-pyrido[1,2-a]pyrimidin-2-yl)methyl]sulfanyl}-1,3,4-thiadiazol-2-yl)-N'-[3-(trifluoromethyl)phenyl]urea" 492.497 1 ? ? ? ? 3 water nat water 18.015 57 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Neurotrophic tyrosine kinase receptor type 1,TRK1-transforming tyrosine kinase protein,Tropomyosin-related kinase A,Tyrosine kinase receptor,Tyrosine kinase receptor A,Trk-A,gp140trk,p140-TrkA ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELL TMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGL HFVHRDLATRNCLVGQGLVVKIGDFGMSRDIY(SEP)TDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEI FTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVL ; _entity_poly.pdbx_seq_one_letter_code_can ;GLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELL TMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGL HFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYG KQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 LEU n 1 3 GLN n 1 4 GLY n 1 5 HIS n 1 6 ILE n 1 7 ILE n 1 8 GLU n 1 9 ASN n 1 10 PRO n 1 11 GLN n 1 12 TYR n 1 13 PHE n 1 14 SER n 1 15 ASP n 1 16 ALA n 1 17 CYS n 1 18 VAL n 1 19 HIS n 1 20 HIS n 1 21 ILE n 1 22 LYS n 1 23 ARG n 1 24 ARG n 1 25 ASP n 1 26 ILE n 1 27 VAL n 1 28 LEU n 1 29 LYS n 1 30 TRP n 1 31 GLU n 1 32 LEU n 1 33 GLY n 1 34 GLU n 1 35 GLY n 1 36 ALA n 1 37 PHE n 1 38 GLY n 1 39 LYS n 1 40 VAL n 1 41 PHE n 1 42 LEU n 1 43 ALA n 1 44 GLU n 1 45 CYS n 1 46 HIS n 1 47 ASN n 1 48 LEU n 1 49 LEU n 1 50 PRO n 1 51 GLU n 1 52 GLN n 1 53 ASP n 1 54 LYS n 1 55 MET n 1 56 LEU n 1 57 VAL n 1 58 ALA n 1 59 VAL n 1 60 LYS n 1 61 ALA n 1 62 LEU n 1 63 LYS n 1 64 GLU n 1 65 ALA n 1 66 SER n 1 67 GLU n 1 68 SER n 1 69 ALA n 1 70 ARG n 1 71 GLN n 1 72 ASP n 1 73 PHE n 1 74 GLN n 1 75 ARG n 1 76 GLU n 1 77 ALA n 1 78 GLU n 1 79 LEU n 1 80 LEU n 1 81 THR n 1 82 MET n 1 83 LEU n 1 84 GLN n 1 85 HIS n 1 86 GLN n 1 87 HIS n 1 88 ILE n 1 89 VAL n 1 90 ARG n 1 91 PHE n 1 92 PHE n 1 93 GLY n 1 94 VAL n 1 95 CYS n 1 96 THR n 1 97 GLU n 1 98 GLY n 1 99 ARG n 1 100 PRO n 1 101 LEU n 1 102 LEU n 1 103 MET n 1 104 VAL n 1 105 PHE n 1 106 GLU n 1 107 TYR n 1 108 MET n 1 109 ARG n 1 110 HIS n 1 111 GLY n 1 112 ASP n 1 113 LEU n 1 114 ASN n 1 115 ARG n 1 116 PHE n 1 117 LEU n 1 118 ARG n 1 119 SER n 1 120 HIS n 1 121 GLY n 1 122 PRO n 1 123 ASP n 1 124 ALA n 1 125 LYS n 1 126 LEU n 1 127 LEU n 1 128 ALA n 1 129 GLY n 1 130 GLY n 1 131 GLU n 1 132 ASP n 1 133 VAL n 1 134 ALA n 1 135 PRO n 1 136 GLY n 1 137 PRO n 1 138 LEU n 1 139 GLY n 1 140 LEU n 1 141 GLY n 1 142 GLN n 1 143 LEU n 1 144 LEU n 1 145 ALA n 1 146 VAL n 1 147 ALA n 1 148 SER n 1 149 GLN n 1 150 VAL n 1 151 ALA n 1 152 ALA n 1 153 GLY n 1 154 MET n 1 155 VAL n 1 156 TYR n 1 157 LEU n 1 158 ALA n 1 159 GLY n 1 160 LEU n 1 161 HIS n 1 162 PHE n 1 163 VAL n 1 164 HIS n 1 165 ARG n 1 166 ASP n 1 167 LEU n 1 168 ALA n 1 169 THR n 1 170 ARG n 1 171 ASN n 1 172 CYS n 1 173 LEU n 1 174 VAL n 1 175 GLY n 1 176 GLN n 1 177 GLY n 1 178 LEU n 1 179 VAL n 1 180 VAL n 1 181 LYS n 1 182 ILE n 1 183 GLY n 1 184 ASP n 1 185 PHE n 1 186 GLY n 1 187 MET n 1 188 SER n 1 189 ARG n 1 190 ASP n 1 191 ILE n 1 192 TYR n 1 193 SEP n 1 194 THR n 1 195 ASP n 1 196 TYR n 1 197 TYR n 1 198 ARG n 1 199 VAL n 1 200 GLY n 1 201 GLY n 1 202 ARG n 1 203 THR n 1 204 MET n 1 205 LEU n 1 206 PRO n 1 207 ILE n 1 208 ARG n 1 209 TRP n 1 210 MET n 1 211 PRO n 1 212 PRO n 1 213 GLU n 1 214 SER n 1 215 ILE n 1 216 LEU n 1 217 TYR n 1 218 ARG n 1 219 LYS n 1 220 PHE n 1 221 THR n 1 222 THR n 1 223 GLU n 1 224 SER n 1 225 ASP n 1 226 VAL n 1 227 TRP n 1 228 SER n 1 229 PHE n 1 230 GLY n 1 231 VAL n 1 232 VAL n 1 233 LEU n 1 234 TRP n 1 235 GLU n 1 236 ILE n 1 237 PHE n 1 238 THR n 1 239 TYR n 1 240 GLY n 1 241 LYS n 1 242 GLN n 1 243 PRO n 1 244 TRP n 1 245 TYR n 1 246 GLN n 1 247 LEU n 1 248 SER n 1 249 ASN n 1 250 THR n 1 251 GLU n 1 252 ALA n 1 253 ILE n 1 254 ASP n 1 255 CYS n 1 256 ILE n 1 257 THR n 1 258 GLN n 1 259 GLY n 1 260 ARG n 1 261 GLU n 1 262 LEU n 1 263 GLU n 1 264 ARG n 1 265 PRO n 1 266 ARG n 1 267 ALA n 1 268 CYS n 1 269 PRO n 1 270 PRO n 1 271 GLU n 1 272 VAL n 1 273 TYR n 1 274 ALA n 1 275 ILE n 1 276 MET n 1 277 ARG n 1 278 GLY n 1 279 CYS n 1 280 TRP n 1 281 GLN n 1 282 ARG n 1 283 GLU n 1 284 PRO n 1 285 GLN n 1 286 GLN n 1 287 ARG n 1 288 HIS n 1 289 SER n 1 290 ILE n 1 291 LYS n 1 292 ASP n 1 293 VAL n 1 294 HIS n 1 295 ALA n 1 296 ARG n 1 297 LEU n 1 298 GLN n 1 299 ALA n 1 300 LEU n 1 301 ALA n 1 302 GLN n 1 303 ALA n 1 304 PRO n 1 305 PRO n 1 306 VAL n 1 307 TYR n 1 308 LEU n 1 309 ASP n 1 310 VAL n 1 311 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 311 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'NTRK1, MTC, TRK, TRKA' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NTRK1_HUMAN _struct_ref.pdbx_db_accession P04629 _struct_ref.pdbx_db_isoform P04629-4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELL TMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGL HFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYG KQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVL ; _struct_ref.pdbx_align_begin 387 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6PL1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 311 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P04629 _struct_ref_seq.db_align_beg 387 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 697 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 485 _struct_ref_seq.pdbx_auth_seq_align_end 795 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 OOJ non-polymer . "N-(5-{[(7-methyl-4-oxo-4H-pyrido[1,2-a]pyrimidin-2-yl)methyl]sulfanyl}-1,3,4-thiadiazol-2-yl)-N'-[3-(trifluoromethyl)phenyl]urea" ? 'C20 H15 F3 N6 O2 S2' 492.497 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6PL1 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.68 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.12 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20mM Tris/HCl, pH=8.5, 50mM NaCl, 2mM DTT, 0.5mM PMSF' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-11-15 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6PL1 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.03 _reflns.d_resolution_low 76.44 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 23189 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I 0.0 _reflns.percent_possible_obs 97.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.6 _reflns.pdbx_Rmerge_I_obs 0.032 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 22.51 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.03 _reflns_shell.d_res_low 2.27 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 95.1 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.4410 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.6 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.31 _refine.aniso_B[1][2] 0.15 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] 0.31 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] -0.99 _refine.B_iso_max ? _refine.B_iso_mean 44.938 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.953 _refine.correlation_coeff_Fo_to_Fc_free 0.936 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6PL1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.03 _refine.ls_d_res_low 45.0 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 21335 _refine.ls_number_reflns_R_free 1815 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.69 _refine.ls_percent_reflns_R_free 7.8 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.22008 _refine.ls_R_factor_R_free 0.26029 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.21688 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.203 _refine.pdbx_overall_ESU_R_Free 0.182 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 5.331 _refine.overall_SU_ML 0.141 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.03 _refine_hist.d_res_low 76.44 _refine_hist.number_atoms_solvent 57 _refine_hist.number_atoms_total 2419 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2329 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 33 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.019 2375 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 2245 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.293 1.971 3237 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 2.578 3.000 5126 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.226 5.000 295 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 34.207 23.030 99 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 12.265 15.000 372 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 16.173 15.000 15 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.072 0.200 353 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 0.021 2725 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.004 0.020 565 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 4.738 5.884 1177 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.737 5.882 1176 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 5.716 9.905 1473 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 5.715 9.909 1474 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 5.814 6.427 1196 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 5.811 6.428 1197 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 7.297 10.617 1764 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 8.244 26.542 2641 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 8.241 26.528 2631 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.030 _refine_ls_shell.d_res_low 2.083 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 151 _refine_ls_shell.number_reflns_R_work 1590 _refine_ls_shell.percent_reflns_obs 99.49 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.388 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.317 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6PL1 _struct.title 'TRK-A IN COMPLEX WITH LIGAND 1B' _struct.pdbx_descriptor 'High affinity nerve growth factor receptor (E.C.2.7.10.1)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6PL1 _struct_keywords.text 'TRK-A KINASE DOMAIN HIGH AFFINITY NERVE GROWTH FACTOR RECEPTOR, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 22 ? ARG A 24 ? LYS A 506 ARG A 508 5 ? 3 HELX_P HELX_P2 AA2 ALA A 69 ? LEU A 83 ? ALA A 553 LEU A 567 1 ? 15 HELX_P HELX_P3 AA3 LEU A 113 ? HIS A 120 ? LEU A 597 HIS A 604 1 ? 8 HELX_P HELX_P4 AA4 LYS A 125 ? GLY A 129 ? LYS A 609 GLY A 613 5 ? 5 HELX_P HELX_P5 AA5 GLY A 139 ? LEU A 160 ? GLY A 623 LEU A 644 1 ? 22 HELX_P HELX_P6 AA6 ALA A 168 ? ARG A 170 ? ALA A 652 ARG A 654 5 ? 3 HELX_P HELX_P7 AA7 GLN A 176 ? LEU A 178 ? GLN A 660 LEU A 662 5 ? 3 HELX_P HELX_P8 AA8 MET A 187 ? TYR A 192 ? MET A 671 TYR A 676 1 ? 6 HELX_P HELX_P9 AA9 SEP A 193 ? TYR A 196 ? SEP A 677 TYR A 680 5 ? 4 HELX_P HELX_P10 AB1 PRO A 206 ? MET A 210 ? PRO A 690 MET A 694 5 ? 5 HELX_P HELX_P11 AB2 PRO A 211 ? ARG A 218 ? PRO A 695 ARG A 702 1 ? 8 HELX_P HELX_P12 AB3 THR A 221 ? THR A 238 ? THR A 705 THR A 722 1 ? 18 HELX_P HELX_P13 AB4 SER A 248 ? GLN A 258 ? SER A 732 GLN A 742 1 ? 11 HELX_P HELX_P14 AB5 PRO A 269 ? TRP A 280 ? PRO A 753 TRP A 764 1 ? 12 HELX_P HELX_P15 AB6 GLU A 283 ? ARG A 287 ? GLU A 767 ARG A 771 5 ? 5 HELX_P HELX_P16 AB7 SER A 289 ? GLN A 302 ? SER A 773 GLN A 786 1 ? 14 HELX_P HELX_P17 AB8 PRO A 304 ? ASP A 309 ? PRO A 788 ASP A 793 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A TYR 192 C ? ? ? 1_555 A SEP 193 N ? ? A TYR 676 A SEP 677 1_555 ? ? ? ? ? ? ? 1.323 ? covale2 covale both ? A SEP 193 C ? ? ? 1_555 A THR 194 N ? ? A SEP 677 A THR 678 1_555 ? ? ? ? ? ? ? 1.334 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ARG _struct_mon_prot_cis.label_seq_id 99 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ARG _struct_mon_prot_cis.auth_seq_id 583 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 100 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 584 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.21 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 26 ? GLU A 34 ? ILE A 510 GLU A 518 AA1 2 GLY A 38 ? HIS A 46 ? GLY A 522 HIS A 530 AA1 3 LYS A 54 ? LEU A 62 ? LYS A 538 LEU A 546 AA1 4 LEU A 102 ? GLU A 106 ? LEU A 586 GLU A 590 AA1 5 PHE A 91 ? CYS A 95 ? PHE A 575 CYS A 579 AA2 1 GLY A 111 ? ASP A 112 ? GLY A 595 ASP A 596 AA2 2 CYS A 172 ? VAL A 174 ? CYS A 656 VAL A 658 AA2 3 VAL A 180 ? ILE A 182 ? VAL A 664 ILE A 666 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TRP A 30 ? N TRP A 514 O LEU A 42 ? O LEU A 526 AA1 2 3 N PHE A 41 ? N PHE A 525 O VAL A 59 ? O VAL A 543 AA1 3 4 N ALA A 58 ? N ALA A 542 O PHE A 105 ? O PHE A 589 AA1 4 5 O VAL A 104 ? O VAL A 588 N PHE A 92 ? N PHE A 576 AA2 1 2 N GLY A 111 ? N GLY A 595 O VAL A 174 ? O VAL A 658 AA2 2 3 N LEU A 173 ? N LEU A 657 O LYS A 181 ? O LYS A 665 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id OOJ _struct_site.pdbx_auth_seq_id 801 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 17 _struct_site.details 'binding site for residue OOJ A 801' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 17 ALA A 58 ? ALA A 542 . ? 1_555 ? 2 AC1 17 LYS A 60 ? LYS A 544 . ? 1_555 ? 3 AC1 17 GLU A 76 ? GLU A 560 . ? 1_555 ? 4 AC1 17 LEU A 83 ? LEU A 567 . ? 1_555 ? 5 AC1 17 ILE A 88 ? ILE A 572 . ? 1_555 ? 6 AC1 17 PHE A 105 ? PHE A 589 . ? 1_555 ? 7 AC1 17 GLU A 106 ? GLU A 590 . ? 1_555 ? 8 AC1 17 TYR A 107 ? TYR A 591 . ? 1_555 ? 9 AC1 17 MET A 108 ? MET A 592 . ? 1_555 ? 10 AC1 17 LEU A 157 ? LEU A 641 . ? 1_555 ? 11 AC1 17 PHE A 162 ? PHE A 646 . ? 1_555 ? 12 AC1 17 HIS A 164 ? HIS A 648 . ? 1_555 ? 13 AC1 17 LEU A 173 ? LEU A 657 . ? 1_555 ? 14 AC1 17 ILE A 182 ? ILE A 666 . ? 1_555 ? 15 AC1 17 GLY A 183 ? GLY A 667 . ? 1_555 ? 16 AC1 17 ASP A 184 ? ASP A 668 . ? 1_555 ? 17 AC1 17 PHE A 185 ? PHE A 669 . ? 1_555 ? # _atom_sites.entry_id 6PL1 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.019262 _atom_sites.fract_transf_matrix[1][2] 0.011121 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022242 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004361 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C F N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 485 ? ? ? A . n A 1 2 LEU 2 486 ? ? ? A . n A 1 3 GLN 3 487 ? ? ? A . n A 1 4 GLY 4 488 ? ? ? A . n A 1 5 HIS 5 489 ? ? ? A . n A 1 6 ILE 6 490 ? ? ? A . n A 1 7 ILE 7 491 ? ? ? A . n A 1 8 GLU 8 492 ? ? ? A . n A 1 9 ASN 9 493 ? ? ? A . n A 1 10 PRO 10 494 ? ? ? A . n A 1 11 GLN 11 495 ? ? ? A . n A 1 12 TYR 12 496 ? ? ? A . n A 1 13 PHE 13 497 ? ? ? A . n A 1 14 SER 14 498 ? ? ? A . n A 1 15 ASP 15 499 ? ? ? A . n A 1 16 ALA 16 500 500 ALA ALA A . n A 1 17 CYS 17 501 501 CYS CYS A . n A 1 18 VAL 18 502 502 VAL VAL A . n A 1 19 HIS 19 503 503 HIS HIS A . n A 1 20 HIS 20 504 504 HIS HIS A . n A 1 21 ILE 21 505 505 ILE ILE A . n A 1 22 LYS 22 506 506 LYS LYS A . n A 1 23 ARG 23 507 507 ARG ARG A . n A 1 24 ARG 24 508 508 ARG ARG A . n A 1 25 ASP 25 509 509 ASP ASP A . n A 1 26 ILE 26 510 510 ILE ILE A . n A 1 27 VAL 27 511 511 VAL VAL A . n A 1 28 LEU 28 512 512 LEU LEU A . n A 1 29 LYS 29 513 513 LYS LYS A . n A 1 30 TRP 30 514 514 TRP TRP A . n A 1 31 GLU 31 515 515 GLU GLU A . n A 1 32 LEU 32 516 516 LEU LEU A . n A 1 33 GLY 33 517 517 GLY GLY A . n A 1 34 GLU 34 518 518 GLU GLU A . n A 1 35 GLY 35 519 519 GLY GLY A . n A 1 36 ALA 36 520 520 ALA ALA A . n A 1 37 PHE 37 521 521 PHE PHE A . n A 1 38 GLY 38 522 522 GLY GLY A . n A 1 39 LYS 39 523 523 LYS LYS A . n A 1 40 VAL 40 524 524 VAL VAL A . n A 1 41 PHE 41 525 525 PHE PHE A . n A 1 42 LEU 42 526 526 LEU LEU A . n A 1 43 ALA 43 527 527 ALA ALA A . n A 1 44 GLU 44 528 528 GLU GLU A . n A 1 45 CYS 45 529 529 CYS CYS A . n A 1 46 HIS 46 530 530 HIS HIS A . n A 1 47 ASN 47 531 531 ASN ASN A . n A 1 48 LEU 48 532 532 LEU LEU A . n A 1 49 LEU 49 533 533 LEU LEU A . n A 1 50 PRO 50 534 534 PRO PRO A . n A 1 51 GLU 51 535 535 GLU GLU A . n A 1 52 GLN 52 536 536 GLN GLN A . n A 1 53 ASP 53 537 537 ASP ASP A . n A 1 54 LYS 54 538 538 LYS LYS A . n A 1 55 MET 55 539 539 MET MET A . n A 1 56 LEU 56 540 540 LEU LEU A . n A 1 57 VAL 57 541 541 VAL VAL A . n A 1 58 ALA 58 542 542 ALA ALA A . n A 1 59 VAL 59 543 543 VAL VAL A . n A 1 60 LYS 60 544 544 LYS LYS A . n A 1 61 ALA 61 545 545 ALA ALA A . n A 1 62 LEU 62 546 546 LEU LEU A . n A 1 63 LYS 63 547 547 LYS LYS A . n A 1 64 GLU 64 548 548 GLU GLU A . n A 1 65 ALA 65 549 ? ? ? A . n A 1 66 SER 66 550 ? ? ? A . n A 1 67 GLU 67 551 ? ? ? A . n A 1 68 SER 68 552 552 SER SER A . n A 1 69 ALA 69 553 553 ALA ALA A . n A 1 70 ARG 70 554 554 ARG ARG A . n A 1 71 GLN 71 555 555 GLN GLN A . n A 1 72 ASP 72 556 556 ASP ASP A . n A 1 73 PHE 73 557 557 PHE PHE A . n A 1 74 GLN 74 558 558 GLN GLN A . n A 1 75 ARG 75 559 559 ARG ARG A . n A 1 76 GLU 76 560 560 GLU GLU A . n A 1 77 ALA 77 561 561 ALA ALA A . n A 1 78 GLU 78 562 562 GLU GLU A . n A 1 79 LEU 79 563 563 LEU LEU A . n A 1 80 LEU 80 564 564 LEU LEU A . n A 1 81 THR 81 565 565 THR THR A . n A 1 82 MET 82 566 566 MET MET A . n A 1 83 LEU 83 567 567 LEU LEU A . n A 1 84 GLN 84 568 568 GLN GLN A . n A 1 85 HIS 85 569 569 HIS HIS A . n A 1 86 GLN 86 570 570 GLN GLN A . n A 1 87 HIS 87 571 571 HIS HIS A . n A 1 88 ILE 88 572 572 ILE ILE A . n A 1 89 VAL 89 573 573 VAL VAL A . n A 1 90 ARG 90 574 574 ARG ARG A . n A 1 91 PHE 91 575 575 PHE PHE A . n A 1 92 PHE 92 576 576 PHE PHE A . n A 1 93 GLY 93 577 577 GLY GLY A . n A 1 94 VAL 94 578 578 VAL VAL A . n A 1 95 CYS 95 579 579 CYS CYS A . n A 1 96 THR 96 580 580 THR THR A . n A 1 97 GLU 97 581 581 GLU GLU A . n A 1 98 GLY 98 582 582 GLY GLY A . n A 1 99 ARG 99 583 583 ARG ARG A . n A 1 100 PRO 100 584 584 PRO PRO A . n A 1 101 LEU 101 585 585 LEU LEU A . n A 1 102 LEU 102 586 586 LEU LEU A . n A 1 103 MET 103 587 587 MET MET A . n A 1 104 VAL 104 588 588 VAL VAL A . n A 1 105 PHE 105 589 589 PHE PHE A . n A 1 106 GLU 106 590 590 GLU GLU A . n A 1 107 TYR 107 591 591 TYR TYR A . n A 1 108 MET 108 592 592 MET MET A . n A 1 109 ARG 109 593 593 ARG ARG A . n A 1 110 HIS 110 594 594 HIS HIS A . n A 1 111 GLY 111 595 595 GLY GLY A . n A 1 112 ASP 112 596 596 ASP ASP A . n A 1 113 LEU 113 597 597 LEU LEU A . n A 1 114 ASN 114 598 598 ASN ASN A . n A 1 115 ARG 115 599 599 ARG ARG A . n A 1 116 PHE 116 600 600 PHE PHE A . n A 1 117 LEU 117 601 601 LEU LEU A . n A 1 118 ARG 118 602 602 ARG ARG A . n A 1 119 SER 119 603 603 SER SER A . n A 1 120 HIS 120 604 604 HIS HIS A . n A 1 121 GLY 121 605 605 GLY GLY A . n A 1 122 PRO 122 606 606 PRO PRO A . n A 1 123 ASP 123 607 607 ASP ASP A . n A 1 124 ALA 124 608 608 ALA ALA A . n A 1 125 LYS 125 609 609 LYS LYS A . n A 1 126 LEU 126 610 610 LEU LEU A . n A 1 127 LEU 127 611 611 LEU LEU A . n A 1 128 ALA 128 612 612 ALA ALA A . n A 1 129 GLY 129 613 613 GLY GLY A . n A 1 130 GLY 130 614 614 GLY GLY A . n A 1 131 GLU 131 615 615 GLU GLU A . n A 1 132 ASP 132 616 616 ASP ASP A . n A 1 133 VAL 133 617 617 VAL VAL A . n A 1 134 ALA 134 618 618 ALA ALA A . n A 1 135 PRO 135 619 619 PRO PRO A . n A 1 136 GLY 136 620 620 GLY GLY A . n A 1 137 PRO 137 621 621 PRO PRO A . n A 1 138 LEU 138 622 622 LEU LEU A . n A 1 139 GLY 139 623 623 GLY GLY A . n A 1 140 LEU 140 624 624 LEU LEU A . n A 1 141 GLY 141 625 625 GLY GLY A . n A 1 142 GLN 142 626 626 GLN GLN A . n A 1 143 LEU 143 627 627 LEU LEU A . n A 1 144 LEU 144 628 628 LEU LEU A . n A 1 145 ALA 145 629 629 ALA ALA A . n A 1 146 VAL 146 630 630 VAL VAL A . n A 1 147 ALA 147 631 631 ALA ALA A . n A 1 148 SER 148 632 632 SER SER A . n A 1 149 GLN 149 633 633 GLN GLN A . n A 1 150 VAL 150 634 634 VAL VAL A . n A 1 151 ALA 151 635 635 ALA ALA A . n A 1 152 ALA 152 636 636 ALA ALA A . n A 1 153 GLY 153 637 637 GLY GLY A . n A 1 154 MET 154 638 638 MET MET A . n A 1 155 VAL 155 639 639 VAL VAL A . n A 1 156 TYR 156 640 640 TYR TYR A . n A 1 157 LEU 157 641 641 LEU LEU A . n A 1 158 ALA 158 642 642 ALA ALA A . n A 1 159 GLY 159 643 643 GLY GLY A . n A 1 160 LEU 160 644 644 LEU LEU A . n A 1 161 HIS 161 645 645 HIS HIS A . n A 1 162 PHE 162 646 646 PHE PHE A . n A 1 163 VAL 163 647 647 VAL VAL A . n A 1 164 HIS 164 648 648 HIS HIS A . n A 1 165 ARG 165 649 649 ARG ARG A . n A 1 166 ASP 166 650 650 ASP ASP A . n A 1 167 LEU 167 651 651 LEU LEU A . n A 1 168 ALA 168 652 652 ALA ALA A . n A 1 169 THR 169 653 653 THR THR A . n A 1 170 ARG 170 654 654 ARG ARG A . n A 1 171 ASN 171 655 655 ASN ASN A . n A 1 172 CYS 172 656 656 CYS CYS A . n A 1 173 LEU 173 657 657 LEU LEU A . n A 1 174 VAL 174 658 658 VAL VAL A . n A 1 175 GLY 175 659 659 GLY GLY A . n A 1 176 GLN 176 660 660 GLN GLN A . n A 1 177 GLY 177 661 661 GLY GLY A . n A 1 178 LEU 178 662 662 LEU LEU A . n A 1 179 VAL 179 663 663 VAL VAL A . n A 1 180 VAL 180 664 664 VAL VAL A . n A 1 181 LYS 181 665 665 LYS LYS A . n A 1 182 ILE 182 666 666 ILE ILE A . n A 1 183 GLY 183 667 667 GLY GLY A . n A 1 184 ASP 184 668 668 ASP ASP A . n A 1 185 PHE 185 669 669 PHE PHE A . n A 1 186 GLY 186 670 670 GLY GLY A . n A 1 187 MET 187 671 671 MET MET A . n A 1 188 SER 188 672 672 SER SER A . n A 1 189 ARG 189 673 673 ARG ARG A . n A 1 190 ASP 190 674 674 ASP ASP A . n A 1 191 ILE 191 675 675 ILE ILE A . n A 1 192 TYR 192 676 676 TYR TYR A . n A 1 193 SEP 193 677 677 SEP SEP A . n A 1 194 THR 194 678 678 THR THR A . n A 1 195 ASP 195 679 679 ASP ASP A . n A 1 196 TYR 196 680 680 TYR TYR A . n A 1 197 TYR 197 681 681 TYR TYR A . n A 1 198 ARG 198 682 682 ARG ARG A . n A 1 199 VAL 199 683 683 VAL VAL A . n A 1 200 GLY 200 684 ? ? ? A . n A 1 201 GLY 201 685 ? ? ? A . n A 1 202 ARG 202 686 ? ? ? A . n A 1 203 THR 203 687 687 THR THR A . n A 1 204 MET 204 688 688 MET MET A . n A 1 205 LEU 205 689 689 LEU LEU A . n A 1 206 PRO 206 690 690 PRO PRO A . n A 1 207 ILE 207 691 691 ILE ILE A . n A 1 208 ARG 208 692 692 ARG ARG A . n A 1 209 TRP 209 693 693 TRP TRP A . n A 1 210 MET 210 694 694 MET MET A . n A 1 211 PRO 211 695 695 PRO PRO A . n A 1 212 PRO 212 696 696 PRO PRO A . n A 1 213 GLU 213 697 697 GLU GLU A . n A 1 214 SER 214 698 698 SER SER A . n A 1 215 ILE 215 699 699 ILE ILE A . n A 1 216 LEU 216 700 700 LEU LEU A . n A 1 217 TYR 217 701 701 TYR TYR A . n A 1 218 ARG 218 702 702 ARG ARG A . n A 1 219 LYS 219 703 703 LYS LYS A . n A 1 220 PHE 220 704 704 PHE PHE A . n A 1 221 THR 221 705 705 THR THR A . n A 1 222 THR 222 706 706 THR THR A . n A 1 223 GLU 223 707 707 GLU GLU A . n A 1 224 SER 224 708 708 SER SER A . n A 1 225 ASP 225 709 709 ASP ASP A . n A 1 226 VAL 226 710 710 VAL VAL A . n A 1 227 TRP 227 711 711 TRP TRP A . n A 1 228 SER 228 712 712 SER SER A . n A 1 229 PHE 229 713 713 PHE PHE A . n A 1 230 GLY 230 714 714 GLY GLY A . n A 1 231 VAL 231 715 715 VAL VAL A . n A 1 232 VAL 232 716 716 VAL VAL A . n A 1 233 LEU 233 717 717 LEU LEU A . n A 1 234 TRP 234 718 718 TRP TRP A . n A 1 235 GLU 235 719 719 GLU GLU A . n A 1 236 ILE 236 720 720 ILE ILE A . n A 1 237 PHE 237 721 721 PHE PHE A . n A 1 238 THR 238 722 722 THR THR A . n A 1 239 TYR 239 723 723 TYR TYR A . n A 1 240 GLY 240 724 724 GLY GLY A . n A 1 241 LYS 241 725 725 LYS LYS A . n A 1 242 GLN 242 726 726 GLN GLN A . n A 1 243 PRO 243 727 727 PRO PRO A . n A 1 244 TRP 244 728 728 TRP TRP A . n A 1 245 TYR 245 729 729 TYR TYR A . n A 1 246 GLN 246 730 730 GLN GLN A . n A 1 247 LEU 247 731 731 LEU LEU A . n A 1 248 SER 248 732 732 SER SER A . n A 1 249 ASN 249 733 733 ASN ASN A . n A 1 250 THR 250 734 734 THR THR A . n A 1 251 GLU 251 735 735 GLU GLU A . n A 1 252 ALA 252 736 736 ALA ALA A . n A 1 253 ILE 253 737 737 ILE ILE A . n A 1 254 ASP 254 738 738 ASP ASP A . n A 1 255 CYS 255 739 739 CYS CYS A . n A 1 256 ILE 256 740 740 ILE ILE A . n A 1 257 THR 257 741 741 THR THR A . n A 1 258 GLN 258 742 742 GLN GLN A . n A 1 259 GLY 259 743 743 GLY GLY A . n A 1 260 ARG 260 744 744 ARG ARG A . n A 1 261 GLU 261 745 745 GLU GLU A . n A 1 262 LEU 262 746 746 LEU LEU A . n A 1 263 GLU 263 747 747 GLU GLU A . n A 1 264 ARG 264 748 748 ARG ARG A . n A 1 265 PRO 265 749 749 PRO PRO A . n A 1 266 ARG 266 750 750 ARG ARG A . n A 1 267 ALA 267 751 751 ALA ALA A . n A 1 268 CYS 268 752 752 CYS CYS A . n A 1 269 PRO 269 753 753 PRO PRO A . n A 1 270 PRO 270 754 754 PRO PRO A . n A 1 271 GLU 271 755 755 GLU GLU A . n A 1 272 VAL 272 756 756 VAL VAL A . n A 1 273 TYR 273 757 757 TYR TYR A . n A 1 274 ALA 274 758 758 ALA ALA A . n A 1 275 ILE 275 759 759 ILE ILE A . n A 1 276 MET 276 760 760 MET MET A . n A 1 277 ARG 277 761 761 ARG ARG A . n A 1 278 GLY 278 762 762 GLY GLY A . n A 1 279 CYS 279 763 763 CYS CYS A . n A 1 280 TRP 280 764 764 TRP TRP A . n A 1 281 GLN 281 765 765 GLN GLN A . n A 1 282 ARG 282 766 766 ARG ARG A . n A 1 283 GLU 283 767 767 GLU GLU A . n A 1 284 PRO 284 768 768 PRO PRO A . n A 1 285 GLN 285 769 769 GLN GLN A . n A 1 286 GLN 286 770 770 GLN GLN A . n A 1 287 ARG 287 771 771 ARG ARG A . n A 1 288 HIS 288 772 772 HIS HIS A . n A 1 289 SER 289 773 773 SER SER A . n A 1 290 ILE 290 774 774 ILE ILE A . n A 1 291 LYS 291 775 775 LYS LYS A . n A 1 292 ASP 292 776 776 ASP ASP A . n A 1 293 VAL 293 777 777 VAL VAL A . n A 1 294 HIS 294 778 778 HIS HIS A . n A 1 295 ALA 295 779 779 ALA ALA A . n A 1 296 ARG 296 780 780 ARG ARG A . n A 1 297 LEU 297 781 781 LEU LEU A . n A 1 298 GLN 298 782 782 GLN GLN A . n A 1 299 ALA 299 783 783 ALA ALA A . n A 1 300 LEU 300 784 784 LEU LEU A . n A 1 301 ALA 301 785 785 ALA ALA A . n A 1 302 GLN 302 786 786 GLN GLN A . n A 1 303 ALA 303 787 787 ALA ALA A . n A 1 304 PRO 304 788 788 PRO PRO A . n A 1 305 PRO 305 789 789 PRO PRO A . n A 1 306 VAL 306 790 790 VAL VAL A . n A 1 307 TYR 307 791 791 TYR TYR A . n A 1 308 LEU 308 792 792 LEU LEU A . n A 1 309 ASP 309 793 793 ASP ASP A . n A 1 310 VAL 310 794 794 VAL VAL A . n A 1 311 LEU 311 795 795 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 OOJ 1 801 1 OOJ INX A . C 3 HOH 1 901 67 HOH HOH A . C 3 HOH 2 902 68 HOH HOH A . C 3 HOH 3 903 13 HOH HOH A . C 3 HOH 4 904 17 HOH HOH A . C 3 HOH 5 905 69 HOH HOH A . C 3 HOH 6 906 61 HOH HOH A . C 3 HOH 7 907 27 HOH HOH A . C 3 HOH 8 908 51 HOH HOH A . C 3 HOH 9 909 43 HOH HOH A . C 3 HOH 10 910 58 HOH HOH A . C 3 HOH 11 911 37 HOH HOH A . C 3 HOH 12 912 62 HOH HOH A . C 3 HOH 13 913 36 HOH HOH A . C 3 HOH 14 914 3 HOH HOH A . C 3 HOH 15 915 46 HOH HOH A . C 3 HOH 16 916 52 HOH HOH A . C 3 HOH 17 917 22 HOH HOH A . C 3 HOH 18 918 21 HOH HOH A . C 3 HOH 19 919 48 HOH HOH A . C 3 HOH 20 920 49 HOH HOH A . C 3 HOH 21 921 63 HOH HOH A . C 3 HOH 22 922 28 HOH HOH A . C 3 HOH 23 923 33 HOH HOH A . C 3 HOH 24 924 45 HOH HOH A . C 3 HOH 25 925 15 HOH HOH A . C 3 HOH 26 926 6 HOH HOH A . C 3 HOH 27 927 38 HOH HOH A . C 3 HOH 28 928 30 HOH HOH A . C 3 HOH 29 929 9 HOH HOH A . C 3 HOH 30 930 65 HOH HOH A . C 3 HOH 31 931 1 HOH HOH A . C 3 HOH 32 932 7 HOH HOH A . C 3 HOH 33 933 16 HOH HOH A . C 3 HOH 34 934 18 HOH HOH A . C 3 HOH 35 935 23 HOH HOH A . C 3 HOH 36 936 19 HOH HOH A . C 3 HOH 37 937 40 HOH HOH A . C 3 HOH 38 938 32 HOH HOH A . C 3 HOH 39 939 31 HOH HOH A . C 3 HOH 40 940 20 HOH HOH A . C 3 HOH 41 941 53 HOH HOH A . C 3 HOH 42 942 47 HOH HOH A . C 3 HOH 43 943 29 HOH HOH A . C 3 HOH 44 944 59 HOH HOH A . C 3 HOH 45 945 60 HOH HOH A . C 3 HOH 46 946 14 HOH HOH A . C 3 HOH 47 947 5 HOH HOH A . C 3 HOH 48 948 8 HOH HOH A . C 3 HOH 49 949 2 HOH HOH A . C 3 HOH 50 950 25 HOH HOH A . C 3 HOH 51 951 4 HOH HOH A . C 3 HOH 52 952 56 HOH HOH A . C 3 HOH 53 953 64 HOH HOH A . C 3 HOH 54 954 55 HOH HOH A . C 3 HOH 55 955 66 HOH HOH A . C 3 HOH 56 956 39 HOH HOH A . C 3 HOH 57 957 57 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id SEP _pdbx_struct_mod_residue.label_seq_id 193 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id SEP _pdbx_struct_mod_residue.auth_seq_id 677 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id SER _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 950 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-10-09 2 'Structure model' 1 1 2019-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 2 'Structure model' '_citation_author.name' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0049 3 # _pdbx_entry_details.entry_id 6PL1 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 609 ? ? -131.75 -158.51 2 1 ARG A 649 ? ? 80.90 -7.13 3 1 ASP A 650 ? ? -151.04 42.14 4 1 TYR A 676 ? ? -113.68 52.27 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 485 ? A GLY 1 2 1 Y 1 A LEU 486 ? A LEU 2 3 1 Y 1 A GLN 487 ? A GLN 3 4 1 Y 1 A GLY 488 ? A GLY 4 5 1 Y 1 A HIS 489 ? A HIS 5 6 1 Y 1 A ILE 490 ? A ILE 6 7 1 Y 1 A ILE 491 ? A ILE 7 8 1 Y 1 A GLU 492 ? A GLU 8 9 1 Y 1 A ASN 493 ? A ASN 9 10 1 Y 1 A PRO 494 ? A PRO 10 11 1 Y 1 A GLN 495 ? A GLN 11 12 1 Y 1 A TYR 496 ? A TYR 12 13 1 Y 1 A PHE 497 ? A PHE 13 14 1 Y 1 A SER 498 ? A SER 14 15 1 Y 1 A ASP 499 ? A ASP 15 16 1 Y 1 A ALA 549 ? A ALA 65 17 1 Y 1 A SER 550 ? A SER 66 18 1 Y 1 A GLU 551 ? A GLU 67 19 1 Y 1 A GLY 684 ? A GLY 200 20 1 Y 1 A GLY 685 ? A GLY 201 21 1 Y 1 A ARG 686 ? A ARG 202 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id OOJ _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id OOJ _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "N-(5-{[(7-methyl-4-oxo-4H-pyrido[1,2-a]pyrimidin-2-yl)methyl]sulfanyl}-1,3,4-thiadiazol-2-yl)-N'-[3-(trifluoromethyl)phenyl]urea" OOJ 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support homology _pdbx_struct_assembly_auth_evidence.details ? #