data_6Q64 # _entry.id 6Q64 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.314 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6Q64 WWPDB D_1200013149 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6Q64 _pdbx_database_status.recvd_initial_deposition_date 2018-12-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Basle, A.' 1 ? 'Paterson, N.' 2 ? 'Crouch, L.' 3 ? 'Bolam, D.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Microbiol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2058-5276 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 4 _citation.language ? _citation.page_first 1571 _citation.page_last 1581 _citation.title ;Complex N-glycan breakdown by gut Bacteroides involves an extensive enzymatic apparatus encoded by multiple co-regulated genetic loci. ; _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41564-019-0466-x _citation.pdbx_database_id_PubMed 31160824 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Briliute, J.' 1 ? primary 'Urbanowicz, P.A.' 2 ? primary 'Luis, A.S.' 3 ? primary 'Basle, A.' 4 ? primary 'Paterson, N.' 5 ? primary 'Rebello, O.' 6 ? primary 'Hendel, J.' 7 ? primary 'Ndeh, D.A.' 8 ? primary 'Lowe, E.C.' 9 ? primary 'Martens, E.C.' 10 ? primary 'Spencer, D.I.R.' 11 ? primary 'Bolam, D.N.' 12 ? primary 'Crouch, L.I.' 13 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6Q64 _cell.details ? _cell.formula_units_Z ? _cell.length_a 119.584 _cell.length_a_esd ? _cell.length_b 119.584 _cell.length_b_esd ? _cell.length_c 83.094 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6Q64 _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Endoglycosidase _entity.formula_weight 42117.867 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Glycoside hydrolase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)KLLKYLCIGISALSILSCSDWTSEEREVFENQEG(MSE)HRLIPLIEAQTEEDLTPT(MSE)REYFAQIREYRKT PHVKGFGWFGNWTGKGNNAQNYLK(MSE)LPDSVDFVSLWGTRGYLSDEQKADLKFFQEVKGGKALLCWIIQDLGDQLTP KGLNATQYWVEEKGQGNFIEGVKAYANAICDSIEKYNLDGFDIDYQPGYGHSGTLANYQTISPSGNNK(MSE)QVFIETL SARLRPAGR(MSE)LV(MSE)DGQPDLLSTETSKLVDHYIYQAYWESSTSSVIYKINKPNLDDWERKTIITVEFEQGWKT GGITYYTSVRPELNS(MSE)EGNQILDYATLDLPSGKRIGGIGTYH(MSE)EYDYPNDPPYKWLRKALYFGNQVYPGKFD ; _entity_poly.pdbx_seq_one_letter_code_can ;MKLLKYLCIGISALSILSCSDWTSEEREVFENQEGMHRLIPLIEAQTEEDLTPTMREYFAQIREYRKTPHVKGFGWFGNW TGKGNNAQNYLKMLPDSVDFVSLWGTRGYLSDEQKADLKFFQEVKGGKALLCWIIQDLGDQLTPKGLNATQYWVEEKGQG NFIEGVKAYANAICDSIEKYNLDGFDIDYQPGYGHSGTLANYQTISPSGNNKMQVFIETLSARLRPAGRMLVMDGQPDLL STETSKLVDHYIYQAYWESSTSSVIYKINKPNLDDWERKTIITVEFEQGWKTGGITYYTSVRPELNSMEGNQILDYATLD LPSGKRIGGIGTYHMEYDYPNDPPYKWLRKALYFGNQVYPGKFD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 LYS n 1 3 LEU n 1 4 LEU n 1 5 LYS n 1 6 TYR n 1 7 LEU n 1 8 CYS n 1 9 ILE n 1 10 GLY n 1 11 ILE n 1 12 SER n 1 13 ALA n 1 14 LEU n 1 15 SER n 1 16 ILE n 1 17 LEU n 1 18 SER n 1 19 CYS n 1 20 SER n 1 21 ASP n 1 22 TRP n 1 23 THR n 1 24 SER n 1 25 GLU n 1 26 GLU n 1 27 ARG n 1 28 GLU n 1 29 VAL n 1 30 PHE n 1 31 GLU n 1 32 ASN n 1 33 GLN n 1 34 GLU n 1 35 GLY n 1 36 MSE n 1 37 HIS n 1 38 ARG n 1 39 LEU n 1 40 ILE n 1 41 PRO n 1 42 LEU n 1 43 ILE n 1 44 GLU n 1 45 ALA n 1 46 GLN n 1 47 THR n 1 48 GLU n 1 49 GLU n 1 50 ASP n 1 51 LEU n 1 52 THR n 1 53 PRO n 1 54 THR n 1 55 MSE n 1 56 ARG n 1 57 GLU n 1 58 TYR n 1 59 PHE n 1 60 ALA n 1 61 GLN n 1 62 ILE n 1 63 ARG n 1 64 GLU n 1 65 TYR n 1 66 ARG n 1 67 LYS n 1 68 THR n 1 69 PRO n 1 70 HIS n 1 71 VAL n 1 72 LYS n 1 73 GLY n 1 74 PHE n 1 75 GLY n 1 76 TRP n 1 77 PHE n 1 78 GLY n 1 79 ASN n 1 80 TRP n 1 81 THR n 1 82 GLY n 1 83 LYS n 1 84 GLY n 1 85 ASN n 1 86 ASN n 1 87 ALA n 1 88 GLN n 1 89 ASN n 1 90 TYR n 1 91 LEU n 1 92 LYS n 1 93 MSE n 1 94 LEU n 1 95 PRO n 1 96 ASP n 1 97 SER n 1 98 VAL n 1 99 ASP n 1 100 PHE n 1 101 VAL n 1 102 SER n 1 103 LEU n 1 104 TRP n 1 105 GLY n 1 106 THR n 1 107 ARG n 1 108 GLY n 1 109 TYR n 1 110 LEU n 1 111 SER n 1 112 ASP n 1 113 GLU n 1 114 GLN n 1 115 LYS n 1 116 ALA n 1 117 ASP n 1 118 LEU n 1 119 LYS n 1 120 PHE n 1 121 PHE n 1 122 GLN n 1 123 GLU n 1 124 VAL n 1 125 LYS n 1 126 GLY n 1 127 GLY n 1 128 LYS n 1 129 ALA n 1 130 LEU n 1 131 LEU n 1 132 CYS n 1 133 TRP n 1 134 ILE n 1 135 ILE n 1 136 GLN n 1 137 ASP n 1 138 LEU n 1 139 GLY n 1 140 ASP n 1 141 GLN n 1 142 LEU n 1 143 THR n 1 144 PRO n 1 145 LYS n 1 146 GLY n 1 147 LEU n 1 148 ASN n 1 149 ALA n 1 150 THR n 1 151 GLN n 1 152 TYR n 1 153 TRP n 1 154 VAL n 1 155 GLU n 1 156 GLU n 1 157 LYS n 1 158 GLY n 1 159 GLN n 1 160 GLY n 1 161 ASN n 1 162 PHE n 1 163 ILE n 1 164 GLU n 1 165 GLY n 1 166 VAL n 1 167 LYS n 1 168 ALA n 1 169 TYR n 1 170 ALA n 1 171 ASN n 1 172 ALA n 1 173 ILE n 1 174 CYS n 1 175 ASP n 1 176 SER n 1 177 ILE n 1 178 GLU n 1 179 LYS n 1 180 TYR n 1 181 ASN n 1 182 LEU n 1 183 ASP n 1 184 GLY n 1 185 PHE n 1 186 ASP n 1 187 ILE n 1 188 ASP n 1 189 TYR n 1 190 GLN n 1 191 PRO n 1 192 GLY n 1 193 TYR n 1 194 GLY n 1 195 HIS n 1 196 SER n 1 197 GLY n 1 198 THR n 1 199 LEU n 1 200 ALA n 1 201 ASN n 1 202 TYR n 1 203 GLN n 1 204 THR n 1 205 ILE n 1 206 SER n 1 207 PRO n 1 208 SER n 1 209 GLY n 1 210 ASN n 1 211 ASN n 1 212 LYS n 1 213 MSE n 1 214 GLN n 1 215 VAL n 1 216 PHE n 1 217 ILE n 1 218 GLU n 1 219 THR n 1 220 LEU n 1 221 SER n 1 222 ALA n 1 223 ARG n 1 224 LEU n 1 225 ARG n 1 226 PRO n 1 227 ALA n 1 228 GLY n 1 229 ARG n 1 230 MSE n 1 231 LEU n 1 232 VAL n 1 233 MSE n 1 234 ASP n 1 235 GLY n 1 236 GLN n 1 237 PRO n 1 238 ASP n 1 239 LEU n 1 240 LEU n 1 241 SER n 1 242 THR n 1 243 GLU n 1 244 THR n 1 245 SER n 1 246 LYS n 1 247 LEU n 1 248 VAL n 1 249 ASP n 1 250 HIS n 1 251 TYR n 1 252 ILE n 1 253 TYR n 1 254 GLN n 1 255 ALA n 1 256 TYR n 1 257 TRP n 1 258 GLU n 1 259 SER n 1 260 SER n 1 261 THR n 1 262 SER n 1 263 SER n 1 264 VAL n 1 265 ILE n 1 266 TYR n 1 267 LYS n 1 268 ILE n 1 269 ASN n 1 270 LYS n 1 271 PRO n 1 272 ASN n 1 273 LEU n 1 274 ASP n 1 275 ASP n 1 276 TRP n 1 277 GLU n 1 278 ARG n 1 279 LYS n 1 280 THR n 1 281 ILE n 1 282 ILE n 1 283 THR n 1 284 VAL n 1 285 GLU n 1 286 PHE n 1 287 GLU n 1 288 GLN n 1 289 GLY n 1 290 TRP n 1 291 LYS n 1 292 THR n 1 293 GLY n 1 294 GLY n 1 295 ILE n 1 296 THR n 1 297 TYR n 1 298 TYR n 1 299 THR n 1 300 SER n 1 301 VAL n 1 302 ARG n 1 303 PRO n 1 304 GLU n 1 305 LEU n 1 306 ASN n 1 307 SER n 1 308 MSE n 1 309 GLU n 1 310 GLY n 1 311 ASN n 1 312 GLN n 1 313 ILE n 1 314 LEU n 1 315 ASP n 1 316 TYR n 1 317 ALA n 1 318 THR n 1 319 LEU n 1 320 ASP n 1 321 LEU n 1 322 PRO n 1 323 SER n 1 324 GLY n 1 325 LYS n 1 326 ARG n 1 327 ILE n 1 328 GLY n 1 329 GLY n 1 330 ILE n 1 331 GLY n 1 332 THR n 1 333 TYR n 1 334 HIS n 1 335 MSE n 1 336 GLU n 1 337 TYR n 1 338 ASP n 1 339 TYR n 1 340 PRO n 1 341 ASN n 1 342 ASP n 1 343 PRO n 1 344 PRO n 1 345 TYR n 1 346 LYS n 1 347 TRP n 1 348 LEU n 1 349 ARG n 1 350 LYS n 1 351 ALA n 1 352 LEU n 1 353 TYR n 1 354 PHE n 1 355 GLY n 1 356 ASN n 1 357 GLN n 1 358 VAL n 1 359 TYR n 1 360 PRO n 1 361 GLY n 1 362 LYS n 1 363 PHE n 1 364 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 364 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BJP75_026240, BSIG_0571, Btheta7330_02659, ERS852430_00349, ERS852511_00641, HMPREF2534_00734' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacteroides thetaiotaomicron' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 818 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0P0FQI4_BACT4 _struct_ref.pdbx_db_accession A0A0P0FQI4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKLLKYLCIGISALSILSCSDWTSEEREVFENQEGMHRLIPLIEAQTEEDLTPTMREYFAQIREYRKTPHVKGFGWFGNW TGKGNNAQNYLKMLPDSVDFVSLWGTRGYLSDEQKADLKFFQEVKGGKALLCWIIQDLGDQLTPKGLNATQYWVEEKGQG NFIEGVKAYANAICDSIEKYNLDGFDIDYEPGYGHSGTLANYQTISPSGNNKMQVFIETLSARLRPAGRMLVMDGQPDLL STETSKLVDHYIYQAYWESSTSSVIYKINKPNLDDWERKTIITVEFEQGWKTGGITYYTSVRPELNSMEGNQILDYATLD LPSGKRIGGIGTYHMEYDYPNDPPYKWLRKALYFGNQVYPGKFD ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6Q64 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 364 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0P0FQI4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 364 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 364 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6Q64 _struct_ref_seq_dif.mon_id GLN _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 190 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code A0A0P0FQI4 _struct_ref_seq_dif.db_mon_id GLU _struct_ref_seq_dif.pdbx_seq_db_seq_num 190 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 190 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6Q64 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.11 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 70.10 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '200 mM NaF, Bis-Tris propane pH 6.5, 20% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-04-15 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9163 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9163 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04-1 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6Q64 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.4 _reflns.d_resolution_low 48.50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 27124 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.1 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.4 _reflns_shell.d_res_low 2.49 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2797 _reflns_shell.percent_possible_all 99.5 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 10.9 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.835 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 2.74 _refine.aniso_B[1][2] 1.37 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 2.74 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] -8.89 _refine.B_iso_max ? _refine.B_iso_mean 82.880 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.969 _refine.correlation_coeff_Fo_to_Fc_free 0.950 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6Q64 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.40 _refine.ls_d_res_low 43.99 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 25784 _refine.ls_number_reflns_R_free 1318 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.81 _refine.ls_percent_reflns_R_free 4.9 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.19930 _refine.ls_R_factor_R_free 0.24364 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.19712 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.200 _refine.pdbx_overall_ESU_R_Free 0.190 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 28.885 _refine.overall_SU_ML 0.249 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 2633 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2633 _refine_hist.d_res_high 2.40 _refine_hist.d_res_low 43.99 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 0.013 2705 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 2401 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.946 1.654 3670 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.353 1.577 5598 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 9.107 5.000 325 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 39.581 23.655 145 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 19.888 15.000 430 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 19.936 15.000 11 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.088 0.200 336 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 0.020 3039 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 578 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 3.517 5.953 1303 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 3.519 5.951 1302 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 5.176 8.936 1627 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 5.174 8.939 1628 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 3.623 6.315 1402 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 3.620 6.309 1400 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 5.500 9.340 2043 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 7.542 68.972 3088 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 7.543 68.899 3086 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.400 _refine_ls_shell.d_res_low 2.462 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 86 _refine_ls_shell.number_reflns_R_work 1883 _refine_ls_shell.percent_reflns_obs 99.49 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.420 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.426 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6Q64 _struct.title 'BT1044SeMet E190Q' _struct.pdbx_descriptor Endoglycosidase _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6Q64 _struct_keywords.text 'Glycoside hydrolase family 18, complex N-glycans, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 41 ? ALA A 45 ? PRO A 41 ALA A 45 5 ? 5 HELX_P HELX_P2 AA2 THR A 47 ? LEU A 51 ? THR A 47 LEU A 51 5 ? 5 HELX_P HELX_P3 AA3 THR A 52 ? ARG A 66 ? THR A 52 ARG A 66 1 ? 15 HELX_P HELX_P4 AA4 ASN A 86 ? LEU A 94 ? ASN A 86 LEU A 94 5 ? 9 HELX_P HELX_P5 AA5 SER A 111 ? VAL A 124 ? SER A 111 VAL A 124 1 ? 14 HELX_P HELX_P6 AA6 ASN A 148 ? VAL A 154 ? ASN A 148 VAL A 154 1 ? 7 HELX_P HELX_P7 AA7 ASN A 161 ? TYR A 180 ? ASN A 161 TYR A 180 1 ? 20 HELX_P HELX_P8 AA8 ASN A 210 ? ARG A 225 ? ASN A 210 ARG A 225 1 ? 16 HELX_P HELX_P9 AA9 PRO A 237 ? LEU A 240 ? PRO A 237 LEU A 240 5 ? 4 HELX_P HELX_P10 AB1 SER A 241 ? LYS A 246 ? SER A 241 LYS A 246 1 ? 6 HELX_P HELX_P11 AB2 SER A 260 ? ASN A 269 ? SER A 260 ASN A 269 1 ? 10 HELX_P HELX_P12 AB3 ASP A 275 ? LYS A 279 ? ASP A 275 LYS A 279 1 ? 5 HELX_P HELX_P13 AB4 PHE A 286 ? TRP A 290 ? PHE A 286 TRP A 290 1 ? 5 HELX_P HELX_P14 AB5 ARG A 302 ? MSE A 308 ? ARG A 302 MSE A 308 5 ? 7 HELX_P HELX_P15 AB6 GLY A 310 ? THR A 318 ? GLY A 310 THR A 318 1 ? 9 HELX_P HELX_P16 AB7 MSE A 335 ? TYR A 339 ? MSE A 335 TYR A 339 5 ? 5 HELX_P HELX_P17 AB8 TYR A 345 ? GLN A 357 ? TYR A 345 GLN A 357 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A THR 54 C ? ? ? 1_555 A MSE 55 N ? ? A THR 54 A MSE 55 1_555 ? ? ? ? ? ? ? 1.345 ? covale2 covale both ? A MSE 55 C ? ? ? 1_555 A ARG 56 N ? ? A MSE 55 A ARG 56 1_555 ? ? ? ? ? ? ? 1.326 ? covale3 covale both ? A LYS 92 C ? ? ? 1_555 A MSE 93 N ? ? A LYS 92 A MSE 93 1_555 ? ? ? ? ? ? ? 1.346 ? covale4 covale both ? A MSE 93 C ? ? ? 1_555 A LEU 94 N ? ? A MSE 93 A LEU 94 1_555 ? ? ? ? ? ? ? 1.333 ? covale5 covale both ? A LYS 212 C ? ? ? 1_555 A MSE 213 N ? ? A LYS 212 A MSE 213 1_555 ? ? ? ? ? ? ? 1.335 ? covale6 covale both ? A MSE 213 C ? ? ? 1_555 A GLN 214 N ? ? A MSE 213 A GLN 214 1_555 ? ? ? ? ? ? ? 1.330 ? covale7 covale both ? A ARG 229 C ? ? ? 1_555 A MSE 230 N ? ? A ARG 229 A MSE 230 1_555 ? ? ? ? ? ? ? 1.327 ? covale8 covale both ? A MSE 230 C ? ? ? 1_555 A LEU 231 N ? ? A MSE 230 A LEU 231 1_555 ? ? ? ? ? ? ? 1.337 ? covale9 covale both ? A VAL 232 C ? ? ? 1_555 A MSE 233 N ? ? A VAL 232 A MSE 233 1_555 ? ? ? ? ? ? ? 1.331 ? covale10 covale both ? A MSE 233 C ? ? ? 1_555 A ASP 234 N ? ? A MSE 233 A ASP 234 1_555 ? ? ? ? ? ? ? 1.330 ? covale11 covale both ? A SER 307 C ? ? ? 1_555 A MSE 308 N ? ? A SER 307 A MSE 308 1_555 ? ? ? ? ? ? ? 1.347 ? covale12 covale both ? A MSE 308 C ? ? ? 1_555 A GLU 309 N ? ? A MSE 308 A GLU 309 1_555 ? ? ? ? ? ? ? 1.330 ? covale13 covale both ? A HIS 334 C ? ? ? 1_555 A MSE 335 N ? ? A HIS 334 A MSE 335 1_555 ? ? ? ? ? ? ? 1.341 ? covale14 covale both ? A MSE 335 C ? ? ? 1_555 A GLU 336 N ? ? A MSE 335 A GLU 336 1_555 ? ? ? ? ? ? ? 1.342 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASP _struct_mon_prot_cis.label_seq_id 342 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASP _struct_mon_prot_cis.auth_seq_id 342 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 343 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 343 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -6.00 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA1 7 8 ? parallel AA1 8 9 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 72 ? TRP A 76 ? LYS A 72 TRP A 76 AA1 2 PHE A 100 ? SER A 102 ? PHE A 100 SER A 102 AA1 3 LYS A 128 ? ILE A 135 ? LYS A 128 ILE A 135 AA1 4 GLY A 184 ? TYR A 189 ? GLY A 184 TYR A 189 AA1 5 MSE A 230 ? GLY A 235 ? MSE A 230 GLY A 235 AA1 6 TYR A 251 ? GLN A 254 ? TYR A 251 GLN A 254 AA1 7 THR A 280 ? GLU A 285 ? THR A 280 GLU A 285 AA1 8 GLY A 329 ? TYR A 333 ? GLY A 329 TYR A 333 AA1 9 LYS A 72 ? TRP A 76 ? LYS A 72 TRP A 76 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 75 ? N GLY A 75 O SER A 102 ? O SER A 102 AA1 2 3 N VAL A 101 ? N VAL A 101 O LEU A 130 ? O LEU A 130 AA1 3 4 N ILE A 135 ? N ILE A 135 O ASP A 188 ? O ASP A 188 AA1 4 5 N ILE A 187 ? N ILE A 187 O ASP A 234 ? O ASP A 234 AA1 5 6 N MSE A 233 ? N MSE A 233 O ILE A 252 ? O ILE A 252 AA1 6 7 N TYR A 251 ? N TYR A 251 O ILE A 281 ? O ILE A 281 AA1 7 8 N VAL A 284 ? N VAL A 284 O TYR A 333 ? O TYR A 333 AA1 8 9 O THR A 332 ? O THR A 332 N TRP A 76 ? N TRP A 76 # _atom_sites.entry_id 6Q64 _atom_sites.fract_transf_matrix[1][1] 0.008362 _atom_sites.fract_transf_matrix[1][2] 0.004828 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009656 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012035 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 LYS 2 2 ? ? ? A . n A 1 3 LEU 3 3 ? ? ? A . n A 1 4 LEU 4 4 ? ? ? A . n A 1 5 LYS 5 5 ? ? ? A . n A 1 6 TYR 6 6 ? ? ? A . n A 1 7 LEU 7 7 ? ? ? A . n A 1 8 CYS 8 8 ? ? ? A . n A 1 9 ILE 9 9 ? ? ? A . n A 1 10 GLY 10 10 ? ? ? A . n A 1 11 ILE 11 11 ? ? ? A . n A 1 12 SER 12 12 ? ? ? A . n A 1 13 ALA 13 13 ? ? ? A . n A 1 14 LEU 14 14 ? ? ? A . n A 1 15 SER 15 15 ? ? ? A . n A 1 16 ILE 16 16 ? ? ? A . n A 1 17 LEU 17 17 ? ? ? A . n A 1 18 SER 18 18 ? ? ? A . n A 1 19 CYS 19 19 ? ? ? A . n A 1 20 SER 20 20 ? ? ? A . n A 1 21 ASP 21 21 ? ? ? A . n A 1 22 TRP 22 22 ? ? ? A . n A 1 23 THR 23 23 ? ? ? A . n A 1 24 SER 24 24 ? ? ? A . n A 1 25 GLU 25 25 ? ? ? A . n A 1 26 GLU 26 26 ? ? ? A . n A 1 27 ARG 27 27 ? ? ? A . n A 1 28 GLU 28 28 ? ? ? A . n A 1 29 VAL 29 29 ? ? ? A . n A 1 30 PHE 30 30 ? ? ? A . n A 1 31 GLU 31 31 ? ? ? A . n A 1 32 ASN 32 32 ? ? ? A . n A 1 33 GLN 33 33 ? ? ? A . n A 1 34 GLU 34 34 ? ? ? A . n A 1 35 GLY 35 35 ? ? ? A . n A 1 36 MSE 36 36 ? ? ? A . n A 1 37 HIS 37 37 ? ? ? A . n A 1 38 ARG 38 38 ? ? ? A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 MSE 55 55 55 MSE MSE A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 TRP 76 76 76 TRP TRP A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 TRP 80 80 80 TRP TRP A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 MSE 93 93 93 MSE MSE A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 TRP 104 104 104 TRP TRP A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 TYR 109 109 109 TYR TYR A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 GLN 114 114 114 GLN GLN A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 PHE 121 121 121 PHE PHE A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 CYS 132 132 132 CYS CYS A . n A 1 133 TRP 133 133 133 TRP TRP A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 GLN 136 136 136 GLN GLN A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 GLN 141 141 141 GLN GLN A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 PRO 144 144 144 PRO PRO A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 ASN 148 148 148 ASN ASN A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 THR 150 150 150 THR THR A . n A 1 151 GLN 151 151 151 GLN GLN A . n A 1 152 TYR 152 152 152 TYR TYR A . n A 1 153 TRP 153 153 153 TRP TRP A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 GLU 156 156 156 GLU GLU A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 GLN 159 159 159 GLN GLN A . n A 1 160 GLY 160 160 160 GLY GLY A . n A 1 161 ASN 161 161 161 ASN ASN A . n A 1 162 PHE 162 162 162 PHE PHE A . n A 1 163 ILE 163 163 163 ILE ILE A . n A 1 164 GLU 164 164 164 GLU GLU A . n A 1 165 GLY 165 165 165 GLY GLY A . n A 1 166 VAL 166 166 166 VAL VAL A . n A 1 167 LYS 167 167 167 LYS LYS A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 TYR 169 169 169 TYR TYR A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 ASN 171 171 171 ASN ASN A . n A 1 172 ALA 172 172 172 ALA ALA A . n A 1 173 ILE 173 173 173 ILE ILE A . n A 1 174 CYS 174 174 174 CYS CYS A . n A 1 175 ASP 175 175 175 ASP ASP A . n A 1 176 SER 176 176 176 SER SER A . n A 1 177 ILE 177 177 177 ILE ILE A . n A 1 178 GLU 178 178 178 GLU GLU A . n A 1 179 LYS 179 179 179 LYS LYS A . n A 1 180 TYR 180 180 180 TYR TYR A . n A 1 181 ASN 181 181 181 ASN ASN A . n A 1 182 LEU 182 182 182 LEU LEU A . n A 1 183 ASP 183 183 183 ASP ASP A . n A 1 184 GLY 184 184 184 GLY GLY A . n A 1 185 PHE 185 185 185 PHE PHE A . n A 1 186 ASP 186 186 186 ASP ASP A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 ASP 188 188 188 ASP ASP A . n A 1 189 TYR 189 189 189 TYR TYR A . n A 1 190 GLN 190 190 190 GLN GLN A . n A 1 191 PRO 191 191 191 PRO PRO A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 TYR 193 193 193 TYR TYR A . n A 1 194 GLY 194 194 194 GLY GLY A . n A 1 195 HIS 195 195 195 HIS HIS A . n A 1 196 SER 196 196 196 SER SER A . n A 1 197 GLY 197 197 197 GLY GLY A . n A 1 198 THR 198 198 198 THR THR A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 ALA 200 200 200 ALA ALA A . n A 1 201 ASN 201 201 201 ASN ASN A . n A 1 202 TYR 202 202 202 TYR TYR A . n A 1 203 GLN 203 203 203 GLN GLN A . n A 1 204 THR 204 204 204 THR THR A . n A 1 205 ILE 205 205 205 ILE ILE A . n A 1 206 SER 206 206 206 SER SER A . n A 1 207 PRO 207 207 207 PRO PRO A . n A 1 208 SER 208 208 208 SER SER A . n A 1 209 GLY 209 209 209 GLY GLY A . n A 1 210 ASN 210 210 210 ASN ASN A . n A 1 211 ASN 211 211 211 ASN ASN A . n A 1 212 LYS 212 212 212 LYS LYS A . n A 1 213 MSE 213 213 213 MSE MSE A . n A 1 214 GLN 214 214 214 GLN GLN A . n A 1 215 VAL 215 215 215 VAL VAL A . n A 1 216 PHE 216 216 216 PHE PHE A . n A 1 217 ILE 217 217 217 ILE ILE A . n A 1 218 GLU 218 218 218 GLU GLU A . n A 1 219 THR 219 219 219 THR THR A . n A 1 220 LEU 220 220 220 LEU LEU A . n A 1 221 SER 221 221 221 SER SER A . n A 1 222 ALA 222 222 222 ALA ALA A . n A 1 223 ARG 223 223 223 ARG ARG A . n A 1 224 LEU 224 224 224 LEU LEU A . n A 1 225 ARG 225 225 225 ARG ARG A . n A 1 226 PRO 226 226 226 PRO PRO A . n A 1 227 ALA 227 227 227 ALA ALA A . n A 1 228 GLY 228 228 228 GLY GLY A . n A 1 229 ARG 229 229 229 ARG ARG A . n A 1 230 MSE 230 230 230 MSE MSE A . n A 1 231 LEU 231 231 231 LEU LEU A . n A 1 232 VAL 232 232 232 VAL VAL A . n A 1 233 MSE 233 233 233 MSE MSE A . n A 1 234 ASP 234 234 234 ASP ASP A . n A 1 235 GLY 235 235 235 GLY GLY A . n A 1 236 GLN 236 236 236 GLN GLN A . n A 1 237 PRO 237 237 237 PRO PRO A . n A 1 238 ASP 238 238 238 ASP ASP A . n A 1 239 LEU 239 239 239 LEU LEU A . n A 1 240 LEU 240 240 240 LEU LEU A . n A 1 241 SER 241 241 241 SER SER A . n A 1 242 THR 242 242 242 THR THR A . n A 1 243 GLU 243 243 243 GLU GLU A . n A 1 244 THR 244 244 244 THR THR A . n A 1 245 SER 245 245 245 SER SER A . n A 1 246 LYS 246 246 246 LYS LYS A . n A 1 247 LEU 247 247 247 LEU LEU A . n A 1 248 VAL 248 248 248 VAL VAL A . n A 1 249 ASP 249 249 249 ASP ASP A . n A 1 250 HIS 250 250 250 HIS HIS A . n A 1 251 TYR 251 251 251 TYR TYR A . n A 1 252 ILE 252 252 252 ILE ILE A . n A 1 253 TYR 253 253 253 TYR TYR A . n A 1 254 GLN 254 254 254 GLN GLN A . n A 1 255 ALA 255 255 255 ALA ALA A . n A 1 256 TYR 256 256 256 TYR TYR A . n A 1 257 TRP 257 257 257 TRP TRP A . n A 1 258 GLU 258 258 258 GLU GLU A . n A 1 259 SER 259 259 259 SER SER A . n A 1 260 SER 260 260 260 SER SER A . n A 1 261 THR 261 261 261 THR THR A . n A 1 262 SER 262 262 262 SER SER A . n A 1 263 SER 263 263 263 SER SER A . n A 1 264 VAL 264 264 264 VAL VAL A . n A 1 265 ILE 265 265 265 ILE ILE A . n A 1 266 TYR 266 266 266 TYR TYR A . n A 1 267 LYS 267 267 267 LYS LYS A . n A 1 268 ILE 268 268 268 ILE ILE A . n A 1 269 ASN 269 269 269 ASN ASN A . n A 1 270 LYS 270 270 270 LYS LYS A . n A 1 271 PRO 271 271 271 PRO PRO A . n A 1 272 ASN 272 272 272 ASN ASN A . n A 1 273 LEU 273 273 273 LEU LEU A . n A 1 274 ASP 274 274 274 ASP ASP A . n A 1 275 ASP 275 275 275 ASP ASP A . n A 1 276 TRP 276 276 276 TRP TRP A . n A 1 277 GLU 277 277 277 GLU GLU A . n A 1 278 ARG 278 278 278 ARG ARG A . n A 1 279 LYS 279 279 279 LYS LYS A . n A 1 280 THR 280 280 280 THR THR A . n A 1 281 ILE 281 281 281 ILE ILE A . n A 1 282 ILE 282 282 282 ILE ILE A . n A 1 283 THR 283 283 283 THR THR A . n A 1 284 VAL 284 284 284 VAL VAL A . n A 1 285 GLU 285 285 285 GLU GLU A . n A 1 286 PHE 286 286 286 PHE PHE A . n A 1 287 GLU 287 287 287 GLU GLU A . n A 1 288 GLN 288 288 288 GLN GLN A . n A 1 289 GLY 289 289 289 GLY GLY A . n A 1 290 TRP 290 290 290 TRP TRP A . n A 1 291 LYS 291 291 291 LYS LYS A . n A 1 292 THR 292 292 292 THR THR A . n A 1 293 GLY 293 293 293 GLY GLY A . n A 1 294 GLY 294 294 294 GLY GLY A . n A 1 295 ILE 295 295 295 ILE ILE A . n A 1 296 THR 296 296 296 THR THR A . n A 1 297 TYR 297 297 297 TYR TYR A . n A 1 298 TYR 298 298 298 TYR TYR A . n A 1 299 THR 299 299 299 THR THR A . n A 1 300 SER 300 300 300 SER SER A . n A 1 301 VAL 301 301 301 VAL VAL A . n A 1 302 ARG 302 302 302 ARG ARG A . n A 1 303 PRO 303 303 303 PRO PRO A . n A 1 304 GLU 304 304 304 GLU GLU A . n A 1 305 LEU 305 305 305 LEU LEU A . n A 1 306 ASN 306 306 306 ASN ASN A . n A 1 307 SER 307 307 307 SER SER A . n A 1 308 MSE 308 308 308 MSE MSE A . n A 1 309 GLU 309 309 309 GLU GLU A . n A 1 310 GLY 310 310 310 GLY GLY A . n A 1 311 ASN 311 311 311 ASN ASN A . n A 1 312 GLN 312 312 312 GLN GLN A . n A 1 313 ILE 313 313 313 ILE ILE A . n A 1 314 LEU 314 314 314 LEU LEU A . n A 1 315 ASP 315 315 315 ASP ASP A . n A 1 316 TYR 316 316 316 TYR TYR A . n A 1 317 ALA 317 317 317 ALA ALA A . n A 1 318 THR 318 318 318 THR THR A . n A 1 319 LEU 319 319 319 LEU LEU A . n A 1 320 ASP 320 320 320 ASP ASP A . n A 1 321 LEU 321 321 321 LEU LEU A . n A 1 322 PRO 322 322 322 PRO PRO A . n A 1 323 SER 323 323 323 SER SER A . n A 1 324 GLY 324 324 324 GLY GLY A . n A 1 325 LYS 325 325 325 LYS LYS A . n A 1 326 ARG 326 326 326 ARG ARG A . n A 1 327 ILE 327 327 327 ILE ILE A . n A 1 328 GLY 328 328 328 GLY GLY A . n A 1 329 GLY 329 329 329 GLY GLY A . n A 1 330 ILE 330 330 330 ILE ILE A . n A 1 331 GLY 331 331 331 GLY GLY A . n A 1 332 THR 332 332 332 THR THR A . n A 1 333 TYR 333 333 333 TYR TYR A . n A 1 334 HIS 334 334 334 HIS HIS A . n A 1 335 MSE 335 335 335 MSE MSE A . n A 1 336 GLU 336 336 336 GLU GLU A . n A 1 337 TYR 337 337 337 TYR TYR A . n A 1 338 ASP 338 338 338 ASP ASP A . n A 1 339 TYR 339 339 339 TYR TYR A . n A 1 340 PRO 340 340 340 PRO PRO A . n A 1 341 ASN 341 341 341 ASN ASN A . n A 1 342 ASP 342 342 342 ASP ASP A . n A 1 343 PRO 343 343 343 PRO PRO A . n A 1 344 PRO 344 344 344 PRO PRO A . n A 1 345 TYR 345 345 345 TYR TYR A . n A 1 346 LYS 346 346 346 LYS LYS A . n A 1 347 TRP 347 347 347 TRP TRP A . n A 1 348 LEU 348 348 348 LEU LEU A . n A 1 349 ARG 349 349 349 ARG ARG A . n A 1 350 LYS 350 350 350 LYS LYS A . n A 1 351 ALA 351 351 351 ALA ALA A . n A 1 352 LEU 352 352 352 LEU LEU A . n A 1 353 TYR 353 353 353 TYR TYR A . n A 1 354 PHE 354 354 354 PHE PHE A . n A 1 355 GLY 355 355 355 GLY GLY A . n A 1 356 ASN 356 356 356 ASN ASN A . n A 1 357 GLN 357 357 357 GLN GLN A . n A 1 358 VAL 358 358 358 VAL VAL A . n A 1 359 TYR 359 359 359 TYR TYR A . n A 1 360 PRO 360 360 360 PRO PRO A . n A 1 361 GLY 361 361 361 GLY GLY A . n A 1 362 LYS 362 362 362 LYS LYS A . n A 1 363 PHE 363 363 363 PHE PHE A . n A 1 364 ASP 364 364 364 ASP ASP A . n # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 55 A MSE 55 ? MET 'modified residue' 2 A MSE 93 A MSE 93 ? MET 'modified residue' 3 A MSE 213 A MSE 213 ? MET 'modified residue' 4 A MSE 230 A MSE 230 ? MET 'modified residue' 5 A MSE 233 A MSE 233 ? MET 'modified residue' 6 A MSE 308 A MSE 308 ? MET 'modified residue' 7 A MSE 335 A MSE 335 ? MET 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 14120 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-05-08 2 'Structure model' 1 1 2019-06-12 3 'Structure model' 1 2 2019-09-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' pdbx_database_proc 4 3 'Structure model' citation 5 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 3 'Structure model' '_citation.journal_volume' 10 3 'Structure model' '_citation.page_first' 11 3 'Structure model' '_citation.page_last' 12 3 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 46.0134 _pdbx_refine_tls.origin_y 50.4194 _pdbx_refine_tls.origin_z 23.5000 _pdbx_refine_tls.T[1][1] 0.1817 _pdbx_refine_tls.T[2][2] 0.2559 _pdbx_refine_tls.T[3][3] 0.1000 _pdbx_refine_tls.T[1][2] 0.1532 _pdbx_refine_tls.T[1][3] 0.0143 _pdbx_refine_tls.T[2][3] -0.0448 _pdbx_refine_tls.L[1][1] 1.6114 _pdbx_refine_tls.L[2][2] 1.3309 _pdbx_refine_tls.L[3][3] 4.2027 _pdbx_refine_tls.L[1][2] -0.3133 _pdbx_refine_tls.L[1][3] 1.0686 _pdbx_refine_tls.L[2][3] -0.3485 _pdbx_refine_tls.S[1][1] -0.1820 _pdbx_refine_tls.S[1][2] -0.2504 _pdbx_refine_tls.S[1][3] 0.2635 _pdbx_refine_tls.S[2][1] 0.2322 _pdbx_refine_tls.S[2][2] 0.0312 _pdbx_refine_tls.S[2][3] 0.2172 _pdbx_refine_tls.S[3][1] -0.4546 _pdbx_refine_tls.S[3][2] -0.8204 _pdbx_refine_tls.S[3][3] 0.1508 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 39 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 364 _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? . 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 5 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG A MSE 55 ? ? SE A MSE 55 ? ? CE A MSE 55 ? ? 82.63 98.90 -16.27 2.20 N 2 1 CG A MSE 93 ? ? SE A MSE 93 ? ? CE A MSE 93 ? ? 114.47 98.90 15.57 2.20 N 3 1 CG A MSE 213 ? ? SE A MSE 213 ? ? CE A MSE 213 ? ? 84.52 98.90 -14.38 2.20 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 85 ? ? 90.20 -59.27 2 1 ARG A 107 ? ? -125.42 -65.41 3 1 TRP A 133 ? ? 171.32 155.11 4 1 GLN A 136 ? ? -135.49 -70.49 5 1 LYS A 145 ? ? 67.80 -138.13 6 1 VAL A 154 ? ? -87.06 -70.76 7 1 LYS A 157 ? ? -133.72 -46.08 8 1 GLN A 159 ? ? -151.57 54.56 9 1 GLN A 190 ? ? -143.18 59.24 10 1 HIS A 195 ? ? -103.09 57.96 11 1 LEU A 199 ? ? -131.30 -53.22 12 1 ALA A 255 ? ? -88.20 47.43 13 1 ILE A 327 ? ? -45.04 153.88 14 1 PRO A 340 ? ? -58.90 -3.30 15 1 GLN A 357 ? ? -128.83 -52.38 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 LYS A 145 ? ? GLY A 146 ? ? 141.68 2 1 GLY A 192 ? ? TYR A 193 ? ? 142.04 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A LYS 2 ? A LYS 2 3 1 Y 1 A LEU 3 ? A LEU 3 4 1 Y 1 A LEU 4 ? A LEU 4 5 1 Y 1 A LYS 5 ? A LYS 5 6 1 Y 1 A TYR 6 ? A TYR 6 7 1 Y 1 A LEU 7 ? A LEU 7 8 1 Y 1 A CYS 8 ? A CYS 8 9 1 Y 1 A ILE 9 ? A ILE 9 10 1 Y 1 A GLY 10 ? A GLY 10 11 1 Y 1 A ILE 11 ? A ILE 11 12 1 Y 1 A SER 12 ? A SER 12 13 1 Y 1 A ALA 13 ? A ALA 13 14 1 Y 1 A LEU 14 ? A LEU 14 15 1 Y 1 A SER 15 ? A SER 15 16 1 Y 1 A ILE 16 ? A ILE 16 17 1 Y 1 A LEU 17 ? A LEU 17 18 1 Y 1 A SER 18 ? A SER 18 19 1 Y 1 A CYS 19 ? A CYS 19 20 1 Y 1 A SER 20 ? A SER 20 21 1 Y 1 A ASP 21 ? A ASP 21 22 1 Y 1 A TRP 22 ? A TRP 22 23 1 Y 1 A THR 23 ? A THR 23 24 1 Y 1 A SER 24 ? A SER 24 25 1 Y 1 A GLU 25 ? A GLU 25 26 1 Y 1 A GLU 26 ? A GLU 26 27 1 Y 1 A ARG 27 ? A ARG 27 28 1 Y 1 A GLU 28 ? A GLU 28 29 1 Y 1 A VAL 29 ? A VAL 29 30 1 Y 1 A PHE 30 ? A PHE 30 31 1 Y 1 A GLU 31 ? A GLU 31 32 1 Y 1 A ASN 32 ? A ASN 32 33 1 Y 1 A GLN 33 ? A GLN 33 34 1 Y 1 A GLU 34 ? A GLU 34 35 1 Y 1 A GLY 35 ? A GLY 35 36 1 Y 1 A MSE 36 ? A MSE 36 37 1 Y 1 A HIS 37 ? A HIS 37 38 1 Y 1 A ARG 38 ? A ARG 38 # _pdbx_audit_support.funding_organization 'Biotechnology and Biological Sciences Research Council' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number BB/M029018/1 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #