data_6PRI # _entry.id 6PRI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6PRI pdb_00006pri 10.2210/pdb6pri/pdb WWPDB D_1000242931 ? ? BMRB 30634 ? 10.13018/BMR30634 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-09-18 2 'Structure model' 1 1 2019-10-23 3 'Structure model' 1 2 2020-01-01 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' pdbx_audit_support 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_database_status 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 3 'Structure model' '_pdbx_audit_support.funding_organization' 7 4 'Structure model' '_database_2.pdbx_DOI' 8 4 'Structure model' '_database_2.pdbx_database_accession' 9 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 10 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6PRI _pdbx_database_status.recvd_initial_deposition_date 2019-07-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 6PQ2 unspecified BMRB 'Structural Basis for Client Recognition and Activity of Hsp40 Chaperones' 30634 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jiang, Y.' 1 0000-0002-0886-292X 'Rossi, P.' 2 0000-0001-8178-0122 'Kalodimos, C.G.' 3 0000-0001-6354-2796 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Science _citation.journal_id_ASTM SCIEAS _citation.journal_id_CSD 0038 _citation.journal_id_ISSN 1095-9203 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 365 _citation.language ? _citation.page_first 1313 _citation.page_last 1319 _citation.title 'Structural basis for client recognition and activity of Hsp40 chaperones.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/science.aax1280 _citation.pdbx_database_id_PubMed 31604242 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jiang, Y.' 1 ? primary 'Rossi, P.' 2 ? primary 'Kalodimos, C.G.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Alkaline phosphatase,Chaperone protein DnaJ 2' _entity.formula_weight 9053.400 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.1.3.1 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name APase # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSQLRIAAYGPHGSGGSGGSGGSQDLYATLDVPAPIAVVGGKVRAMTLEGPVEVAVPPRTQAGRKLRLKGKGFPGPAGRG DLYLEVRIT ; _entity_poly.pdbx_seq_one_letter_code_can ;MSQLRIAAYGPHGSGGSGGSGGSQDLYATLDVPAPIAVVGGKVRAMTLEGPVEVAVPPRTQAGRKLRLKGKGFPGPAGRG DLYLEVRIT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLN n 1 4 LEU n 1 5 ARG n 1 6 ILE n 1 7 ALA n 1 8 ALA n 1 9 TYR n 1 10 GLY n 1 11 PRO n 1 12 HIS n 1 13 GLY n 1 14 SER n 1 15 GLY n 1 16 GLY n 1 17 SER n 1 18 GLY n 1 19 GLY n 1 20 SER n 1 21 GLY n 1 22 GLY n 1 23 SER n 1 24 GLN n 1 25 ASP n 1 26 LEU n 1 27 TYR n 1 28 ALA n 1 29 THR n 1 30 LEU n 1 31 ASP n 1 32 VAL n 1 33 PRO n 1 34 ALA n 1 35 PRO n 1 36 ILE n 1 37 ALA n 1 38 VAL n 1 39 VAL n 1 40 GLY n 1 41 GLY n 1 42 LYS n 1 43 VAL n 1 44 ARG n 1 45 ALA n 1 46 MET n 1 47 THR n 1 48 LEU n 1 49 GLU n 1 50 GLY n 1 51 PRO n 1 52 VAL n 1 53 GLU n 1 54 VAL n 1 55 ALA n 1 56 VAL n 1 57 PRO n 1 58 PRO n 1 59 ARG n 1 60 THR n 1 61 GLN n 1 62 ALA n 1 63 GLY n 1 64 ARG n 1 65 LYS n 1 66 LEU n 1 67 ARG n 1 68 LEU n 1 69 LYS n 1 70 GLY n 1 71 LYS n 1 72 GLY n 1 73 PHE n 1 74 PRO n 1 75 GLY n 1 76 PRO n 1 77 ALA n 1 78 GLY n 1 79 ARG n 1 80 GLY n 1 81 ASP n 1 82 LEU n 1 83 TYR n 1 84 LEU n 1 85 GLU n 1 86 VAL n 1 87 ARG n 1 88 ILE n 1 89 THR n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 24 ? ? 'phoA, b0383, JW0374' ? K12 ? ? ? ? 'Escherichia coli (strain K12)' 83333 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 25 89 ? ? 'dnaJ2, TTHA1489' ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 168 168 MET MET A . n A 1 2 SER 2 169 169 SER SER A . n A 1 3 GLN 3 170 170 GLN GLN A . n A 1 4 LEU 4 171 171 LEU LEU A . n A 1 5 ARG 5 172 172 ARG ARG A . n A 1 6 ILE 6 173 173 ILE ILE A . n A 1 7 ALA 7 174 174 ALA ALA A . n A 1 8 ALA 8 175 175 ALA ALA A . n A 1 9 TYR 9 176 176 TYR TYR A . n A 1 10 GLY 10 177 177 GLY GLY A . n A 1 11 PRO 11 178 178 PRO PRO A . n A 1 12 HIS 12 179 179 HIS HIS A . n A 1 13 GLY 13 180 180 GLY GLY A . n A 1 14 SER 14 181 181 SER SER A . n A 1 15 GLY 15 182 182 GLY GLY A . n A 1 16 GLY 16 183 183 GLY GLY A . n A 1 17 SER 17 184 184 SER SER A . n A 1 18 GLY 18 185 185 GLY GLY A . n A 1 19 GLY 19 186 186 GLY GLY A . n A 1 20 SER 20 187 187 SER SER A . n A 1 21 GLY 21 188 188 GLY GLY A . n A 1 22 GLY 22 189 189 GLY GLY A . n A 1 23 SER 23 190 190 SER SER A . n A 1 24 GLN 24 191 191 GLN GLN A . n A 1 25 ASP 25 192 192 ASP ASP A . n A 1 26 LEU 26 193 193 LEU LEU A . n A 1 27 TYR 27 194 194 TYR TYR A . n A 1 28 ALA 28 195 195 ALA ALA A . n A 1 29 THR 29 196 196 THR THR A . n A 1 30 LEU 30 197 197 LEU LEU A . n A 1 31 ASP 31 198 198 ASP ASP A . n A 1 32 VAL 32 199 199 VAL VAL A . n A 1 33 PRO 33 200 200 PRO PRO A . n A 1 34 ALA 34 201 201 ALA ALA A . n A 1 35 PRO 35 202 202 PRO PRO A . n A 1 36 ILE 36 203 203 ILE ILE A . n A 1 37 ALA 37 204 204 ALA ALA A . n A 1 38 VAL 38 205 205 VAL VAL A . n A 1 39 VAL 39 206 206 VAL VAL A . n A 1 40 GLY 40 207 207 GLY GLY A . n A 1 41 GLY 41 208 208 GLY GLY A . n A 1 42 LYS 42 209 209 LYS LYS A . n A 1 43 VAL 43 210 210 VAL VAL A . n A 1 44 ARG 44 211 211 ARG ARG A . n A 1 45 ALA 45 212 212 ALA ALA A . n A 1 46 MET 46 213 213 MET MET A . n A 1 47 THR 47 214 214 THR THR A . n A 1 48 LEU 48 215 215 LEU LEU A . n A 1 49 GLU 49 216 216 GLU GLU A . n A 1 50 GLY 50 217 217 GLY GLY A . n A 1 51 PRO 51 218 218 PRO PRO A . n A 1 52 VAL 52 219 219 VAL VAL A . n A 1 53 GLU 53 220 220 GLU GLU A . n A 1 54 VAL 54 221 221 VAL VAL A . n A 1 55 ALA 55 222 222 ALA ALA A . n A 1 56 VAL 56 223 223 VAL VAL A . n A 1 57 PRO 57 224 224 PRO PRO A . n A 1 58 PRO 58 225 225 PRO PRO A . n A 1 59 ARG 59 226 226 ARG ARG A . n A 1 60 THR 60 227 227 THR THR A . n A 1 61 GLN 61 228 228 GLN GLN A . n A 1 62 ALA 62 229 229 ALA ALA A . n A 1 63 GLY 63 230 230 GLY GLY A . n A 1 64 ARG 64 231 231 ARG ARG A . n A 1 65 LYS 65 232 232 LYS LYS A . n A 1 66 LEU 66 233 233 LEU LEU A . n A 1 67 ARG 67 234 234 ARG ARG A . n A 1 68 LEU 68 235 235 LEU LEU A . n A 1 69 LYS 69 236 236 LYS LYS A . n A 1 70 GLY 70 237 237 GLY GLY A . n A 1 71 LYS 71 238 238 LYS LYS A . n A 1 72 GLY 72 239 239 GLY GLY A . n A 1 73 PHE 73 240 240 PHE PHE A . n A 1 74 PRO 74 241 241 PRO PRO A . n A 1 75 GLY 75 242 242 GLY GLY A . n A 1 76 PRO 76 243 243 PRO PRO A . n A 1 77 ALA 77 244 244 ALA ALA A . n A 1 78 GLY 78 245 245 GLY GLY A . n A 1 79 ARG 79 246 246 ARG ARG A . n A 1 80 GLY 80 247 247 GLY GLY A . n A 1 81 ASP 81 248 248 ASP ASP A . n A 1 82 LEU 82 249 249 LEU LEU A . n A 1 83 TYR 83 250 250 TYR TYR A . n A 1 84 LEU 84 251 251 LEU LEU A . n A 1 85 GLU 85 252 252 GLU GLU A . n A 1 86 VAL 86 253 253 VAL VAL A . n A 1 87 ARG 87 254 254 ARG ARG A . n A 1 88 ILE 88 255 255 ILE ILE A . n A 1 89 THR 89 256 256 THR THR A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6PRI _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6PRI _struct.title 'Structural Basis for Client Recognition and Activity of Hsp40 Chaperones' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6PRI _struct_keywords.text 'Client Recognition, CHAPERONE, CHAPERONE-HYDROLASE complex' _struct_keywords.pdbx_keywords CHAPERONE/HYDROLASE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP PPB_ECOLI P00634 ? 1 SQLRIAAYGPH 437 2 UNP DNAJ2_THET8 Q56237 ? 1 DLYATLDVPAPIAVVGGKVRAMTLEGPVEVAVPPRTQAGRKLRLKGKGFPGPAGRGDLYLEVRIT 192 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6PRI A 2 ? 12 ? P00634 437 ? 447 ? 169 179 2 2 6PRI A 25 ? 89 ? Q56237 192 ? 256 ? 192 256 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6PRI MET A 1 ? UNP P00634 ? ? 'initiating methionine' 168 1 1 6PRI GLY A 13 ? UNP P00634 ? ? linker 180 2 1 6PRI SER A 14 ? UNP P00634 ? ? linker 181 3 1 6PRI GLY A 15 ? UNP P00634 ? ? linker 182 4 1 6PRI GLY A 16 ? UNP P00634 ? ? linker 183 5 1 6PRI SER A 17 ? UNP P00634 ? ? linker 184 6 1 6PRI GLY A 18 ? UNP P00634 ? ? linker 185 7 1 6PRI GLY A 19 ? UNP P00634 ? ? linker 186 8 1 6PRI SER A 20 ? UNP P00634 ? ? linker 187 9 1 6PRI GLY A 21 ? UNP P00634 ? ? linker 188 10 1 6PRI GLY A 22 ? UNP P00634 ? ? linker 189 11 1 6PRI SER A 23 ? UNP P00634 ? ? linker 190 12 1 6PRI GLN A 24 ? UNP P00634 ? ? linker 191 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'isothermal titration calorimetry' _pdbx_struct_assembly_auth_evidence.details 'NMR titrations' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ALA _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 34 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 40 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ALA _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 201 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 207 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 26 ? PRO A 33 ? LEU A 193 PRO A 200 AA1 2 GLY A 78 ? THR A 89 ? GLY A 245 THR A 256 AA1 3 LYS A 65 ? GLY A 75 ? LYS A 232 GLY A 242 AA2 1 GLY A 41 ? THR A 47 ? GLY A 208 THR A 214 AA2 2 GLY A 50 ? VAL A 56 ? GLY A 217 VAL A 223 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ALA A 28 ? N ALA A 195 O TYR A 83 ? O TYR A 250 AA1 2 3 O LEU A 84 ? O LEU A 251 N LEU A 66 ? N LEU A 233 AA2 1 2 N ALA A 45 ? N ALA A 212 O VAL A 52 ? O VAL A 219 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 178 ? ? -66.97 98.37 2 1 SER A 190 ? ? -71.80 -80.35 3 1 GLN A 191 ? ? -106.50 74.26 4 2 ILE A 173 ? ? -87.32 -74.78 5 2 ALA A 174 ? ? 55.93 19.36 6 2 SER A 181 ? ? -61.32 92.30 7 2 SER A 184 ? ? 49.81 89.28 8 2 THR A 227 ? ? -65.54 91.62 9 3 ILE A 173 ? ? -77.41 -83.91 10 3 ALA A 174 ? ? 48.31 26.63 11 3 PRO A 178 ? ? -87.48 39.91 12 3 SER A 190 ? ? 75.20 -37.81 13 4 PRO A 178 ? ? -68.88 83.90 14 4 SER A 181 ? ? -170.24 -49.45 15 4 SER A 187 ? ? -63.52 92.75 16 4 SER A 190 ? ? -170.47 -22.11 17 5 ILE A 173 ? ? -72.46 -75.49 18 5 ALA A 174 ? ? 59.56 11.23 19 5 SER A 181 ? ? -174.24 -178.93 20 5 PRO A 225 ? ? -64.27 -174.43 21 6 GLN A 170 ? ? 61.54 75.64 22 6 PRO A 178 ? ? -65.41 97.54 23 6 SER A 187 ? ? 57.01 82.94 24 6 VAL A 253 ? ? -57.91 109.63 25 7 SER A 169 ? ? -173.55 118.24 26 7 HIS A 179 ? ? -98.77 41.96 27 7 SER A 190 ? ? -143.49 -76.34 28 8 SER A 184 ? ? -158.96 -61.49 29 8 THR A 227 ? ? -66.05 97.57 30 9 LEU A 171 ? ? -69.06 93.85 31 9 ILE A 173 ? ? -77.46 -78.05 32 9 VAL A 253 ? ? -59.62 104.21 33 10 ILE A 173 ? ? -81.59 -81.16 34 10 SER A 190 ? ? -152.54 35.88 35 11 ARG A 172 ? ? -68.62 99.91 36 11 SER A 190 ? ? -154.92 -50.05 37 12 SER A 169 ? ? -95.80 -83.72 38 12 GLN A 170 ? ? 58.03 18.99 39 12 LEU A 171 ? ? -61.24 87.30 40 12 ILE A 173 ? ? -84.80 -73.44 41 12 SER A 184 ? ? -62.72 93.73 42 13 ALA A 174 ? ? -92.74 35.33 43 13 PRO A 225 ? ? -58.87 177.00 44 13 THR A 227 ? ? -68.86 88.69 45 14 ILE A 173 ? ? -87.62 -74.10 46 14 ALA A 174 ? ? 66.25 -7.75 47 15 TYR A 176 ? ? 77.79 -63.09 48 15 GLN A 191 ? ? -98.04 39.68 49 16 HIS A 179 ? ? -154.00 -54.50 50 16 SER A 181 ? ? 178.54 114.35 51 17 ALA A 174 ? ? -84.07 40.08 52 18 ILE A 173 ? ? -76.13 -70.87 53 18 TYR A 176 ? ? 66.54 -68.44 54 18 SER A 187 ? ? 59.79 91.43 55 19 HIS A 179 ? ? -62.43 84.01 56 19 SER A 184 ? ? -69.65 90.20 57 19 PRO A 225 ? ? -67.63 -179.41 58 19 LYS A 238 ? ? -131.26 -34.12 59 20 SER A 169 ? ? -162.84 -167.53 60 20 SER A 187 ? ? -150.85 79.64 61 20 SER A 190 ? ? -162.61 12.89 # _pdbx_nmr_ensemble.entry_id 6PRI _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6PRI _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM [U-100% 13C; U-100% 15N] F-CBD2, 75 mM potassium chloride, 20 mM potassium phosphate, 0.04 % sodium azide, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 15N_13C_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 F-CBD2 1 ? mM '[U-100% 13C; U-100% 15N]' 1 'potassium chloride' 75 ? mM 'natural abundance' 1 'potassium phosphate' 20 ? mM 'natural abundance' 1 'sodium azide' 0.04 ? % 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC' 1 isotropic 3 1 1 '3D HNCACB' 1 isotropic 4 1 1 '3D HNCO' 1 isotropic 5 1 1 '3D HBHA(CO)NH' 1 isotropic 13 1 1 '3D 1H-15N NOESY' 1 isotropic 12 1 1 '3D 1H-13C NOESY' 1 isotropic 11 1 1 '3D CCH-TOCSY' 1 isotropic 10 1 1 '3D CCH-NOESY' 1 isotropic 9 1 1 '3D CCONH tocsy' 1 isotropic # _pdbx_nmr_refine.entry_id 6PRI _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details 'restrained MD in H2O' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' PINE ? 'Bahrami, Markley, Assadi, and Eghbalnia' 4 'peak picking' Sparky ? Goddard 9 'geometry optimization' TALOS ? 'Cornilescu, Delaglio and Bax' 8 'data analysis' PSVS ? 'Bhattacharya and Montelione' 7 collection TopSpin 4.0 'Bruker Biospin' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 GLN N N N N 57 GLN CA C N S 58 GLN C C N N 59 GLN O O N N 60 GLN CB C N N 61 GLN CG C N N 62 GLN CD C N N 63 GLN OE1 O N N 64 GLN NE2 N N N 65 GLN OXT O N N 66 GLN H H N N 67 GLN H2 H N N 68 GLN HA H N N 69 GLN HB2 H N N 70 GLN HB3 H N N 71 GLN HG2 H N N 72 GLN HG3 H N N 73 GLN HE21 H N N 74 GLN HE22 H N N 75 GLN HXT H N N 76 GLU N N N N 77 GLU CA C N S 78 GLU C C N N 79 GLU O O N N 80 GLU CB C N N 81 GLU CG C N N 82 GLU CD C N N 83 GLU OE1 O N N 84 GLU OE2 O N N 85 GLU OXT O N N 86 GLU H H N N 87 GLU H2 H N N 88 GLU HA H N N 89 GLU HB2 H N N 90 GLU HB3 H N N 91 GLU HG2 H N N 92 GLU HG3 H N N 93 GLU HE2 H N N 94 GLU HXT H N N 95 GLY N N N N 96 GLY CA C N N 97 GLY C C N N 98 GLY O O N N 99 GLY OXT O N N 100 GLY H H N N 101 GLY H2 H N N 102 GLY HA2 H N N 103 GLY HA3 H N N 104 GLY HXT H N N 105 HIS N N N N 106 HIS CA C N S 107 HIS C C N N 108 HIS O O N N 109 HIS CB C N N 110 HIS CG C Y N 111 HIS ND1 N Y N 112 HIS CD2 C Y N 113 HIS CE1 C Y N 114 HIS NE2 N Y N 115 HIS OXT O N N 116 HIS H H N N 117 HIS H2 H N N 118 HIS HA H N N 119 HIS HB2 H N N 120 HIS HB3 H N N 121 HIS HD1 H N N 122 HIS HD2 H N N 123 HIS HE1 H N N 124 HIS HE2 H N N 125 HIS HXT H N N 126 ILE N N N N 127 ILE CA C N S 128 ILE C C N N 129 ILE O O N N 130 ILE CB C N S 131 ILE CG1 C N N 132 ILE CG2 C N N 133 ILE CD1 C N N 134 ILE OXT O N N 135 ILE H H N N 136 ILE H2 H N N 137 ILE HA H N N 138 ILE HB H N N 139 ILE HG12 H N N 140 ILE HG13 H N N 141 ILE HG21 H N N 142 ILE HG22 H N N 143 ILE HG23 H N N 144 ILE HD11 H N N 145 ILE HD12 H N N 146 ILE HD13 H N N 147 ILE HXT H N N 148 LEU N N N N 149 LEU CA C N S 150 LEU C C N N 151 LEU O O N N 152 LEU CB C N N 153 LEU CG C N N 154 LEU CD1 C N N 155 LEU CD2 C N N 156 LEU OXT O N N 157 LEU H H N N 158 LEU H2 H N N 159 LEU HA H N N 160 LEU HB2 H N N 161 LEU HB3 H N N 162 LEU HG H N N 163 LEU HD11 H N N 164 LEU HD12 H N N 165 LEU HD13 H N N 166 LEU HD21 H N N 167 LEU HD22 H N N 168 LEU HD23 H N N 169 LEU HXT H N N 170 LYS N N N N 171 LYS CA C N S 172 LYS C C N N 173 LYS O O N N 174 LYS CB C N N 175 LYS CG C N N 176 LYS CD C N N 177 LYS CE C N N 178 LYS NZ N N N 179 LYS OXT O N N 180 LYS H H N N 181 LYS H2 H N N 182 LYS HA H N N 183 LYS HB2 H N N 184 LYS HB3 H N N 185 LYS HG2 H N N 186 LYS HG3 H N N 187 LYS HD2 H N N 188 LYS HD3 H N N 189 LYS HE2 H N N 190 LYS HE3 H N N 191 LYS HZ1 H N N 192 LYS HZ2 H N N 193 LYS HZ3 H N N 194 LYS HXT H N N 195 MET N N N N 196 MET CA C N S 197 MET C C N N 198 MET O O N N 199 MET CB C N N 200 MET CG C N N 201 MET SD S N N 202 MET CE C N N 203 MET OXT O N N 204 MET H H N N 205 MET H2 H N N 206 MET HA H N N 207 MET HB2 H N N 208 MET HB3 H N N 209 MET HG2 H N N 210 MET HG3 H N N 211 MET HE1 H N N 212 MET HE2 H N N 213 MET HE3 H N N 214 MET HXT H N N 215 PHE N N N N 216 PHE CA C N S 217 PHE C C N N 218 PHE O O N N 219 PHE CB C N N 220 PHE CG C Y N 221 PHE CD1 C Y N 222 PHE CD2 C Y N 223 PHE CE1 C Y N 224 PHE CE2 C Y N 225 PHE CZ C Y N 226 PHE OXT O N N 227 PHE H H N N 228 PHE H2 H N N 229 PHE HA H N N 230 PHE HB2 H N N 231 PHE HB3 H N N 232 PHE HD1 H N N 233 PHE HD2 H N N 234 PHE HE1 H N N 235 PHE HE2 H N N 236 PHE HZ H N N 237 PHE HXT H N N 238 PRO N N N N 239 PRO CA C N S 240 PRO C C N N 241 PRO O O N N 242 PRO CB C N N 243 PRO CG C N N 244 PRO CD C N N 245 PRO OXT O N N 246 PRO H H N N 247 PRO HA H N N 248 PRO HB2 H N N 249 PRO HB3 H N N 250 PRO HG2 H N N 251 PRO HG3 H N N 252 PRO HD2 H N N 253 PRO HD3 H N N 254 PRO HXT H N N 255 SER N N N N 256 SER CA C N S 257 SER C C N N 258 SER O O N N 259 SER CB C N N 260 SER OG O N N 261 SER OXT O N N 262 SER H H N N 263 SER H2 H N N 264 SER HA H N N 265 SER HB2 H N N 266 SER HB3 H N N 267 SER HG H N N 268 SER HXT H N N 269 THR N N N N 270 THR CA C N S 271 THR C C N N 272 THR O O N N 273 THR CB C N R 274 THR OG1 O N N 275 THR CG2 C N N 276 THR OXT O N N 277 THR H H N N 278 THR H2 H N N 279 THR HA H N N 280 THR HB H N N 281 THR HG1 H N N 282 THR HG21 H N N 283 THR HG22 H N N 284 THR HG23 H N N 285 THR HXT H N N 286 TYR N N N N 287 TYR CA C N S 288 TYR C C N N 289 TYR O O N N 290 TYR CB C N N 291 TYR CG C Y N 292 TYR CD1 C Y N 293 TYR CD2 C Y N 294 TYR CE1 C Y N 295 TYR CE2 C Y N 296 TYR CZ C Y N 297 TYR OH O N N 298 TYR OXT O N N 299 TYR H H N N 300 TYR H2 H N N 301 TYR HA H N N 302 TYR HB2 H N N 303 TYR HB3 H N N 304 TYR HD1 H N N 305 TYR HD2 H N N 306 TYR HE1 H N N 307 TYR HE2 H N N 308 TYR HH H N N 309 TYR HXT H N N 310 VAL N N N N 311 VAL CA C N S 312 VAL C C N N 313 VAL O O N N 314 VAL CB C N N 315 VAL CG1 C N N 316 VAL CG2 C N N 317 VAL OXT O N N 318 VAL H H N N 319 VAL H2 H N N 320 VAL HA H N N 321 VAL HB H N N 322 VAL HG11 H N N 323 VAL HG12 H N N 324 VAL HG13 H N N 325 VAL HG21 H N N 326 VAL HG22 H N N 327 VAL HG23 H N N 328 VAL HXT H N N 329 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 GLN N CA sing N N 54 GLN N H sing N N 55 GLN N H2 sing N N 56 GLN CA C sing N N 57 GLN CA CB sing N N 58 GLN CA HA sing N N 59 GLN C O doub N N 60 GLN C OXT sing N N 61 GLN CB CG sing N N 62 GLN CB HB2 sing N N 63 GLN CB HB3 sing N N 64 GLN CG CD sing N N 65 GLN CG HG2 sing N N 66 GLN CG HG3 sing N N 67 GLN CD OE1 doub N N 68 GLN CD NE2 sing N N 69 GLN NE2 HE21 sing N N 70 GLN NE2 HE22 sing N N 71 GLN OXT HXT sing N N 72 GLU N CA sing N N 73 GLU N H sing N N 74 GLU N H2 sing N N 75 GLU CA C sing N N 76 GLU CA CB sing N N 77 GLU CA HA sing N N 78 GLU C O doub N N 79 GLU C OXT sing N N 80 GLU CB CG sing N N 81 GLU CB HB2 sing N N 82 GLU CB HB3 sing N N 83 GLU CG CD sing N N 84 GLU CG HG2 sing N N 85 GLU CG HG3 sing N N 86 GLU CD OE1 doub N N 87 GLU CD OE2 sing N N 88 GLU OE2 HE2 sing N N 89 GLU OXT HXT sing N N 90 GLY N CA sing N N 91 GLY N H sing N N 92 GLY N H2 sing N N 93 GLY CA C sing N N 94 GLY CA HA2 sing N N 95 GLY CA HA3 sing N N 96 GLY C O doub N N 97 GLY C OXT sing N N 98 GLY OXT HXT sing N N 99 HIS N CA sing N N 100 HIS N H sing N N 101 HIS N H2 sing N N 102 HIS CA C sing N N 103 HIS CA CB sing N N 104 HIS CA HA sing N N 105 HIS C O doub N N 106 HIS C OXT sing N N 107 HIS CB CG sing N N 108 HIS CB HB2 sing N N 109 HIS CB HB3 sing N N 110 HIS CG ND1 sing Y N 111 HIS CG CD2 doub Y N 112 HIS ND1 CE1 doub Y N 113 HIS ND1 HD1 sing N N 114 HIS CD2 NE2 sing Y N 115 HIS CD2 HD2 sing N N 116 HIS CE1 NE2 sing Y N 117 HIS CE1 HE1 sing N N 118 HIS NE2 HE2 sing N N 119 HIS OXT HXT sing N N 120 ILE N CA sing N N 121 ILE N H sing N N 122 ILE N H2 sing N N 123 ILE CA C sing N N 124 ILE CA CB sing N N 125 ILE CA HA sing N N 126 ILE C O doub N N 127 ILE C OXT sing N N 128 ILE CB CG1 sing N N 129 ILE CB CG2 sing N N 130 ILE CB HB sing N N 131 ILE CG1 CD1 sing N N 132 ILE CG1 HG12 sing N N 133 ILE CG1 HG13 sing N N 134 ILE CG2 HG21 sing N N 135 ILE CG2 HG22 sing N N 136 ILE CG2 HG23 sing N N 137 ILE CD1 HD11 sing N N 138 ILE CD1 HD12 sing N N 139 ILE CD1 HD13 sing N N 140 ILE OXT HXT sing N N 141 LEU N CA sing N N 142 LEU N H sing N N 143 LEU N H2 sing N N 144 LEU CA C sing N N 145 LEU CA CB sing N N 146 LEU CA HA sing N N 147 LEU C O doub N N 148 LEU C OXT sing N N 149 LEU CB CG sing N N 150 LEU CB HB2 sing N N 151 LEU CB HB3 sing N N 152 LEU CG CD1 sing N N 153 LEU CG CD2 sing N N 154 LEU CG HG sing N N 155 LEU CD1 HD11 sing N N 156 LEU CD1 HD12 sing N N 157 LEU CD1 HD13 sing N N 158 LEU CD2 HD21 sing N N 159 LEU CD2 HD22 sing N N 160 LEU CD2 HD23 sing N N 161 LEU OXT HXT sing N N 162 LYS N CA sing N N 163 LYS N H sing N N 164 LYS N H2 sing N N 165 LYS CA C sing N N 166 LYS CA CB sing N N 167 LYS CA HA sing N N 168 LYS C O doub N N 169 LYS C OXT sing N N 170 LYS CB CG sing N N 171 LYS CB HB2 sing N N 172 LYS CB HB3 sing N N 173 LYS CG CD sing N N 174 LYS CG HG2 sing N N 175 LYS CG HG3 sing N N 176 LYS CD CE sing N N 177 LYS CD HD2 sing N N 178 LYS CD HD3 sing N N 179 LYS CE NZ sing N N 180 LYS CE HE2 sing N N 181 LYS CE HE3 sing N N 182 LYS NZ HZ1 sing N N 183 LYS NZ HZ2 sing N N 184 LYS NZ HZ3 sing N N 185 LYS OXT HXT sing N N 186 MET N CA sing N N 187 MET N H sing N N 188 MET N H2 sing N N 189 MET CA C sing N N 190 MET CA CB sing N N 191 MET CA HA sing N N 192 MET C O doub N N 193 MET C OXT sing N N 194 MET CB CG sing N N 195 MET CB HB2 sing N N 196 MET CB HB3 sing N N 197 MET CG SD sing N N 198 MET CG HG2 sing N N 199 MET CG HG3 sing N N 200 MET SD CE sing N N 201 MET CE HE1 sing N N 202 MET CE HE2 sing N N 203 MET CE HE3 sing N N 204 MET OXT HXT sing N N 205 PHE N CA sing N N 206 PHE N H sing N N 207 PHE N H2 sing N N 208 PHE CA C sing N N 209 PHE CA CB sing N N 210 PHE CA HA sing N N 211 PHE C O doub N N 212 PHE C OXT sing N N 213 PHE CB CG sing N N 214 PHE CB HB2 sing N N 215 PHE CB HB3 sing N N 216 PHE CG CD1 doub Y N 217 PHE CG CD2 sing Y N 218 PHE CD1 CE1 sing Y N 219 PHE CD1 HD1 sing N N 220 PHE CD2 CE2 doub Y N 221 PHE CD2 HD2 sing N N 222 PHE CE1 CZ doub Y N 223 PHE CE1 HE1 sing N N 224 PHE CE2 CZ sing Y N 225 PHE CE2 HE2 sing N N 226 PHE CZ HZ sing N N 227 PHE OXT HXT sing N N 228 PRO N CA sing N N 229 PRO N CD sing N N 230 PRO N H sing N N 231 PRO CA C sing N N 232 PRO CA CB sing N N 233 PRO CA HA sing N N 234 PRO C O doub N N 235 PRO C OXT sing N N 236 PRO CB CG sing N N 237 PRO CB HB2 sing N N 238 PRO CB HB3 sing N N 239 PRO CG CD sing N N 240 PRO CG HG2 sing N N 241 PRO CG HG3 sing N N 242 PRO CD HD2 sing N N 243 PRO CD HD3 sing N N 244 PRO OXT HXT sing N N 245 SER N CA sing N N 246 SER N H sing N N 247 SER N H2 sing N N 248 SER CA C sing N N 249 SER CA CB sing N N 250 SER CA HA sing N N 251 SER C O doub N N 252 SER C OXT sing N N 253 SER CB OG sing N N 254 SER CB HB2 sing N N 255 SER CB HB3 sing N N 256 SER OG HG sing N N 257 SER OXT HXT sing N N 258 THR N CA sing N N 259 THR N H sing N N 260 THR N H2 sing N N 261 THR CA C sing N N 262 THR CA CB sing N N 263 THR CA HA sing N N 264 THR C O doub N N 265 THR C OXT sing N N 266 THR CB OG1 sing N N 267 THR CB CG2 sing N N 268 THR CB HB sing N N 269 THR OG1 HG1 sing N N 270 THR CG2 HG21 sing N N 271 THR CG2 HG22 sing N N 272 THR CG2 HG23 sing N N 273 THR OXT HXT sing N N 274 TYR N CA sing N N 275 TYR N H sing N N 276 TYR N H2 sing N N 277 TYR CA C sing N N 278 TYR CA CB sing N N 279 TYR CA HA sing N N 280 TYR C O doub N N 281 TYR C OXT sing N N 282 TYR CB CG sing N N 283 TYR CB HB2 sing N N 284 TYR CB HB3 sing N N 285 TYR CG CD1 doub Y N 286 TYR CG CD2 sing Y N 287 TYR CD1 CE1 sing Y N 288 TYR CD1 HD1 sing N N 289 TYR CD2 CE2 doub Y N 290 TYR CD2 HD2 sing N N 291 TYR CE1 CZ doub Y N 292 TYR CE1 HE1 sing N N 293 TYR CE2 CZ sing Y N 294 TYR CE2 HE2 sing N N 295 TYR CZ OH sing N N 296 TYR OH HH sing N N 297 TYR OXT HXT sing N N 298 VAL N CA sing N N 299 VAL N H sing N N 300 VAL N H2 sing N N 301 VAL CA C sing N N 302 VAL CA CB sing N N 303 VAL CA HA sing N N 304 VAL C O doub N N 305 VAL C OXT sing N N 306 VAL CB CG1 sing N N 307 VAL CB CG2 sing N N 308 VAL CB HB sing N N 309 VAL CG1 HG11 sing N N 310 VAL CG1 HG12 sing N N 311 VAL CG1 HG13 sing N N 312 VAL CG2 HG21 sing N N 313 VAL CG2 HG22 sing N N 314 VAL CG2 HG23 sing N N 315 VAL OXT HXT sing N N 316 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 5R35GM122462-04 _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE NEO' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 6PRI _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_