data_6PSH # _entry.id 6PSH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.331 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6PSH WWPDB D_1000242966 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6PSH _pdbx_database_status.recvd_initial_deposition_date 2019-07-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category FoldIt _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kuznetsov, V.B.' 1 0000-0002-5867-7984 'Krieger, I.V.' 2 0000-0001-7144-3069 'Sacchettini, J.C.' 3 0000-0001-5767-2367 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Mol.Biol. _citation.journal_id_ASTM JMOBAK _citation.journal_id_CSD 0070 _citation.journal_id_ISSN 1089-8638 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 432 _citation.language ? _citation.page_first 4623 _citation.page_last 4636 _citation.title 'The Structural Basis of T4 Phage Lysis Control: DNA as the Signal for Lysis Inhibition.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jmb.2020.06.013 _citation.pdbx_database_id_PubMed 32562709 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Krieger, I.V.' 1 ? primary 'Kuznetsov, V.' 2 ? primary 'Chang, J.Y.' 3 ? primary 'Zhang, J.' 4 ? primary 'Moussa, S.H.' 5 ? primary 'Young, R.F.' 6 ? primary 'Sacchettini, J.C.' 7 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6PSH _cell.details ? _cell.formula_units_Z ? _cell.length_a 49.975 _cell.length_a_esd ? _cell.length_b 49.975 _cell.length_b_esd ? _cell.length_c 118.677 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6PSH _symmetry.cell_setting ? _symmetry.Int_Tables_number 180 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 62 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Antiholin 10328.606 1 ? ? ? ? 2 non-polymer nat 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 3 water nat water 18.015 10 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Protein rI' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNVDPHFDKFMESGIRHVYMLFENKSVESSEQFYSFMRTTYKNDPCSSDFECIERGAEMAQSYARIMNIKLETEKLAAAL EHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MNVDPHFDKFMESGIRHVYMLFENKSVESSEQFYSFMRTTYKNDPCSSDFECIERGAEMAQSYARIMNIKLETEKLAAAL EHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 VAL n 1 4 ASP n 1 5 PRO n 1 6 HIS n 1 7 PHE n 1 8 ASP n 1 9 LYS n 1 10 PHE n 1 11 MET n 1 12 GLU n 1 13 SER n 1 14 GLY n 1 15 ILE n 1 16 ARG n 1 17 HIS n 1 18 VAL n 1 19 TYR n 1 20 MET n 1 21 LEU n 1 22 PHE n 1 23 GLU n 1 24 ASN n 1 25 LYS n 1 26 SER n 1 27 VAL n 1 28 GLU n 1 29 SER n 1 30 SER n 1 31 GLU n 1 32 GLN n 1 33 PHE n 1 34 TYR n 1 35 SER n 1 36 PHE n 1 37 MET n 1 38 ARG n 1 39 THR n 1 40 THR n 1 41 TYR n 1 42 LYS n 1 43 ASN n 1 44 ASP n 1 45 PRO n 1 46 CYS n 1 47 SER n 1 48 SER n 1 49 ASP n 1 50 PHE n 1 51 GLU n 1 52 CYS n 1 53 ILE n 1 54 GLU n 1 55 ARG n 1 56 GLY n 1 57 ALA n 1 58 GLU n 1 59 MET n 1 60 ALA n 1 61 GLN n 1 62 SER n 1 63 TYR n 1 64 ALA n 1 65 ARG n 1 66 ILE n 1 67 MET n 1 68 ASN n 1 69 ILE n 1 70 LYS n 1 71 LEU n 1 72 GLU n 1 73 THR n 1 74 GLU n 1 75 LYS n 1 76 LEU n 1 77 ALA n 1 78 ALA n 1 79 ALA n 1 80 LEU n 1 81 GLU n 1 82 HIS n 1 83 HIS n 1 84 HIS n 1 85 HIS n 1 86 HIS n 1 87 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 87 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'rI, 58.6, rIA, tk.-2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterobacteria phage T4' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10665 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ANTIH_BPT4 _struct_ref.pdbx_db_accession P13304 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code NVDPHFDKFMESGIRHVYMLFENKSVESSEQFYSFMRTTYKNDPCSSDFECIERGAEMAQSYARIMNIKLETE _struct_ref.pdbx_align_begin 25 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6PSH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 74 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P13304 _struct_ref_seq.db_align_beg 25 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 97 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 25 _struct_ref_seq.pdbx_auth_seq_align_end 97 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6PSH MET A 1 ? UNP P13304 ? ? 'initiating methionine' 24 1 1 6PSH LYS A 75 ? UNP P13304 ? ? 'expression tag' 98 2 1 6PSH LEU A 76 ? UNP P13304 ? ? 'expression tag' 99 3 1 6PSH ALA A 77 ? UNP P13304 ? ? 'expression tag' 100 4 1 6PSH ALA A 78 ? UNP P13304 ? ? 'expression tag' 101 5 1 6PSH ALA A 79 ? UNP P13304 ? ? 'expression tag' 102 6 1 6PSH LEU A 80 ? UNP P13304 ? ? 'expression tag' 103 7 1 6PSH GLU A 81 ? UNP P13304 ? ? 'expression tag' 104 8 1 6PSH HIS A 82 ? UNP P13304 ? ? 'expression tag' 105 9 1 6PSH HIS A 83 ? UNP P13304 ? ? 'expression tag' 106 10 1 6PSH HIS A 84 ? UNP P13304 ? ? 'expression tag' 107 11 1 6PSH HIS A 85 ? UNP P13304 ? ? 'expression tag' 108 12 1 6PSH HIS A 86 ? UNP P13304 ? ? 'expression tag' 109 13 1 6PSH HIS A 87 ? UNP P13304 ? ? 'expression tag' 110 14 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6PSH _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.07 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 40.61 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM Na citrate (pH 4.5), 1M Na acetate, 0.5% Anapoe X114' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MAR scanner 300 mm plate' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2010-04-05 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 23-ID-B' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 23-ID-B _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 45.990 _reflns.entry_id 6PSH _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.210 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 4888 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 25.100 _reflns.pdbx_Rmerge_I_obs 0.106 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.300 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.831 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 122852 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.210 2.250 ? ? ? ? ? ? 240 100.000 ? ? ? ? 0.700 ? ? ? ? ? ? ? ? 19.200 ? 0.517 ? ? ? ? ? 1 1 ? ? 2.250 2.290 ? ? ? ? ? ? 229 99.600 ? ? ? ? 0.608 ? ? ? ? ? ? ? ? 20.500 ? 0.442 ? ? ? ? ? 2 1 ? ? 2.290 2.330 ? ? ? ? ? ? 230 100.000 ? ? ? ? 0.696 ? ? ? ? ? ? ? ? 24.500 ? 0.559 ? ? ? ? ? 3 1 ? ? 2.330 2.380 ? ? ? ? ? ? 239 100.000 ? ? ? ? 0.616 ? ? ? ? ? ? ? ? 25.100 ? 0.480 ? ? ? ? ? 4 1 ? ? 2.380 2.430 ? ? ? ? ? ? 229 100.000 ? ? ? ? 0.502 ? ? ? ? ? ? ? ? 26.600 ? 0.510 ? ? ? ? ? 5 1 ? ? 2.430 2.490 ? ? ? ? ? ? 238 100.000 ? ? ? ? 0.462 ? ? ? ? ? ? ? ? 27.100 ? 0.499 ? ? ? ? ? 6 1 ? ? 2.490 2.550 ? ? ? ? ? ? 231 100.000 ? ? ? ? 0.351 ? ? ? ? ? ? ? ? 26.900 ? 0.560 ? ? ? ? ? 7 1 ? ? 2.550 2.620 ? ? ? ? ? ? 244 100.000 ? ? ? ? 0.280 ? ? ? ? ? ? ? ? 27.900 ? 0.559 ? ? ? ? ? 8 1 ? ? 2.620 2.700 ? ? ? ? ? ? 232 100.000 ? ? ? ? 0.223 ? ? ? ? ? ? ? ? 27.100 ? 0.587 ? ? ? ? ? 9 1 ? ? 2.700 2.780 ? ? ? ? ? ? 241 100.000 ? ? ? ? 0.211 ? ? ? ? ? ? ? ? 26.900 ? 0.632 ? ? ? ? ? 10 1 ? ? 2.780 2.880 ? ? ? ? ? ? 237 100.000 ? ? ? ? 0.152 ? ? ? ? ? ? ? ? 26.700 ? 0.774 ? ? ? ? ? 11 1 ? ? 2.880 3.000 ? ? ? ? ? ? 239 100.000 ? ? ? ? 0.162 ? ? ? ? ? ? ? ? 27.200 ? 0.942 ? ? ? ? ? 12 1 ? ? 3.000 3.140 ? ? ? ? ? ? 247 100.000 ? ? ? ? 0.117 ? ? ? ? ? ? ? ? 26.100 ? 1.064 ? ? ? ? ? 13 1 ? ? 3.140 3.300 ? ? ? ? ? ? 239 100.000 ? ? ? ? 0.104 ? ? ? ? ? ? ? ? 26.900 ? 1.352 ? ? ? ? ? 14 1 ? ? 3.300 3.510 ? ? ? ? ? ? 239 100.000 ? ? ? ? 0.095 ? ? ? ? ? ? ? ? 26.200 ? 1.947 ? ? ? ? ? 15 1 ? ? 3.510 3.780 ? ? ? ? ? ? 253 100.000 ? ? ? ? 0.094 ? ? ? ? ? ? ? ? 26.000 ? 2.357 ? ? ? ? ? 16 1 ? ? 3.780 4.160 ? ? ? ? ? ? 251 100.000 ? ? ? ? 0.087 ? ? ? ? ? ? ? ? 25.200 ? 3.463 ? ? ? ? ? 17 1 ? ? 4.160 4.760 ? ? ? ? ? ? 254 100.000 ? ? ? ? 0.081 ? ? ? ? ? ? ? ? 24.600 ? 3.881 ? ? ? ? ? 18 1 ? ? 4.760 6.000 ? ? ? ? ? ? 265 100.000 ? ? ? ? 0.082 ? ? ? ? ? ? ? ? 23.500 ? 5.555 ? ? ? ? ? 19 1 ? ? 6.000 50.000 ? ? ? ? ? ? 311 98.700 ? ? ? ? 0.084 ? ? ? ? ? ? ? ? 20.200 ? 9.338 ? ? ? ? ? 20 1 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 135.150 _refine.B_iso_mean 60.5893 _refine.B_iso_min 25.650 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6PSH _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.2100 _refine.ls_d_res_low 40.6600 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4758 _refine.ls_number_reflns_R_free 476 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.9200 _refine.ls_percent_reflns_R_free 10.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2885 _refine.ls_R_factor_R_free 0.3229 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2841 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.330 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 38.3800 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2900 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.2100 _refine_hist.d_res_low 40.6600 _refine_hist.number_atoms_solvent 10 _refine_hist.number_atoms_total 593 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 70 _refine_hist.pdbx_B_iso_mean_ligand 72.51 _refine_hist.pdbx_B_iso_mean_solvent 68.64 _refine_hist.pdbx_number_atoms_protein 579 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 4 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 616 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.731 ? 826 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.045 ? 81 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 108 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 11.979 ? 517 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2104 2.5303 . . 149 1338 95.0000 . . . 0.3999 0.0000 0.3066 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5303 3.1877 . . 156 1404 99.0000 . . . 0.3919 0.0000 0.3162 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1877 40.6 . . 171 1540 100.0000 . . . 0.2927 0.0000 0.2700 . . . . . . . . . . # _struct.entry_id 6PSH _struct.title 'Crystal structure of periplasmic domain of antiholin RI from T4 phage' _struct.pdbx_descriptor Antiholin _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6PSH _struct_keywords.text 'phage, lysis inhibition, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 4 ? PHE A 22 ? ASP A 27 PHE A 45 1 ? 19 HELX_P HELX_P2 AA2 PHE A 22 ? ASN A 43 ? PHE A 45 ASN A 66 1 ? 22 HELX_P HELX_P3 AA3 SER A 48 ? ILE A 69 ? SER A 71 ILE A 92 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 46 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 52 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 69 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 75 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.042 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id EDO _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 1 _struct_site.details 'binding site for residue EDO A 201' # _struct_site_gen.id 1 _struct_site_gen.site_id AC1 _struct_site_gen.pdbx_num_res 1 _struct_site_gen.label_comp_id HOH _struct_site_gen.label_asym_id C _struct_site_gen.label_seq_id . _struct_site_gen.pdbx_auth_ins_code ? _struct_site_gen.auth_comp_id HOH _struct_site_gen.auth_asym_id A _struct_site_gen.auth_seq_id 303 _struct_site_gen.label_atom_id . _struct_site_gen.label_alt_id ? _struct_site_gen.symmetry 1_555 _struct_site_gen.details ? # _database_PDB_matrix.entry_id 6PSH _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.000000 _database_PDB_matrix.origx_vector[2] 0.000000 _database_PDB_matrix.origx_vector[3] 0.000000 # _atom_sites.entry_id 6PSH _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.020010 _atom_sites.fract_transf_matrix[1][2] 0.011553 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023106 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008426 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 24 ? ? ? A . n A 1 2 ASN 2 25 25 ASN ASN A . n A 1 3 VAL 3 26 26 VAL VAL A . n A 1 4 ASP 4 27 27 ASP ASP A . n A 1 5 PRO 5 28 28 PRO PRO A . n A 1 6 HIS 6 29 29 HIS HIS A . n A 1 7 PHE 7 30 30 PHE PHE A . n A 1 8 ASP 8 31 31 ASP ASP A . n A 1 9 LYS 9 32 32 LYS LYS A . n A 1 10 PHE 10 33 33 PHE PHE A . n A 1 11 MET 11 34 34 MET MET A . n A 1 12 GLU 12 35 35 GLU GLU A . n A 1 13 SER 13 36 36 SER SER A . n A 1 14 GLY 14 37 37 GLY GLY A . n A 1 15 ILE 15 38 38 ILE ILE A . n A 1 16 ARG 16 39 39 ARG ARG A . n A 1 17 HIS 17 40 40 HIS HIS A . n A 1 18 VAL 18 41 41 VAL VAL A . n A 1 19 TYR 19 42 42 TYR TYR A . n A 1 20 MET 20 43 43 MET MET A . n A 1 21 LEU 21 44 44 LEU LEU A . n A 1 22 PHE 22 45 45 PHE PHE A . n A 1 23 GLU 23 46 46 GLU GLU A . n A 1 24 ASN 24 47 47 ASN ASN A . n A 1 25 LYS 25 48 48 LYS LYS A . n A 1 26 SER 26 49 49 SER SER A . n A 1 27 VAL 27 50 50 VAL VAL A . n A 1 28 GLU 28 51 51 GLU GLU A . n A 1 29 SER 29 52 52 SER SER A . n A 1 30 SER 30 53 53 SER SER A . n A 1 31 GLU 31 54 54 GLU GLU A . n A 1 32 GLN 32 55 55 GLN GLN A . n A 1 33 PHE 33 56 56 PHE PHE A . n A 1 34 TYR 34 57 57 TYR TYR A . n A 1 35 SER 35 58 58 SER SER A . n A 1 36 PHE 36 59 59 PHE PHE A . n A 1 37 MET 37 60 60 MET MET A . n A 1 38 ARG 38 61 61 ARG ARG A . n A 1 39 THR 39 62 62 THR THR A . n A 1 40 THR 40 63 63 THR THR A . n A 1 41 TYR 41 64 64 TYR TYR A . n A 1 42 LYS 42 65 65 LYS LYS A . n A 1 43 ASN 43 66 66 ASN ASN A . n A 1 44 ASP 44 67 67 ASP ASP A . n A 1 45 PRO 45 68 68 PRO PRO A . n A 1 46 CYS 46 69 69 CYS CYS A . n A 1 47 SER 47 70 70 SER SER A . n A 1 48 SER 48 71 71 SER SER A . n A 1 49 ASP 49 72 72 ASP ASP A . n A 1 50 PHE 50 73 73 PHE PHE A . n A 1 51 GLU 51 74 74 GLU GLU A . n A 1 52 CYS 52 75 75 CYS CYS A . n A 1 53 ILE 53 76 76 ILE ILE A . n A 1 54 GLU 54 77 77 GLU GLU A . n A 1 55 ARG 55 78 78 ARG ARG A . n A 1 56 GLY 56 79 79 GLY GLY A . n A 1 57 ALA 57 80 80 ALA ALA A . n A 1 58 GLU 58 81 81 GLU GLU A . n A 1 59 MET 59 82 82 MET MET A . n A 1 60 ALA 60 83 83 ALA ALA A . n A 1 61 GLN 61 84 84 GLN GLN A . n A 1 62 SER 62 85 85 SER SER A . n A 1 63 TYR 63 86 86 TYR TYR A . n A 1 64 ALA 64 87 87 ALA ALA A . n A 1 65 ARG 65 88 88 ARG ARG A . n A 1 66 ILE 66 89 89 ILE ILE A . n A 1 67 MET 67 90 90 MET MET A . n A 1 68 ASN 68 91 91 ASN ASN A . n A 1 69 ILE 69 92 92 ILE ILE A . n A 1 70 LYS 70 93 93 LYS LYS A . n A 1 71 LEU 71 94 94 LEU LEU A . n A 1 72 GLU 72 95 ? ? ? A . n A 1 73 THR 73 96 ? ? ? A . n A 1 74 GLU 74 97 ? ? ? A . n A 1 75 LYS 75 98 ? ? ? A . n A 1 76 LEU 76 99 ? ? ? A . n A 1 77 ALA 77 100 ? ? ? A . n A 1 78 ALA 78 101 ? ? ? A . n A 1 79 ALA 79 102 ? ? ? A . n A 1 80 LEU 80 103 ? ? ? A . n A 1 81 GLU 81 104 ? ? ? A . n A 1 82 HIS 82 105 ? ? ? A . n A 1 83 HIS 83 106 ? ? ? A . n A 1 84 HIS 84 107 ? ? ? A . n A 1 85 HIS 85 108 ? ? ? A . n A 1 86 HIS 86 109 ? ? ? A . n A 1 87 HIS 87 110 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EDO 1 201 3318 EDO EDO A . C 3 HOH 1 301 22 HOH HOH A . C 3 HOH 2 302 24 HOH HOH A . C 3 HOH 3 303 20 HOH HOH A . C 3 HOH 4 304 25 HOH HOH A . C 3 HOH 5 305 5 HOH HOH A . C 3 HOH 6 306 8 HOH HOH A . C 3 HOH 7 307 21 HOH HOH A . C 3 HOH 8 308 15 HOH HOH A . C 3 HOH 9 309 23 HOH HOH A . C 3 HOH 10 310 14 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_655 -x+1,-y,z -1.0000000000 0.0000000000 0.0000000000 49.9750000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 8_556 x-y,-y,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 118.6770000000 4 'crystal symmetry operation' 11_656 -x+y+1,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 49.9750000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 118.6770000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 304 ? C HOH . 2 1 A HOH 308 ? C HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-06-24 2 'Structure model' 1 1 2020-07-01 3 'Structure model' 1 2 2020-08-12 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 2 'Structure model' '_citation_author.identifier_ORCID' 4 2 'Structure model' '_citation_author.name' 5 3 'Structure model' '_citation.journal_volume' 6 3 'Structure model' '_citation.page_first' 7 3 'Structure model' '_citation.page_last' 8 3 'Structure model' '_citation_author.name' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1_2575 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? TRUNCATE ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? SHARP ? ? ? . 5 # _pdbx_entry_details.entry_id 6PSH _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 67 ? ? -172.67 71.13 2 1 LYS A 93 ? ? -100.70 61.44 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 24 ? A MET 1 2 1 Y 1 A GLU 95 ? A GLU 72 3 1 Y 1 A THR 96 ? A THR 73 4 1 Y 1 A GLU 97 ? A GLU 74 5 1 Y 1 A LYS 98 ? A LYS 75 6 1 Y 1 A LEU 99 ? A LEU 76 7 1 Y 1 A ALA 100 ? A ALA 77 8 1 Y 1 A ALA 101 ? A ALA 78 9 1 Y 1 A ALA 102 ? A ALA 79 10 1 Y 1 A LEU 103 ? A LEU 80 11 1 Y 1 A GLU 104 ? A GLU 81 12 1 Y 1 A HIS 105 ? A HIS 82 13 1 Y 1 A HIS 106 ? A HIS 83 14 1 Y 1 A HIS 107 ? A HIS 84 15 1 Y 1 A HIS 108 ? A HIS 85 16 1 Y 1 A HIS 109 ? A HIS 86 17 1 Y 1 A HIS 110 ? A HIS 87 # _pdbx_audit_support.funding_organization 'Welch Foundation' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number A-0015 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,2-ETHANEDIOL EDO 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #