data_6PYA # _entry.id 6PYA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.322 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6PYA WWPDB D_1000242300 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6PYA _pdbx_database_status.recvd_initial_deposition_date 2019-07-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Round, P.W.' 1 0000-0001-9167-1974 'Das, S.' 2 0000-0003-0615-5647 'Van Petegem, F.' 3 0000-0003-2728-8537 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 295 _citation.language ? _citation.page_first 1202 _citation.page_last 1211 _citation.title 'Molecular interactions between sex hormone-binding globulin and nonsteroidal ligands that enhance androgen activity.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.RA119.011051 _citation.pdbx_database_id_PubMed 31852737 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Round, P.' 1 0000-0001-9167-1974 primary 'Das, S.' 2 ? primary 'Wu, T.S.' 3 ? primary 'Wahala, K.' 4 0000-0003-4082-8622 primary 'Van Petegem, F.' 5 ? primary 'Hammond, G.L.' 6 0000-0002-4639-7336 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6PYA _cell.details ? _cell.formula_units_Z ? _cell.length_a 52.241 _cell.length_a_esd ? _cell.length_b 52.241 _cell.length_b_esd ? _cell.length_c 147.870 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6PYA _symmetry.cell_setting ? _symmetry.Int_Tables_number 95 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Sex hormone-binding globulin' 22610.689 1 ? E176K ? ? 2 non-polymer syn '3-[(1H-imidazol-1-yl)methyl]-2-phenyl-1H-indole' 273.332 1 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 4 water nat water 18.015 121 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;SHBG,Sex steroid-binding protein,SBP,Testis-specific androgen-binding protein,ABP,Testosterone-estradiol-binding globulin,TeBG,Testosterone-estrogen-binding globulin ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;LRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQL HNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPA LDGCLRRDSWLDKQAKISASAPTSLRSCDVESNPGIFLPPGTQAE ; _entity_poly.pdbx_seq_one_letter_code_can ;LRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQL HNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPA LDGCLRRDSWLDKQAKISASAPTSLRSCDVESNPGIFLPPGTQAE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 ARG n 1 3 PRO n 1 4 VAL n 1 5 LEU n 1 6 PRO n 1 7 THR n 1 8 GLN n 1 9 SER n 1 10 ALA n 1 11 HIS n 1 12 ASP n 1 13 PRO n 1 14 PRO n 1 15 ALA n 1 16 VAL n 1 17 HIS n 1 18 LEU n 1 19 SER n 1 20 ASN n 1 21 GLY n 1 22 PRO n 1 23 GLY n 1 24 GLN n 1 25 GLU n 1 26 PRO n 1 27 ILE n 1 28 ALA n 1 29 VAL n 1 30 MET n 1 31 THR n 1 32 PHE n 1 33 ASP n 1 34 LEU n 1 35 THR n 1 36 LYS n 1 37 ILE n 1 38 THR n 1 39 LYS n 1 40 THR n 1 41 SER n 1 42 SER n 1 43 SER n 1 44 PHE n 1 45 GLU n 1 46 VAL n 1 47 ARG n 1 48 THR n 1 49 TRP n 1 50 ASP n 1 51 PRO n 1 52 GLU n 1 53 GLY n 1 54 VAL n 1 55 ILE n 1 56 PHE n 1 57 TYR n 1 58 GLY n 1 59 ASP n 1 60 THR n 1 61 ASN n 1 62 PRO n 1 63 LYS n 1 64 ASP n 1 65 ASP n 1 66 TRP n 1 67 PHE n 1 68 MET n 1 69 LEU n 1 70 GLY n 1 71 LEU n 1 72 ARG n 1 73 ASP n 1 74 GLY n 1 75 ARG n 1 76 PRO n 1 77 GLU n 1 78 ILE n 1 79 GLN n 1 80 LEU n 1 81 HIS n 1 82 ASN n 1 83 HIS n 1 84 TRP n 1 85 ALA n 1 86 GLN n 1 87 LEU n 1 88 THR n 1 89 VAL n 1 90 GLY n 1 91 ALA n 1 92 GLY n 1 93 PRO n 1 94 ARG n 1 95 LEU n 1 96 ASP n 1 97 ASP n 1 98 GLY n 1 99 ARG n 1 100 TRP n 1 101 HIS n 1 102 GLN n 1 103 VAL n 1 104 GLU n 1 105 VAL n 1 106 LYS n 1 107 MET n 1 108 GLU n 1 109 GLY n 1 110 ASP n 1 111 SER n 1 112 VAL n 1 113 LEU n 1 114 LEU n 1 115 GLU n 1 116 VAL n 1 117 ASP n 1 118 GLY n 1 119 GLU n 1 120 GLU n 1 121 VAL n 1 122 LEU n 1 123 ARG n 1 124 LEU n 1 125 ARG n 1 126 GLN n 1 127 VAL n 1 128 SER n 1 129 GLY n 1 130 PRO n 1 131 LEU n 1 132 THR n 1 133 SER n 1 134 LYS n 1 135 ARG n 1 136 HIS n 1 137 PRO n 1 138 ILE n 1 139 MET n 1 140 ARG n 1 141 ILE n 1 142 ALA n 1 143 LEU n 1 144 GLY n 1 145 GLY n 1 146 LEU n 1 147 LEU n 1 148 PHE n 1 149 PRO n 1 150 ALA n 1 151 SER n 1 152 ASN n 1 153 LEU n 1 154 ARG n 1 155 LEU n 1 156 PRO n 1 157 LEU n 1 158 VAL n 1 159 PRO n 1 160 ALA n 1 161 LEU n 1 162 ASP n 1 163 GLY n 1 164 CYS n 1 165 LEU n 1 166 ARG n 1 167 ARG n 1 168 ASP n 1 169 SER n 1 170 TRP n 1 171 LEU n 1 172 ASP n 1 173 LYS n 1 174 GLN n 1 175 ALA n 1 176 LYS n 1 177 ILE n 1 178 SER n 1 179 ALA n 1 180 SER n 1 181 ALA n 1 182 PRO n 1 183 THR n 1 184 SER n 1 185 LEU n 1 186 ARG n 1 187 SER n 1 188 CYS n 1 189 ASP n 1 190 VAL n 1 191 GLU n 1 192 SER n 1 193 ASN n 1 194 PRO n 1 195 GLY n 1 196 ILE n 1 197 PHE n 1 198 LEU n 1 199 PRO n 1 200 PRO n 1 201 GLY n 1 202 THR n 1 203 GLN n 1 204 ALA n 1 205 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 205 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene SHBG _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SHBG_HUMAN _struct_ref.pdbx_db_accession P04278 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQL HNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPA LDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAE ; _struct_ref.pdbx_align_begin 30 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6PYA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 205 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P04278 _struct_ref_seq.db_align_beg 30 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 234 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 205 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6PYA _struct_ref_seq_dif.mon_id LYS _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 176 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P04278 _struct_ref_seq_dif.db_mon_id GLU _struct_ref_seq_dif.pdbx_seq_db_seq_num 205 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 176 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 P57 non-polymer . '3-[(1H-imidazol-1-yl)methyl]-2-phenyl-1H-indole' ? 'C18 H15 N3' 273.332 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6PYA _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.58 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.35 _exptl_crystal.description 'Crystals were diamond shaped' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details 'Room Temperature' _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% Peg 3350, 0.2 M potassium thiocyanate, HEPES pH 7.5, 2.5 mM Calcium Chloride' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-03-17 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.03320 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 23-ID-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.03320 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 23-ID-D _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6PYA _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.710 _reflns.d_resolution_low 26.120 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 23105 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.000 _reflns.pdbx_Rmerge_I_obs 0.060 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.200 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 173 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 277976 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.710 1.740 ? ? 15782 ? ? ? 1224 100.000 ? ? ? ? 0.592 ? ? ? ? ? ? ? ? 12.900 ? ? ? 3.800 ? ? ? 1 1 0.924 ? 9.050 26.120 ? ? 2017 ? ? ? 203 96.200 ? ? ? ? 0.038 ? ? ? ? ? ? ? ? 9.900 ? ? ? 46.500 ? ? ? 2 1 0.999 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 100.500 _refine.B_iso_mean 32.5125 _refine.B_iso_min 14.790 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6PYA _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.7100 _refine.ls_d_res_low 26.1200 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 23009 _refine.ls_number_reflns_R_free 1998 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.7900 _refine.ls_percent_reflns_R_free 8.6800 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1879 _refine.ls_R_factor_R_free 0.2158 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1852 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.0400 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1800 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.7100 _refine_hist.d_res_low 26.1200 _refine_hist.number_atoms_solvent 121 _refine_hist.number_atoms_total 1500 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 175 _refine_hist.pdbx_B_iso_mean_ligand 27.40 _refine_hist.pdbx_B_iso_mean_solvent 37.38 _refine_hist.pdbx_number_atoms_protein 1357 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 22 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.7100 1.7528 . . 140 1476 100.0000 . . . 0.2660 0.0000 0.2396 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7528 1.8002 . . 140 1469 100.0000 . . . 0.2766 0.0000 0.2185 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8002 1.8531 . . 139 1465 100.0000 . . . 0.2584 0.0000 0.2118 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8531 1.9129 . . 137 1440 99.0000 . . . 0.2453 0.0000 0.2426 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9129 1.9813 . . 140 1462 100.0000 . . . 0.3123 0.0000 0.2703 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9813 2.0606 . . 141 1480 100.0000 . . . 0.2383 0.0000 0.2014 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0606 2.1543 . . 141 1485 100.0000 . . . 0.2234 0.0000 0.2071 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1543 2.2678 . . 140 1482 100.0000 . . . 0.2691 0.0000 0.2105 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2678 2.4098 . . 141 1484 100.0000 . . . 0.2409 0.0000 0.2008 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4098 2.5957 . . 143 1504 100.0000 . . . 0.2728 0.0000 0.1982 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5957 2.8566 . . 145 1514 100.0000 . . . 0.2304 0.0000 0.1925 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8566 3.2693 . . 145 1529 100.0000 . . . 0.2086 0.0000 0.1901 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2693 4.1164 . . 148 1557 100.0000 . . . 0.1804 0.0000 0.1624 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.1164 26.1200 . . 158 1664 100.0000 . . . 0.1780 0.0000 0.1525 . . . . . . . . . . # _struct.entry_id 6PYA _struct.title 'Sex Hormone-binding globulin mutant E176K in complex with IPI' _struct.pdbx_descriptor 'Sex hormone-binding globulin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6PYA _struct_keywords.text 'Sex Steroid Transport Binding Globulin, HORMONE' _struct_keywords.pdbx_keywords HORMONE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 149 ? LEU A 153 ? PRO A 149 LEU A 153 5 ? 5 HELX_P HELX_P2 AA2 ASP A 172 ? GLN A 174 ? ASP A 172 GLN A 174 5 ? 3 HELX_P HELX_P3 AA3 ALA A 181 ? LEU A 185 ? ALA A 181 LEU A 185 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 164 SG ? ? ? 1_555 A CYS 188 SG ? ? A CYS 164 A CYS 188 1_555 ? ? ? ? ? ? ? 2.043 ? metalc1 metalc ? ? A ASP 50 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 50 A CA 302 1_555 ? ? ? ? ? ? ? 2.564 ? metalc2 metalc ? ? A ASP 50 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 50 A CA 302 1_555 ? ? ? ? ? ? ? 2.371 ? metalc3 metalc ? ? A GLU 52 O ? ? ? 1_555 C CA . CA ? ? A GLU 52 A CA 302 1_555 ? ? ? ? ? ? ? 2.334 ? metalc4 metalc ? ? A ALA 160 O ? ? ? 1_555 C CA . CA ? ? A ALA 160 A CA 302 1_555 ? ? ? ? ? ? ? 2.353 ? metalc5 metalc ? ? C CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 302 A HOH 426 1_555 ? ? ? ? ? ? ? 2.361 ? metalc6 metalc ? ? C CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 302 A HOH 489 1_555 ? ? ? ? ? ? ? 2.324 ? metalc7 metalc ? ? C CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 302 A HOH 501 1_555 ? ? ? ? ? ? ? 2.528 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 16 ? HIS A 17 ? VAL A 16 HIS A 17 AA1 2 GLY A 163 ? TRP A 170 ? GLY A 163 TRP A 170 AA1 3 SER A 41 ? THR A 48 ? SER A 41 THR A 48 AA1 4 HIS A 101 ? GLU A 108 ? HIS A 101 GLU A 108 AA1 5 SER A 111 ? VAL A 116 ? SER A 111 VAL A 116 AA1 6 GLU A 119 ? LEU A 124 ? GLU A 119 LEU A 124 AA2 1 GLN A 86 ? GLY A 90 ? GLN A 86 GLY A 90 AA2 2 ARG A 75 ? HIS A 81 ? ARG A 75 HIS A 81 AA2 3 ASP A 65 ? ARG A 72 ? ASP A 65 ARG A 72 AA2 4 GLY A 53 ? ASN A 61 ? GLY A 53 ASN A 61 AA2 5 ILE A 138 ? LEU A 143 ? ILE A 138 LEU A 143 AA2 6 ALA A 28 ? ASP A 33 ? ALA A 28 ASP A 33 AA2 7 LYS A 176 ? ALA A 179 ? LYS A 176 ALA A 179 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 16 ? N VAL A 16 O LEU A 165 ? O LEU A 165 AA1 2 3 O SER A 169 ? O SER A 169 N SER A 43 ? N SER A 43 AA1 3 4 N PHE A 44 ? N PHE A 44 O VAL A 103 ? O VAL A 103 AA1 4 5 N LYS A 106 ? N LYS A 106 O LEU A 113 ? O LEU A 113 AA1 5 6 N VAL A 112 ? N VAL A 112 O LEU A 124 ? O LEU A 124 AA2 1 2 O VAL A 89 ? O VAL A 89 N ILE A 78 ? N ILE A 78 AA2 2 3 O GLU A 77 ? O GLU A 77 N GLY A 70 ? N GLY A 70 AA2 3 4 O LEU A 69 ? O LEU A 69 N PHE A 56 ? N PHE A 56 AA2 4 5 N TYR A 57 ? N TYR A 57 O ALA A 142 ? O ALA A 142 AA2 5 6 O MET A 139 ? O MET A 139 N PHE A 32 ? N PHE A 32 AA2 6 7 N THR A 31 ? N THR A 31 O ILE A 177 ? O ILE A 177 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A P57 301 ? 7 'binding site for residue P57 A 301' AC2 Software A CA 302 ? 6 'binding site for residue CA A 302' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 SER A 42 ? SER A 42 . ? 1_555 ? 2 AC1 7 PHE A 67 ? PHE A 67 . ? 1_555 ? 3 AC1 7 VAL A 105 ? VAL A 105 . ? 1_555 ? 4 AC1 7 MET A 107 ? MET A 107 . ? 1_555 ? 5 AC1 7 MET A 139 ? MET A 139 . ? 1_555 ? 6 AC1 7 LEU A 171 ? LEU A 171 . ? 1_555 ? 7 AC1 7 HOH D . ? HOH A 488 . ? 1_555 ? 8 AC2 6 ASP A 50 ? ASP A 50 . ? 1_555 ? 9 AC2 6 GLU A 52 ? GLU A 52 . ? 1_555 ? 10 AC2 6 ALA A 160 ? ALA A 160 . ? 1_555 ? 11 AC2 6 HOH D . ? HOH A 426 . ? 1_555 ? 12 AC2 6 HOH D . ? HOH A 489 . ? 1_555 ? 13 AC2 6 HOH D . ? HOH A 501 . ? 1_555 ? # _atom_sites.entry_id 6PYA _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.019142 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019142 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006763 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CA ? ? 16.26893 3.65395 ? ? 3.58509 77.28589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 1 ? ? ? A . n A 1 2 ARG 2 2 ? ? ? A . n A 1 3 PRO 3 3 ? ? ? A . n A 1 4 VAL 4 4 ? ? ? A . n A 1 5 LEU 5 5 ? ? ? A . n A 1 6 PRO 6 6 ? ? ? A . n A 1 7 THR 7 7 ? ? ? A . n A 1 8 GLN 8 8 ? ? ? A . n A 1 9 SER 9 9 ? ? ? A . n A 1 10 ALA 10 10 ? ? ? A . n A 1 11 HIS 11 11 ? ? ? A . n A 1 12 ASP 12 12 ? ? ? A . n A 1 13 PRO 13 13 ? ? ? A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 TRP 49 49 49 TRP TRP A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 TRP 66 66 66 TRP TRP A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 MET 68 68 68 MET MET A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 HIS 83 83 83 HIS HIS A . n A 1 84 TRP 84 84 84 TRP TRP A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 TRP 100 100 100 TRP TRP A . n A 1 101 HIS 101 101 101 HIS HIS A . n A 1 102 GLN 102 102 102 GLN GLN A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 MET 107 107 107 MET MET A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 ARG 123 123 123 ARG ARG A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 GLN 126 126 126 GLN GLN A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 PRO 130 130 130 PRO PRO A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 ARG 135 135 135 ARG ARG A . n A 1 136 HIS 136 136 136 HIS HIS A . n A 1 137 PRO 137 137 137 PRO PRO A . n A 1 138 ILE 138 138 138 ILE ILE A . n A 1 139 MET 139 139 139 MET MET A . n A 1 140 ARG 140 140 140 ARG ARG A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 PHE 148 148 148 PHE PHE A . n A 1 149 PRO 149 149 149 PRO PRO A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 ASN 152 152 152 ASN ASN A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 PRO 156 156 156 PRO PRO A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 PRO 159 159 159 PRO PRO A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 CYS 164 164 164 CYS CYS A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 ARG 166 166 166 ARG ARG A . n A 1 167 ARG 167 167 167 ARG ARG A . n A 1 168 ASP 168 168 168 ASP ASP A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 TRP 170 170 170 TRP TRP A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 ASP 172 172 172 ASP ASP A . n A 1 173 LYS 173 173 173 LYS LYS A . n A 1 174 GLN 174 174 174 GLN GLN A . n A 1 175 ALA 175 175 175 ALA ALA A . n A 1 176 LYS 176 176 176 LYS LYS A . n A 1 177 ILE 177 177 177 ILE ILE A . n A 1 178 SER 178 178 178 SER SER A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 SER 180 180 180 SER SER A . n A 1 181 ALA 181 181 181 ALA ALA A . n A 1 182 PRO 182 182 182 PRO PRO A . n A 1 183 THR 183 183 183 THR THR A . n A 1 184 SER 184 184 184 SER SER A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 ARG 186 186 186 ARG ARG A . n A 1 187 SER 187 187 187 SER SER A . n A 1 188 CYS 188 188 188 CYS CYS A . n A 1 189 ASP 189 189 ? ? ? A . n A 1 190 VAL 190 190 ? ? ? A . n A 1 191 GLU 191 191 ? ? ? A . n A 1 192 SER 192 192 ? ? ? A . n A 1 193 ASN 193 193 ? ? ? A . n A 1 194 PRO 194 194 ? ? ? A . n A 1 195 GLY 195 195 ? ? ? A . n A 1 196 ILE 196 196 ? ? ? A . n A 1 197 PHE 197 197 ? ? ? A . n A 1 198 LEU 198 198 ? ? ? A . n A 1 199 PRO 199 199 ? ? ? A . n A 1 200 PRO 200 200 ? ? ? A . n A 1 201 GLY 201 201 ? ? ? A . n A 1 202 THR 202 202 ? ? ? A . n A 1 203 GLN 203 203 ? ? ? A . n A 1 204 ALA 204 204 ? ? ? A . n A 1 205 GLU 205 205 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 P57 1 301 2 P57 DRG A . C 3 CA 1 302 1 CA CA A . D 4 HOH 1 401 106 HOH HOH A . D 4 HOH 2 402 111 HOH HOH A . D 4 HOH 3 403 17 HOH HOH A . D 4 HOH 4 404 84 HOH HOH A . D 4 HOH 5 405 32 HOH HOH A . D 4 HOH 6 406 121 HOH HOH A . D 4 HOH 7 407 14 HOH HOH A . D 4 HOH 8 408 147 HOH HOH A . D 4 HOH 9 409 41 HOH HOH A . D 4 HOH 10 410 125 HOH HOH A . D 4 HOH 11 411 82 HOH HOH A . D 4 HOH 12 412 43 HOH HOH A . D 4 HOH 13 413 150 HOH HOH A . D 4 HOH 14 414 117 HOH HOH A . D 4 HOH 15 415 140 HOH HOH A . D 4 HOH 16 416 76 HOH HOH A . D 4 HOH 17 417 94 HOH HOH A . D 4 HOH 18 418 48 HOH HOH A . D 4 HOH 19 419 158 HOH HOH A . D 4 HOH 20 420 2 HOH HOH A . D 4 HOH 21 421 8 HOH HOH A . D 4 HOH 22 422 87 HOH HOH A . D 4 HOH 23 423 22 HOH HOH A . D 4 HOH 24 424 29 HOH HOH A . D 4 HOH 25 425 15 HOH HOH A . D 4 HOH 26 426 20 HOH HOH A . D 4 HOH 27 427 4 HOH HOH A . D 4 HOH 28 428 99 HOH HOH A . D 4 HOH 29 429 88 HOH HOH A . D 4 HOH 30 430 3 HOH HOH A . D 4 HOH 31 431 100 HOH HOH A . D 4 HOH 32 432 28 HOH HOH A . D 4 HOH 33 433 52 HOH HOH A . D 4 HOH 34 434 35 HOH HOH A . D 4 HOH 35 435 44 HOH HOH A . D 4 HOH 36 436 58 HOH HOH A . D 4 HOH 37 437 9 HOH HOH A . D 4 HOH 38 438 64 HOH HOH A . D 4 HOH 39 439 46 HOH HOH A . D 4 HOH 40 440 79 HOH HOH A . D 4 HOH 41 441 80 HOH HOH A . D 4 HOH 42 442 23 HOH HOH A . D 4 HOH 43 443 24 HOH HOH A . D 4 HOH 44 444 115 HOH HOH A . D 4 HOH 45 445 6 HOH HOH A . D 4 HOH 46 446 36 HOH HOH A . D 4 HOH 47 447 1 HOH HOH A . D 4 HOH 48 448 12 HOH HOH A . D 4 HOH 49 449 133 HOH HOH A . D 4 HOH 50 450 120 HOH HOH A . D 4 HOH 51 451 33 HOH HOH A . D 4 HOH 52 452 72 HOH HOH A . D 4 HOH 53 453 67 HOH HOH A . D 4 HOH 54 454 37 HOH HOH A . D 4 HOH 55 455 57 HOH HOH A . D 4 HOH 56 456 124 HOH HOH A . D 4 HOH 57 457 49 HOH HOH A . D 4 HOH 58 458 70 HOH HOH A . D 4 HOH 59 459 10 HOH HOH A . D 4 HOH 60 460 31 HOH HOH A . D 4 HOH 61 461 5 HOH HOH A . D 4 HOH 62 462 93 HOH HOH A . D 4 HOH 63 463 30 HOH HOH A . D 4 HOH 64 464 89 HOH HOH A . D 4 HOH 65 465 135 HOH HOH A . D 4 HOH 66 466 13 HOH HOH A . D 4 HOH 67 467 130 HOH HOH A . D 4 HOH 68 468 34 HOH HOH A . D 4 HOH 69 469 26 HOH HOH A . D 4 HOH 70 470 85 HOH HOH A . D 4 HOH 71 471 27 HOH HOH A . D 4 HOH 72 472 95 HOH HOH A . D 4 HOH 73 473 42 HOH HOH A . D 4 HOH 74 474 53 HOH HOH A . D 4 HOH 75 475 114 HOH HOH A . D 4 HOH 76 476 109 HOH HOH A . D 4 HOH 77 477 126 HOH HOH A . D 4 HOH 78 478 56 HOH HOH A . D 4 HOH 79 479 90 HOH HOH A . D 4 HOH 80 480 59 HOH HOH A . D 4 HOH 81 481 40 HOH HOH A . D 4 HOH 82 482 55 HOH HOH A . D 4 HOH 83 483 73 HOH HOH A . D 4 HOH 84 484 66 HOH HOH A . D 4 HOH 85 485 68 HOH HOH A . D 4 HOH 86 486 113 HOH HOH A . D 4 HOH 87 487 91 HOH HOH A . D 4 HOH 88 488 83 HOH HOH A . D 4 HOH 89 489 19 HOH HOH A . D 4 HOH 90 490 118 HOH HOH A . D 4 HOH 91 491 39 HOH HOH A . D 4 HOH 92 492 45 HOH HOH A . D 4 HOH 93 493 129 HOH HOH A . D 4 HOH 94 494 16 HOH HOH A . D 4 HOH 95 495 69 HOH HOH A . D 4 HOH 96 496 50 HOH HOH A . D 4 HOH 97 497 54 HOH HOH A . D 4 HOH 98 498 97 HOH HOH A . D 4 HOH 99 499 61 HOH HOH A . D 4 HOH 100 500 62 HOH HOH A . D 4 HOH 101 501 18 HOH HOH A . D 4 HOH 102 502 157 HOH HOH A . D 4 HOH 103 503 60 HOH HOH A . D 4 HOH 104 504 11 HOH HOH A . D 4 HOH 105 505 119 HOH HOH A . D 4 HOH 106 506 86 HOH HOH A . D 4 HOH 107 507 63 HOH HOH A . D 4 HOH 108 508 145 HOH HOH A . D 4 HOH 109 509 81 HOH HOH A . D 4 HOH 110 510 137 HOH HOH A . D 4 HOH 111 511 159 HOH HOH A . D 4 HOH 112 512 146 HOH HOH A . D 4 HOH 113 513 105 HOH HOH A . D 4 HOH 114 514 21 HOH HOH A . D 4 HOH 115 515 7 HOH HOH A . D 4 HOH 116 516 25 HOH HOH A . D 4 HOH 117 517 103 HOH HOH A . D 4 HOH 118 518 65 HOH HOH A . D 4 HOH 119 519 74 HOH HOH A . D 4 HOH 120 520 98 HOH HOH A . D 4 HOH 121 521 134 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_444 -y-1,-x-1,-z-1/4 0.0000000000 -1.0000000000 0.0000000000 -52.2410000000 -1.0000000000 0.0000000000 0.0000000000 -52.2410000000 0.0000000000 0.0000000000 -1.0000000000 -36.9675000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 416 ? D HOH . 2 1 A HOH 435 ? D HOH . 3 1 A HOH 439 ? D HOH . 4 1 A HOH 520 ? D HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 50 ? A ASP 50 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 OD2 ? A ASP 50 ? A ASP 50 ? 1_555 52.7 ? 2 OD1 ? A ASP 50 ? A ASP 50 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 O ? A GLU 52 ? A GLU 52 ? 1_555 73.7 ? 3 OD2 ? A ASP 50 ? A ASP 50 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 O ? A GLU 52 ? A GLU 52 ? 1_555 92.4 ? 4 OD1 ? A ASP 50 ? A ASP 50 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 O ? A ALA 160 ? A ALA 160 ? 1_555 130.9 ? 5 OD2 ? A ASP 50 ? A ASP 50 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 O ? A ALA 160 ? A ALA 160 ? 1_555 87.3 ? 6 O ? A GLU 52 ? A GLU 52 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 O ? A ALA 160 ? A ALA 160 ? 1_555 82.1 ? 7 OD1 ? A ASP 50 ? A ASP 50 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 O ? D HOH . ? A HOH 426 ? 1_555 135.6 ? 8 OD2 ? A ASP 50 ? A ASP 50 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 O ? D HOH . ? A HOH 426 ? 1_555 170.5 ? 9 O ? A GLU 52 ? A GLU 52 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 O ? D HOH . ? A HOH 426 ? 1_555 87.0 ? 10 O ? A ALA 160 ? A ALA 160 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 O ? D HOH . ? A HOH 426 ? 1_555 83.3 ? 11 OD1 ? A ASP 50 ? A ASP 50 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 O ? D HOH . ? A HOH 489 ? 1_555 75.6 ? 12 OD2 ? A ASP 50 ? A ASP 50 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 O ? D HOH . ? A HOH 489 ? 1_555 114.3 ? 13 O ? A GLU 52 ? A GLU 52 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 O ? D HOH . ? A HOH 489 ? 1_555 110.6 ? 14 O ? A ALA 160 ? A ALA 160 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 O ? D HOH . ? A HOH 489 ? 1_555 153.5 ? 15 O ? D HOH . ? A HOH 426 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 O ? D HOH . ? A HOH 489 ? 1_555 74.6 ? 16 OD1 ? A ASP 50 ? A ASP 50 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 O ? D HOH . ? A HOH 501 ? 1_555 109.8 ? 17 OD2 ? A ASP 50 ? A ASP 50 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 O ? D HOH . ? A HOH 501 ? 1_555 80.9 ? 18 O ? A GLU 52 ? A GLU 52 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 O ? D HOH . ? A HOH 501 ? 1_555 167.1 ? 19 O ? A ALA 160 ? A ALA 160 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 O ? D HOH . ? A HOH 501 ? 1_555 86.6 ? 20 O ? D HOH . ? A HOH 426 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 O ? D HOH . ? A HOH 501 ? 1_555 97.9 ? 21 O ? D HOH . ? A HOH 489 ? 1_555 CA ? C CA . ? A CA 302 ? 1_555 O ? D HOH . ? A HOH 501 ? 1_555 82.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-12-25 2 'Structure model' 1 1 2020-01-01 3 'Structure model' 1 2 2020-02-12 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_DOI' 2 2 'Structure model' '_citation.pdbx_database_id_PubMed' 3 2 'Structure model' '_citation.title' 4 2 'Structure model' '_citation_author.identifier_ORCID' 5 2 'Structure model' '_citation_author.name' 6 3 'Structure model' '_citation.journal_volume' 7 3 'Structure model' '_citation.page_first' 8 3 'Structure model' '_citation.page_last' 9 3 'Structure model' '_citation.title' 10 3 'Structure model' '_citation.year' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.15.2_3472)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.23 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 6PYA _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 40 ? ? -108.92 40.16 2 1 ASN A 61 ? ? -163.64 114.05 3 1 ASP A 96 ? ? -93.11 46.00 4 1 LEU A 171 ? ? 50.40 -127.42 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A SER 133 ? OG ? A SER 133 OG 2 1 Y 1 A LYS 134 ? CG ? A LYS 134 CG 3 1 Y 1 A LYS 134 ? CD ? A LYS 134 CD 4 1 Y 1 A LYS 134 ? CE ? A LYS 134 CE 5 1 Y 1 A LYS 134 ? NZ ? A LYS 134 NZ 6 1 Y 1 A LYS 173 ? CG ? A LYS 173 CG 7 1 Y 1 A LYS 173 ? CD ? A LYS 173 CD 8 1 Y 1 A LYS 173 ? CE ? A LYS 173 CE 9 1 Y 1 A LYS 173 ? NZ ? A LYS 173 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 1 ? A LEU 1 2 1 Y 1 A ARG 2 ? A ARG 2 3 1 Y 1 A PRO 3 ? A PRO 3 4 1 Y 1 A VAL 4 ? A VAL 4 5 1 Y 1 A LEU 5 ? A LEU 5 6 1 Y 1 A PRO 6 ? A PRO 6 7 1 Y 1 A THR 7 ? A THR 7 8 1 Y 1 A GLN 8 ? A GLN 8 9 1 Y 1 A SER 9 ? A SER 9 10 1 Y 1 A ALA 10 ? A ALA 10 11 1 Y 1 A HIS 11 ? A HIS 11 12 1 Y 1 A ASP 12 ? A ASP 12 13 1 Y 1 A PRO 13 ? A PRO 13 14 1 Y 1 A ASP 189 ? A ASP 189 15 1 Y 1 A VAL 190 ? A VAL 190 16 1 Y 1 A GLU 191 ? A GLU 191 17 1 Y 1 A SER 192 ? A SER 192 18 1 Y 1 A ASN 193 ? A ASN 193 19 1 Y 1 A PRO 194 ? A PRO 194 20 1 Y 1 A GLY 195 ? A GLY 195 21 1 Y 1 A ILE 196 ? A ILE 196 22 1 Y 1 A PHE 197 ? A PHE 197 23 1 Y 1 A LEU 198 ? A LEU 198 24 1 Y 1 A PRO 199 ? A PRO 199 25 1 Y 1 A PRO 200 ? A PRO 200 26 1 Y 1 A GLY 201 ? A GLY 201 27 1 Y 1 A THR 202 ? A THR 202 28 1 Y 1 A GLN 203 ? A GLN 203 29 1 Y 1 A ALA 204 ? A ALA 204 30 1 Y 1 A GLU 205 ? A GLU 205 # _pdbx_audit_support.funding_organization 'Canadian Institutes of Health Research (CIHR)' _pdbx_audit_support.country Canada _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id P57 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id P57 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '3-[(1H-imidazol-1-yl)methyl]-2-phenyl-1H-indole' P57 3 'CALCIUM ION' CA 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'native gel electrophoresis' _pdbx_struct_assembly_auth_evidence.details 'Established in the literature' # _space_group.name_H-M_alt 'P 43 2 2' _space_group.name_Hall 'P 4cw 2c' _space_group.IT_number 95 _space_group.crystal_system tetragonal _space_group.id 1 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x,z+3/4 3 y,-x,z+1/4 4 x,-y,-z+1/2 5 -x,y,-z 6 -x,-y,z+1/2 7 y,x,-z+1/4 8 -y,-x,-z+3/4 #