data_6PRH # _entry.id 6PRH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.320 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6PRH WWPDB D_1000242929 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6PRH _pdbx_database_status.recvd_initial_deposition_date 2019-07-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Tarique, F.K.' 1 ? 'Neiditch, M.B.' 2 ? 'Dubnau, D.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Mbio _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2150-7511 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Structure-Function Studies of the Bacillus subtilis Ric Proteins Identify the Fe-S Cluster-Ligating Residues and Their Roles in Development and RNA Processing. ; _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1128/mBio.01841-19 _citation.pdbx_database_id_PubMed 31530674 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Adusei-Danso, F.' 1 ? primary 'Khaja, F.T.' 2 ? primary 'DeSantis, M.' 3 ? primary 'Jeffrey, P.D.' 4 ? primary 'Dubnau, E.' 5 ? primary 'Demeler, B.' 6 ? primary 'Neiditch, M.B.' 7 ? primary 'Dubnau, D.' 8 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 95.830 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6PRH _cell.details ? _cell.formula_units_Z ? _cell.length_a 109.491 _cell.length_a_esd ? _cell.length_b 52.212 _cell.length_b_esd ? _cell.length_c 27.109 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6PRH _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man RicA 14180.994 1 ? ? ? ? 2 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 3 water nat water 18.015 52 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPMTLYSKKDIVQQARNLAKMISETEEVDFFKRAEAQINENDKVSTIVNQIKALQKQAVNLKHYEKHEALKQVEAKIDAL QEELEEIPVIQEFRDSQMEVNDLLQLVAHTISNQVTNEIITSTG ; _entity_poly.pdbx_seq_one_letter_code_can ;GPMTLYSKKDIVQQARNLAKMISETEEVDFFKRAEAQINENDKVSTIVNQIKALQKQAVNLKHYEKHEALKQVEAKIDAL QEELEEIPVIQEFRDSQMEVNDLLQLVAHTISNQVTNEIITSTG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 MET n 1 4 THR n 1 5 LEU n 1 6 TYR n 1 7 SER n 1 8 LYS n 1 9 LYS n 1 10 ASP n 1 11 ILE n 1 12 VAL n 1 13 GLN n 1 14 GLN n 1 15 ALA n 1 16 ARG n 1 17 ASN n 1 18 LEU n 1 19 ALA n 1 20 LYS n 1 21 MET n 1 22 ILE n 1 23 SER n 1 24 GLU n 1 25 THR n 1 26 GLU n 1 27 GLU n 1 28 VAL n 1 29 ASP n 1 30 PHE n 1 31 PHE n 1 32 LYS n 1 33 ARG n 1 34 ALA n 1 35 GLU n 1 36 ALA n 1 37 GLN n 1 38 ILE n 1 39 ASN n 1 40 GLU n 1 41 ASN n 1 42 ASP n 1 43 LYS n 1 44 VAL n 1 45 SER n 1 46 THR n 1 47 ILE n 1 48 VAL n 1 49 ASN n 1 50 GLN n 1 51 ILE n 1 52 LYS n 1 53 ALA n 1 54 LEU n 1 55 GLN n 1 56 LYS n 1 57 GLN n 1 58 ALA n 1 59 VAL n 1 60 ASN n 1 61 LEU n 1 62 LYS n 1 63 HIS n 1 64 TYR n 1 65 GLU n 1 66 LYS n 1 67 HIS n 1 68 GLU n 1 69 ALA n 1 70 LEU n 1 71 LYS n 1 72 GLN n 1 73 VAL n 1 74 GLU n 1 75 ALA n 1 76 LYS n 1 77 ILE n 1 78 ASP n 1 79 ALA n 1 80 LEU n 1 81 GLN n 1 82 GLU n 1 83 GLU n 1 84 LEU n 1 85 GLU n 1 86 GLU n 1 87 ILE n 1 88 PRO n 1 89 VAL n 1 90 ILE n 1 91 GLN n 1 92 GLU n 1 93 PHE n 1 94 ARG n 1 95 ASP n 1 96 SER n 1 97 GLN n 1 98 MET n 1 99 GLU n 1 100 VAL n 1 101 ASN n 1 102 ASP n 1 103 LEU n 1 104 LEU n 1 105 GLN n 1 106 LEU n 1 107 VAL n 1 108 ALA n 1 109 HIS n 1 110 THR n 1 111 ILE n 1 112 SER n 1 113 ASN n 1 114 GLN n 1 115 VAL n 1 116 THR n 1 117 ASN n 1 118 GLU n 1 119 ILE n 1 120 ILE n 1 121 THR n 1 122 SER n 1 123 THR n 1 124 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 124 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ymcA, BSU17020' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 168 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis (strain 168)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 224308 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code YMCA_BACSU _struct_ref.pdbx_db_accession O31779 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTLYSKKDIVQQARNLAKMISETEEVDFFKRAEAQINENDKVSTIVNQIKALQKQAVNLKHYEKHEALKQVEAKIDALQE ELEEIPVIQEFRDSQMEVNDLLQLVAHTISNQVTNEIITSTG ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6PRH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 124 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O31779 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 122 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 122 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6PRH GLY A 1 ? UNP O31779 ? ? 'expression tag' -1 1 1 6PRH PRO A 2 ? UNP O31779 ? ? 'expression tag' 0 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6PRH _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.75 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.24 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM MES pH 6.0, 150 mM NaCl, 65% (vol/vol) MPD' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 93 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 325 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-06-18 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.18076 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL14-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.18076 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL14-1 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate 29.6 _reflns.entry_id 6PRH _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.080 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9208 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.500 _reflns.pdbx_Rmerge_I_obs 0.141 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 15.06 _reflns.pdbx_netI_over_sigmaI 10.100 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 2.028 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.151 _reflns.pdbx_Rpim_I_all 0.055 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.99 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.080 2.120 ? ? ? ? ? ? 437 99.100 ? ? ? ? 0.396 ? ? ? ? ? ? ? ? 6.900 ? 1.248 ? ? 0.428 0.159 ? 1 1 0.930 ? 2.120 2.150 ? ? ? ? ? ? 456 100.000 ? ? ? ? 0.345 ? ? ? ? ? ? ? ? 7.200 ? 1.323 ? ? 0.371 0.136 ? 2 1 0.944 ? 2.150 2.200 ? ? ? ? ? ? 455 99.800 ? ? ? ? 0.314 ? ? ? ? ? ? ? ? 7.200 ? 1.301 ? ? 0.338 0.124 ? 3 1 0.955 ? 2.200 2.240 ? ? ? ? ? ? 462 98.900 ? ? ? ? 0.298 ? ? ? ? ? ? ? ? 7.400 ? 1.439 ? ? 0.320 0.116 ? 4 1 0.964 ? 2.240 2.290 ? ? ? ? ? ? 451 99.300 ? ? ? ? 0.277 ? ? ? ? ? ? ? ? 7.500 ? 1.577 ? ? 0.297 0.107 ? 5 1 0.961 ? 2.290 2.340 ? ? ? ? ? ? 465 100.000 ? ? ? ? 0.237 ? ? ? ? ? ? ? ? 7.600 ? 1.653 ? ? 0.254 0.091 ? 6 1 0.966 ? 2.340 2.400 ? ? ? ? ? ? 438 100.000 ? ? ? ? 0.235 ? ? ? ? ? ? ? ? 7.500 ? 1.673 ? ? 0.253 0.091 ? 7 1 0.973 ? 2.400 2.470 ? ? ? ? ? ? 481 99.000 ? ? ? ? 0.213 ? ? ? ? ? ? ? ? 7.500 ? 1.800 ? ? 0.228 0.083 ? 8 1 0.973 ? 2.470 2.540 ? ? ? ? ? ? 441 100.000 ? ? ? ? 0.212 ? ? ? ? ? ? ? ? 7.600 ? 1.784 ? ? 0.227 0.081 ? 9 1 0.969 ? 2.540 2.620 ? ? ? ? ? ? 459 100.000 ? ? ? ? 0.192 ? ? ? ? ? ? ? ? 7.600 ? 1.914 ? ? 0.205 0.074 ? 10 1 0.975 ? 2.620 2.710 ? ? ? ? ? ? 471 99.800 ? ? ? ? 0.181 ? ? ? ? ? ? ? ? 7.500 ? 2.036 ? ? 0.195 0.071 ? 11 1 0.978 ? 2.710 2.820 ? ? ? ? ? ? 446 100.000 ? ? ? ? 0.167 ? ? ? ? ? ? ? ? 7.600 ? 2.209 ? ? 0.180 0.065 ? 12 1 0.978 ? 2.820 2.950 ? ? ? ? ? ? 468 100.000 ? ? ? ? 0.159 ? ? ? ? ? ? ? ? 7.500 ? 2.208 ? ? 0.170 0.061 ? 13 1 0.981 ? 2.950 3.110 ? ? ? ? ? ? 464 100.000 ? ? ? ? 0.151 ? ? ? ? ? ? ? ? 7.600 ? 2.347 ? ? 0.162 0.058 ? 14 1 0.987 ? 3.110 3.300 ? ? ? ? ? ? 459 100.000 ? ? ? ? 0.140 ? ? ? ? ? ? ? ? 7.600 ? 2.421 ? ? 0.150 0.054 ? 15 1 0.982 ? 3.300 3.560 ? ? ? ? ? ? 471 100.000 ? ? ? ? 0.140 ? ? ? ? ? ? ? ? 7.600 ? 2.743 ? ? 0.150 0.054 ? 16 1 0.986 ? 3.560 3.910 ? ? ? ? ? ? 468 100.000 ? ? ? ? 0.131 ? ? ? ? ? ? ? ? 7.500 ? 2.820 ? ? 0.140 0.051 ? 17 1 0.985 ? 3.910 4.480 ? ? ? ? ? ? 466 100.000 ? ? ? ? 0.128 ? ? ? ? ? ? ? ? 7.600 ? 2.819 ? ? 0.137 0.049 ? 18 1 0.989 ? 4.480 5.640 ? ? ? ? ? ? 466 100.000 ? ? ? ? 0.123 ? ? ? ? ? ? ? ? 7.500 ? 2.592 ? ? 0.132 0.047 ? 19 1 0.991 ? 5.640 50.000 ? ? ? ? ? ? 484 99.600 ? ? ? ? 0.107 ? ? ? ? ? ? ? ? 7.300 ? 2.369 ? ? 0.115 0.042 ? 20 1 0.992 ? # _refine.aniso_B[1][1] 0.5500 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 1.4000 _refine.aniso_B[2][2] -1.4600 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 0.6100 _refine.B_iso_max 95.710 _refine.B_iso_mean 36.7960 _refine.B_iso_min 20.070 _refine.correlation_coeff_Fo_to_Fc 0.9550 _refine.correlation_coeff_Fo_to_Fc_free 0.9390 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6PRH _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.0800 _refine.ls_d_res_low 29.8300 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8761 _refine.ls_number_reflns_R_free 447 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.7100 _refine.ls_percent_reflns_R_free 4.9000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1849 _refine.ls_R_factor_R_free 0.2241 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1830 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2PIH _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.1830 _refine.pdbx_overall_ESU_R_Free 0.1630 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 4.0270 _refine.overall_SU_ML 0.1110 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.0800 _refine_hist.d_res_low 29.8300 _refine_hist.number_atoms_solvent 52 _refine_hist.number_atoms_total 1032 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 122 _refine_hist.pdbx_B_iso_mean_ligand 29.55 _refine_hist.pdbx_B_iso_mean_solvent 43.81 _refine_hist.pdbx_number_atoms_protein 979 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 0.013 987 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 931 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.588 1.636 1330 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.435 1.578 2178 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 4.568 5.000 121 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 41.614 26.364 55 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 17.109 15.000 200 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 18.153 15.000 3 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.089 0.200 139 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 1085 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 164 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.0800 _refine_ls_shell.d_res_low 2.1340 _refine_ls_shell.number_reflns_all 645 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 38 _refine_ls_shell.number_reflns_R_work 607 _refine_ls_shell.percent_reflns_obs 98.6200 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2290 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.1840 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6PRH _struct.title 'X-ray Crystal Structure of Bacillus subtilis RicA' _struct.pdbx_descriptor RicA _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6PRH _struct_keywords.text 'RNA processing, biofilms, competence, sporulation, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 7 ? GLU A 24 ? SER A 5 GLU A 22 1 ? 18 HELX_P HELX_P2 AA2 THR A 25 ? ASN A 39 ? THR A 23 ASN A 37 1 ? 15 HELX_P HELX_P3 AA3 ASN A 41 ? TYR A 64 ? ASN A 39 TYR A 62 1 ? 24 HELX_P HELX_P4 AA4 LYS A 66 ? ILE A 87 ? LYS A 64 ILE A 85 1 ? 22 HELX_P HELX_P5 AA5 ILE A 87 ? THR A 123 ? ILE A 85 THR A 121 1 ? 37 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CL _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'binding site for residue CL A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 ASN A 113 ? ASN A 111 . ? 1_554 ? 2 AC1 2 ASN A 117 ? ASN A 115 . ? 2_556 ? # _atom_sites.entry_id 6PRH _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.009133 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000932 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019153 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.037080 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 PRO 2 0 ? ? ? A . n A 1 3 MET 3 1 1 MET MET A . n A 1 4 THR 4 2 2 THR THR A . n A 1 5 LEU 5 3 3 LEU LEU A . n A 1 6 TYR 6 4 4 TYR TYR A . n A 1 7 SER 7 5 5 SER SER A . n A 1 8 LYS 8 6 6 LYS LYS A . n A 1 9 LYS 9 7 7 LYS LYS A . n A 1 10 ASP 10 8 8 ASP ASP A . n A 1 11 ILE 11 9 9 ILE ILE A . n A 1 12 VAL 12 10 10 VAL VAL A . n A 1 13 GLN 13 11 11 GLN GLN A . n A 1 14 GLN 14 12 12 GLN GLN A . n A 1 15 ALA 15 13 13 ALA ALA A . n A 1 16 ARG 16 14 14 ARG ARG A . n A 1 17 ASN 17 15 15 ASN ASN A . n A 1 18 LEU 18 16 16 LEU LEU A . n A 1 19 ALA 19 17 17 ALA ALA A . n A 1 20 LYS 20 18 18 LYS LYS A . n A 1 21 MET 21 19 19 MET MET A . n A 1 22 ILE 22 20 20 ILE ILE A . n A 1 23 SER 23 21 21 SER SER A . n A 1 24 GLU 24 22 22 GLU GLU A . n A 1 25 THR 25 23 23 THR THR A . n A 1 26 GLU 26 24 24 GLU GLU A . n A 1 27 GLU 27 25 25 GLU GLU A . n A 1 28 VAL 28 26 26 VAL VAL A . n A 1 29 ASP 29 27 27 ASP ASP A . n A 1 30 PHE 30 28 28 PHE PHE A . n A 1 31 PHE 31 29 29 PHE PHE A . n A 1 32 LYS 32 30 30 LYS LYS A . n A 1 33 ARG 33 31 31 ARG ARG A . n A 1 34 ALA 34 32 32 ALA ALA A . n A 1 35 GLU 35 33 33 GLU GLU A . n A 1 36 ALA 36 34 34 ALA ALA A . n A 1 37 GLN 37 35 35 GLN GLN A . n A 1 38 ILE 38 36 36 ILE ILE A . n A 1 39 ASN 39 37 37 ASN ASN A . n A 1 40 GLU 40 38 38 GLU GLU A . n A 1 41 ASN 41 39 39 ASN ASN A . n A 1 42 ASP 42 40 40 ASP ASP A . n A 1 43 LYS 43 41 41 LYS LYS A . n A 1 44 VAL 44 42 42 VAL VAL A . n A 1 45 SER 45 43 43 SER SER A . n A 1 46 THR 46 44 44 THR THR A . n A 1 47 ILE 47 45 45 ILE ILE A . n A 1 48 VAL 48 46 46 VAL VAL A . n A 1 49 ASN 49 47 47 ASN ASN A . n A 1 50 GLN 50 48 48 GLN GLN A . n A 1 51 ILE 51 49 49 ILE ILE A . n A 1 52 LYS 52 50 50 LYS LYS A . n A 1 53 ALA 53 51 51 ALA ALA A . n A 1 54 LEU 54 52 52 LEU LEU A . n A 1 55 GLN 55 53 53 GLN GLN A . n A 1 56 LYS 56 54 54 LYS LYS A . n A 1 57 GLN 57 55 55 GLN GLN A . n A 1 58 ALA 58 56 56 ALA ALA A . n A 1 59 VAL 59 57 57 VAL VAL A . n A 1 60 ASN 60 58 58 ASN ASN A . n A 1 61 LEU 61 59 59 LEU LEU A . n A 1 62 LYS 62 60 60 LYS LYS A . n A 1 63 HIS 63 61 61 HIS HIS A . n A 1 64 TYR 64 62 62 TYR TYR A . n A 1 65 GLU 65 63 63 GLU GLU A . n A 1 66 LYS 66 64 64 LYS LYS A . n A 1 67 HIS 67 65 65 HIS HIS A . n A 1 68 GLU 68 66 66 GLU GLU A . n A 1 69 ALA 69 67 67 ALA ALA A . n A 1 70 LEU 70 68 68 LEU LEU A . n A 1 71 LYS 71 69 69 LYS LYS A . n A 1 72 GLN 72 70 70 GLN GLN A . n A 1 73 VAL 73 71 71 VAL VAL A . n A 1 74 GLU 74 72 72 GLU GLU A . n A 1 75 ALA 75 73 73 ALA ALA A . n A 1 76 LYS 76 74 74 LYS LYS A . n A 1 77 ILE 77 75 75 ILE ILE A . n A 1 78 ASP 78 76 76 ASP ASP A . n A 1 79 ALA 79 77 77 ALA ALA A . n A 1 80 LEU 80 78 78 LEU LEU A . n A 1 81 GLN 81 79 79 GLN GLN A . n A 1 82 GLU 82 80 80 GLU GLU A . n A 1 83 GLU 83 81 81 GLU GLU A . n A 1 84 LEU 84 82 82 LEU LEU A . n A 1 85 GLU 85 83 83 GLU GLU A . n A 1 86 GLU 86 84 84 GLU GLU A . n A 1 87 ILE 87 85 85 ILE ILE A . n A 1 88 PRO 88 86 86 PRO PRO A . n A 1 89 VAL 89 87 87 VAL VAL A . n A 1 90 ILE 90 88 88 ILE ILE A . n A 1 91 GLN 91 89 89 GLN GLN A . n A 1 92 GLU 92 90 90 GLU GLU A . n A 1 93 PHE 93 91 91 PHE PHE A . n A 1 94 ARG 94 92 92 ARG ARG A . n A 1 95 ASP 95 93 93 ASP ASP A . n A 1 96 SER 96 94 94 SER SER A . n A 1 97 GLN 97 95 95 GLN GLN A . n A 1 98 MET 98 96 96 MET MET A . n A 1 99 GLU 99 97 97 GLU GLU A . n A 1 100 VAL 100 98 98 VAL VAL A . n A 1 101 ASN 101 99 99 ASN ASN A . n A 1 102 ASP 102 100 100 ASP ASP A . n A 1 103 LEU 103 101 101 LEU LEU A . n A 1 104 LEU 104 102 102 LEU LEU A . n A 1 105 GLN 105 103 103 GLN GLN A . n A 1 106 LEU 106 104 104 LEU LEU A . n A 1 107 VAL 107 105 105 VAL VAL A . n A 1 108 ALA 108 106 106 ALA ALA A . n A 1 109 HIS 109 107 107 HIS HIS A . n A 1 110 THR 110 108 108 THR THR A . n A 1 111 ILE 111 109 109 ILE ILE A . n A 1 112 SER 112 110 110 SER SER A . n A 1 113 ASN 113 111 111 ASN ASN A . n A 1 114 GLN 114 112 112 GLN GLN A . n A 1 115 VAL 115 113 113 VAL VAL A . n A 1 116 THR 116 114 114 THR THR A . n A 1 117 ASN 117 115 115 ASN ASN A . n A 1 118 GLU 118 116 116 GLU GLU A . n A 1 119 ILE 119 117 117 ILE ILE A . n A 1 120 ILE 120 118 118 ILE ILE A . n A 1 121 THR 121 119 119 THR THR A . n A 1 122 SER 122 120 120 SER SER A . n A 1 123 THR 123 121 121 THR THR A . n A 1 124 GLY 124 122 122 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 201 1 CL CL A . C 3 HOH 1 301 46 HOH HOH A . C 3 HOH 2 302 11 HOH HOH A . C 3 HOH 3 303 34 HOH HOH A . C 3 HOH 4 304 27 HOH HOH A . C 3 HOH 5 305 16 HOH HOH A . C 3 HOH 6 306 1 HOH HOH A . C 3 HOH 7 307 21 HOH HOH A . C 3 HOH 8 308 9 HOH HOH A . C 3 HOH 9 309 31 HOH HOH A . C 3 HOH 10 310 45 HOH HOH A . C 3 HOH 11 311 32 HOH HOH A . C 3 HOH 12 312 12 HOH HOH A . C 3 HOH 13 313 24 HOH HOH A . C 3 HOH 14 314 50 HOH HOH A . C 3 HOH 15 315 17 HOH HOH A . C 3 HOH 16 316 13 HOH HOH A . C 3 HOH 17 317 10 HOH HOH A . C 3 HOH 18 318 25 HOH HOH A . C 3 HOH 19 319 26 HOH HOH A . C 3 HOH 20 320 8 HOH HOH A . C 3 HOH 21 321 2 HOH HOH A . C 3 HOH 22 322 22 HOH HOH A . C 3 HOH 23 323 47 HOH HOH A . C 3 HOH 24 324 28 HOH HOH A . C 3 HOH 25 325 19 HOH HOH A . C 3 HOH 26 326 7 HOH HOH A . C 3 HOH 27 327 40 HOH HOH A . C 3 HOH 28 328 6 HOH HOH A . C 3 HOH 29 329 5 HOH HOH A . C 3 HOH 30 330 18 HOH HOH A . C 3 HOH 31 331 44 HOH HOH A . C 3 HOH 32 332 35 HOH HOH A . C 3 HOH 33 333 49 HOH HOH A . C 3 HOH 34 334 51 HOH HOH A . C 3 HOH 35 335 42 HOH HOH A . C 3 HOH 36 336 29 HOH HOH A . C 3 HOH 37 337 15 HOH HOH A . C 3 HOH 38 338 48 HOH HOH A . C 3 HOH 39 339 14 HOH HOH A . C 3 HOH 40 340 3 HOH HOH A . C 3 HOH 41 341 37 HOH HOH A . C 3 HOH 42 342 30 HOH HOH A . C 3 HOH 43 343 20 HOH HOH A . C 3 HOH 44 344 4 HOH HOH A . C 3 HOH 45 345 38 HOH HOH A . C 3 HOH 46 346 33 HOH HOH A . C 3 HOH 47 347 36 HOH HOH A . C 3 HOH 48 348 23 HOH HOH A . C 3 HOH 49 349 57 HOH HOH A . C 3 HOH 50 350 56 HOH HOH A . C 3 HOH 51 351 39 HOH HOH A . C 3 HOH 52 352 43 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3960 ? 1 MORE -52 ? 1 'SSA (A^2)' 16070 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_556 -x,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 -2.7536563589 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 26.9687830214 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 350 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-10-02 2 'Structure model' 1 1 2019-12-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Author supporting evidence' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category pdbx_audit_support # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_audit_support.funding_organization' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0232 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 6PRH _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A MET 1 ? CG ? A MET 3 CG 2 1 Y 1 A MET 1 ? SD ? A MET 3 SD 3 1 Y 1 A MET 1 ? CE ? A MET 3 CE # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A PRO 0 ? A PRO 2 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' R01GM057720 1 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' R01AI125452 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #