data_6Q7N # _entry.id 6Q7N # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.311 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6Q7N WWPDB D_1200013429 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6Q7N _pdbx_database_status.recvd_initial_deposition_date 2018-12-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Levy, C.W.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0002-9724-310X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nature _citation.journal_id_ASTM NATUAS _citation.journal_id_CSD 0006 _citation.journal_id_ISSN 1476-4687 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 570 _citation.language ? _citation.page_first 219 _citation.page_last 223 _citation.title 'Design and evolution of an enzyme with a non-canonical organocatalytic mechanism.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41586-019-1262-8 _citation.pdbx_database_id_PubMed 31132786 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Burke, A.J.' 1 ? primary 'Lovelock, S.L.' 2 ? primary 'Frese, A.' 3 ? primary 'Crawshaw, R.' 4 ? primary 'Ortmayer, M.' 5 ? primary 'Dunstan, M.' 6 ? primary 'Levy, C.' 7 ? primary 'Green, A.P.' 8 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 103.484 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6Q7N _cell.details ? _cell.formula_units_Z ? _cell.length_a 34.571 _cell.length_a_esd ? _cell.length_b 70.549 _cell.length_b_esd ? _cell.length_c 53.004 _cell.length_c_esd ? _cell.volume 125710.648 _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6Q7N _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall 'P 2yb' _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man BH32 27676.623 1 ? ? ? ? 2 non-polymer syn 1-PHENYLETHANONE 120.149 1 ? ? ? ? 3 water nat water 18.015 91 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MIRAVFFDSLGTLNSVEGAAKSHLKIMEEVLGDYPLNPKTLLDEYEKLTREAFSNYAGKPYRPLRDILEEVMRKLAEKYG FKYPENFWEISLRMSQRYGELYPEVVEVLKSLKGKYHVGMITDSDTEQAMAFLDALGIKDLFDSITTSEEAGFFKPHPRI FELALKKAGVKGEEAVYVGDNPVKDCGGSKNLGMTSILLDRKGEKREFWDKCDFIVSDLREVIKIVDELNGQGSLEHHHH HH ; _entity_poly.pdbx_seq_one_letter_code_can ;MIRAVFFDSLGTLNSVEGAAKSHLKIMEEVLGDYPLNPKTLLDEYEKLTREAFSNYAGKPYRPLRDILEEVMRKLAEKYG FKYPENFWEISLRMSQRYGELYPEVVEVLKSLKGKYHVGMITDSDTEQAMAFLDALGIKDLFDSITTSEEAGFFKPHPRI FELALKKAGVKGEEAVYVGDNPVKDCGGSKNLGMTSILLDRKGEKREFWDKCDFIVSDLREVIKIVDELNGQGSLEHHHH HH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ILE n 1 3 ARG n 1 4 ALA n 1 5 VAL n 1 6 PHE n 1 7 PHE n 1 8 ASP n 1 9 SER n 1 10 LEU n 1 11 GLY n 1 12 THR n 1 13 LEU n 1 14 ASN n 1 15 SER n 1 16 VAL n 1 17 GLU n 1 18 GLY n 1 19 ALA n 1 20 ALA n 1 21 LYS n 1 22 SER n 1 23 HIS n 1 24 LEU n 1 25 LYS n 1 26 ILE n 1 27 MET n 1 28 GLU n 1 29 GLU n 1 30 VAL n 1 31 LEU n 1 32 GLY n 1 33 ASP n 1 34 TYR n 1 35 PRO n 1 36 LEU n 1 37 ASN n 1 38 PRO n 1 39 LYS n 1 40 THR n 1 41 LEU n 1 42 LEU n 1 43 ASP n 1 44 GLU n 1 45 TYR n 1 46 GLU n 1 47 LYS n 1 48 LEU n 1 49 THR n 1 50 ARG n 1 51 GLU n 1 52 ALA n 1 53 PHE n 1 54 SER n 1 55 ASN n 1 56 TYR n 1 57 ALA n 1 58 GLY n 1 59 LYS n 1 60 PRO n 1 61 TYR n 1 62 ARG n 1 63 PRO n 1 64 LEU n 1 65 ARG n 1 66 ASP n 1 67 ILE n 1 68 LEU n 1 69 GLU n 1 70 GLU n 1 71 VAL n 1 72 MET n 1 73 ARG n 1 74 LYS n 1 75 LEU n 1 76 ALA n 1 77 GLU n 1 78 LYS n 1 79 TYR n 1 80 GLY n 1 81 PHE n 1 82 LYS n 1 83 TYR n 1 84 PRO n 1 85 GLU n 1 86 ASN n 1 87 PHE n 1 88 TRP n 1 89 GLU n 1 90 ILE n 1 91 SER n 1 92 LEU n 1 93 ARG n 1 94 MET n 1 95 SER n 1 96 GLN n 1 97 ARG n 1 98 TYR n 1 99 GLY n 1 100 GLU n 1 101 LEU n 1 102 TYR n 1 103 PRO n 1 104 GLU n 1 105 VAL n 1 106 VAL n 1 107 GLU n 1 108 VAL n 1 109 LEU n 1 110 LYS n 1 111 SER n 1 112 LEU n 1 113 LYS n 1 114 GLY n 1 115 LYS n 1 116 TYR n 1 117 HIS n 1 118 VAL n 1 119 GLY n 1 120 MET n 1 121 ILE n 1 122 THR n 1 123 ASP n 1 124 SER n 1 125 ASP n 1 126 THR n 1 127 GLU n 1 128 GLN n 1 129 ALA n 1 130 MET n 1 131 ALA n 1 132 PHE n 1 133 LEU n 1 134 ASP n 1 135 ALA n 1 136 LEU n 1 137 GLY n 1 138 ILE n 1 139 LYS n 1 140 ASP n 1 141 LEU n 1 142 PHE n 1 143 ASP n 1 144 SER n 1 145 ILE n 1 146 THR n 1 147 THR n 1 148 SER n 1 149 GLU n 1 150 GLU n 1 151 ALA n 1 152 GLY n 1 153 PHE n 1 154 PHE n 1 155 LYS n 1 156 PRO n 1 157 HIS n 1 158 PRO n 1 159 ARG n 1 160 ILE n 1 161 PHE n 1 162 GLU n 1 163 LEU n 1 164 ALA n 1 165 LEU n 1 166 LYS n 1 167 LYS n 1 168 ALA n 1 169 GLY n 1 170 VAL n 1 171 LYS n 1 172 GLY n 1 173 GLU n 1 174 GLU n 1 175 ALA n 1 176 VAL n 1 177 TYR n 1 178 VAL n 1 179 GLY n 1 180 ASP n 1 181 ASN n 1 182 PRO n 1 183 VAL n 1 184 LYS n 1 185 ASP n 1 186 CYS n 1 187 GLY n 1 188 GLY n 1 189 SER n 1 190 LYS n 1 191 ASN n 1 192 LEU n 1 193 GLY n 1 194 MET n 1 195 THR n 1 196 SER n 1 197 ILE n 1 198 LEU n 1 199 LEU n 1 200 ASP n 1 201 ARG n 1 202 LYS n 1 203 GLY n 1 204 GLU n 1 205 LYS n 1 206 ARG n 1 207 GLU n 1 208 PHE n 1 209 TRP n 1 210 ASP n 1 211 LYS n 1 212 CYS n 1 213 ASP n 1 214 PHE n 1 215 ILE n 1 216 VAL n 1 217 SER n 1 218 ASP n 1 219 LEU n 1 220 ARG n 1 221 GLU n 1 222 VAL n 1 223 ILE n 1 224 LYS n 1 225 ILE n 1 226 VAL n 1 227 ASP n 1 228 GLU n 1 229 LEU n 1 230 ASN n 1 231 GLY n 1 232 GLN n 1 233 GLY n 1 234 SER n 1 235 LEU n 1 236 GLU n 1 237 HIS n 1 238 HIS n 1 239 HIS n 1 240 HIS n 1 241 HIS n 1 242 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 242 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PH0459 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus horikoshii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 53953 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O58216_PYRHO _struct_ref.pdbx_db_accession O58216 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MIRAVFFDFVGTLLSVEGEAKTHLKIMEEVLGDYPLNPKTLLDEYEKLTREAFSNYAGKPYRPIRDIEEEVMRKLAEKYG FKYPENFWEIHLRMHQRYGELYPEVVEVLKSLKGKYHVGMITDSDTEYLMAHLDALGIKDLFDSITTSEEAGFFKPHPRI FELALKKAGVKGEEAVYVGDNPVKDCGGSKNLGMTSILLDRKGEKREFWDKCDFIVSDLREVIKIVDELNGQ ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6Q7N _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 232 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O58216 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 232 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 232 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6Q7N SER A 9 ? UNP O58216 PHE 9 conflict 9 1 1 6Q7N LEU A 10 ? UNP O58216 VAL 10 conflict 10 2 1 6Q7N ASN A 14 ? UNP O58216 LEU 14 conflict 14 3 1 6Q7N ALA A 19 ? UNP O58216 GLU 19 conflict 19 4 1 6Q7N SER A 22 ? UNP O58216 THR 22 conflict 22 5 1 6Q7N LEU A 64 ? UNP O58216 ILE 64 conflict 64 6 1 6Q7N LEU A 68 ? UNP O58216 GLU 68 conflict 68 7 1 6Q7N SER A 91 ? UNP O58216 HIS 91 conflict 91 8 1 6Q7N SER A 95 ? UNP O58216 HIS 95 conflict 95 9 1 6Q7N GLN A 128 ? UNP O58216 TYR 128 conflict 128 10 1 6Q7N ALA A 129 ? UNP O58216 LEU 129 conflict 129 11 1 6Q7N PHE A 132 ? UNP O58216 HIS 132 conflict 132 12 1 6Q7N GLY A 233 ? UNP O58216 ? ? 'expression tag' 233 13 1 6Q7N SER A 234 ? UNP O58216 ? ? 'expression tag' 234 14 1 6Q7N LEU A 235 ? UNP O58216 ? ? 'expression tag' 235 15 1 6Q7N GLU A 236 ? UNP O58216 ? ? 'expression tag' 236 16 1 6Q7N HIS A 237 ? UNP O58216 ? ? 'expression tag' 237 17 1 6Q7N HIS A 238 ? UNP O58216 ? ? 'expression tag' 238 18 1 6Q7N HIS A 239 ? UNP O58216 ? ? 'expression tag' 239 19 1 6Q7N HIS A 240 ? UNP O58216 ? ? 'expression tag' 240 20 1 6Q7N HIS A 241 ? UNP O58216 ? ? 'expression tag' 241 21 1 6Q7N HIS A 242 ? UNP O58216 ? ? 'expression tag' 242 22 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight AC0 non-polymer . 1-PHENYLETHANONE ACETOPHENONE 'C8 H8 O' 120.149 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6Q7N _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.39 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.58 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details 'Cold room' _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M sodium acetate trihydrate, 0.1 M Tris pH 8.5, 30 % w/v PEG 4000.' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-03-05 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.98 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 43.68 _reflns.entry_id 6Q7N _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.02 _reflns.d_resolution_low 41.62 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15995 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.97 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.4 _reflns.pdbx_Rmerge_I_obs 0.036 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.83 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.043 _reflns.pdbx_Rpim_I_all 0.023 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.99 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.02 _reflns_shell.d_res_low 2.1 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.03 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1586 _reflns_shell.percent_possible_all 98.94 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.58 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.37 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.84 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 56.47 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6Q7N _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.02 _refine.ls_d_res_low 41.62 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16004 _refine.ls_number_reflns_R_free 765 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.98 _refine.ls_percent_reflns_R_free 4.78 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1985 _refine.ls_R_factor_R_free 0.2361 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1965 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2UW6 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.4713 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2325 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1846 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 9 _refine_hist.number_atoms_solvent 91 _refine_hist.number_atoms_total 1946 _refine_hist.d_res_high 2.02 _refine_hist.d_res_low 41.62 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0018 ? 1893 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.4353 ? 2545 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0374 ? 273 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0022 ? 327 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.1094 ? 1150 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.02 2.17 . . 159 3041 99.07 . . . 0.3189 . 0.2771 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.17 2.39 . . 149 2865 92.82 . . . 0.2490 . 0.2182 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.39 2.74 . . 162 3072 99.20 . . . 0.2652 . 0.2172 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.74 3.45 . . 125 3138 99.51 . . . 0.2890 . 0.2247 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.45 41.63 . . 170 3123 99.25 . . . 0.2043 . 0.1685 . . . . . . . . . . # _struct.entry_id 6Q7N _struct.title 'Crystal structure of BH32 alkylated with the mechanistic inhibitor 2-bromoacetophenone' _struct.pdbx_descriptor 'Uncharacterized protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6Q7N _struct_keywords.text 'Computationally designed enzyme, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 15 ? GLY A 32 ? SER A 15 GLY A 32 1 ? 18 HELX_P HELX_P2 AA2 ASN A 37 ? ALA A 57 ? ASN A 37 ALA A 57 1 ? 21 HELX_P HELX_P3 AA3 PRO A 63 ? GLY A 80 ? PRO A 63 GLY A 80 1 ? 18 HELX_P HELX_P4 AA4 ASN A 86 ? GLY A 99 ? ASN A 86 GLY A 99 1 ? 14 HELX_P HELX_P5 AA5 GLU A 104 ? LYS A 113 ? GLU A 104 LYS A 113 1 ? 10 HELX_P HELX_P6 AA6 ASP A 125 ? LEU A 136 ? ASP A 125 LEU A 136 1 ? 12 HELX_P HELX_P7 AA7 ILE A 138 ? PHE A 142 ? ILE A 138 PHE A 142 5 ? 5 HELX_P HELX_P8 AA8 SER A 148 ? GLY A 152 ? SER A 148 GLY A 152 1 ? 5 HELX_P HELX_P9 AA9 HIS A 157 ? GLY A 169 ? HIS A 157 GLY A 169 1 ? 13 HELX_P HELX_P10 AB1 LYS A 171 ? GLU A 173 ? LYS A 171 GLU A 173 5 ? 3 HELX_P HELX_P11 AB2 ASP A 185 ? ASN A 191 ? ASP A 185 ASN A 191 1 ? 7 HELX_P HELX_P12 AB3 LYS A 205 ? TRP A 209 ? LYS A 205 TRP A 209 5 ? 5 HELX_P HELX_P13 AB4 LEU A 219 ? ASN A 230 ? LEU A 219 ASN A 230 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 186 SG ? ? ? 1_555 A CYS 212 SG ? ? A CYS 186 A CYS 212 1_555 ? ? ? ? ? ? ? 2.036 ? covale1 covale none ? A HIS 23 NE2 ? ? ? 1_555 B AC0 . C8 ? ? A HIS 23 A AC0 301 1_555 ? ? ? ? ? ? ? 1.437 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 155 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 155 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 156 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 156 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 1.17 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 144 ? THR A 147 ? SER A 144 THR A 147 AA1 2 HIS A 117 ? THR A 122 ? HIS A 117 THR A 122 AA1 3 ALA A 4 ? PHE A 7 ? ALA A 4 PHE A 7 AA1 4 ALA A 175 ? GLY A 179 ? ALA A 175 GLY A 179 AA1 5 THR A 195 ? LEU A 199 ? THR A 195 LEU A 199 AA1 6 PHE A 214 ? VAL A 216 ? PHE A 214 VAL A 216 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O THR A 146 ? O THR A 146 N MET A 120 ? N MET A 120 AA1 2 3 O HIS A 117 ? O HIS A 117 N VAL A 5 ? N VAL A 5 AA1 3 4 N PHE A 6 ? N PHE A 6 O VAL A 176 ? O VAL A 176 AA1 4 5 N GLY A 179 ? N GLY A 179 O LEU A 199 ? O LEU A 199 AA1 5 6 N LEU A 198 ? N LEU A 198 O PHE A 214 ? O PHE A 214 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id AC0 _struct_site.pdbx_auth_seq_id 301 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'binding site for residue AC0 A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 HIS A 23 ? HIS A 23 . ? 1_555 ? 2 AC1 6 LEU A 68 ? LEU A 68 . ? 1_555 ? 3 AC1 6 TRP A 88 ? TRP A 88 . ? 1_555 ? 4 AC1 6 SER A 91 ? SER A 91 . ? 1_555 ? 5 AC1 6 LEU A 92 ? LEU A 92 . ? 1_555 ? 6 AC1 6 SER A 95 ? SER A 95 . ? 1_555 ? # _atom_sites.entry_id 6Q7N _atom_sites.fract_transf_matrix[1][1] 0.028926 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.006936 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014175 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019401 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 MET 27 27 27 MET MET A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 TRP 88 88 88 TRP TRP A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 MET 94 94 94 MET MET A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 TYR 98 98 98 TYR TYR A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 TYR 116 116 116 TYR TYR A . n A 1 117 HIS 117 117 117 HIS HIS A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 MET 120 120 120 MET MET A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 SER 124 124 124 SER SER A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 THR 126 126 126 THR THR A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 GLN 128 128 128 GLN GLN A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 MET 130 130 130 MET MET A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 PHE 132 132 132 PHE PHE A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 ILE 138 138 138 ILE ILE A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 PHE 142 142 142 PHE PHE A . n A 1 143 ASP 143 143 143 ASP ASP A . n A 1 144 SER 144 144 144 SER SER A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 THR 146 146 146 THR THR A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 SER 148 148 148 SER SER A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 GLY 152 152 152 GLY GLY A . n A 1 153 PHE 153 153 153 PHE PHE A . n A 1 154 PHE 154 154 154 PHE PHE A . n A 1 155 LYS 155 155 155 LYS LYS A . n A 1 156 PRO 156 156 156 PRO PRO A . n A 1 157 HIS 157 157 157 HIS HIS A . n A 1 158 PRO 158 158 158 PRO PRO A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 ILE 160 160 160 ILE ILE A . n A 1 161 PHE 161 161 161 PHE PHE A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 LYS 166 166 166 LYS LYS A . n A 1 167 LYS 167 167 167 LYS LYS A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 VAL 170 170 170 VAL VAL A . n A 1 171 LYS 171 171 171 LYS LYS A . n A 1 172 GLY 172 172 172 GLY GLY A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 GLU 174 174 174 GLU GLU A . n A 1 175 ALA 175 175 175 ALA ALA A . n A 1 176 VAL 176 176 176 VAL VAL A . n A 1 177 TYR 177 177 177 TYR TYR A . n A 1 178 VAL 178 178 178 VAL VAL A . n A 1 179 GLY 179 179 179 GLY GLY A . n A 1 180 ASP 180 180 180 ASP ASP A . n A 1 181 ASN 181 181 181 ASN ASN A . n A 1 182 PRO 182 182 182 PRO PRO A . n A 1 183 VAL 183 183 183 VAL VAL A . n A 1 184 LYS 184 184 184 LYS LYS A . n A 1 185 ASP 185 185 185 ASP ASP A . n A 1 186 CYS 186 186 186 CYS CYS A . n A 1 187 GLY 187 187 187 GLY GLY A . n A 1 188 GLY 188 188 188 GLY GLY A . n A 1 189 SER 189 189 189 SER SER A . n A 1 190 LYS 190 190 190 LYS LYS A . n A 1 191 ASN 191 191 191 ASN ASN A . n A 1 192 LEU 192 192 192 LEU LEU A . n A 1 193 GLY 193 193 193 GLY GLY A . n A 1 194 MET 194 194 194 MET MET A . n A 1 195 THR 195 195 195 THR THR A . n A 1 196 SER 196 196 196 SER SER A . n A 1 197 ILE 197 197 197 ILE ILE A . n A 1 198 LEU 198 198 198 LEU LEU A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 ASP 200 200 200 ASP ASP A . n A 1 201 ARG 201 201 201 ARG ARG A . n A 1 202 LYS 202 202 202 LYS LYS A . n A 1 203 GLY 203 203 203 GLY GLY A . n A 1 204 GLU 204 204 204 GLU GLU A . n A 1 205 LYS 205 205 205 LYS LYS A . n A 1 206 ARG 206 206 206 ARG ARG A . n A 1 207 GLU 207 207 207 GLU GLU A . n A 1 208 PHE 208 208 208 PHE PHE A . n A 1 209 TRP 209 209 209 TRP TRP A . n A 1 210 ASP 210 210 210 ASP ASP A . n A 1 211 LYS 211 211 211 LYS LYS A . n A 1 212 CYS 212 212 212 CYS CYS A . n A 1 213 ASP 213 213 213 ASP ASP A . n A 1 214 PHE 214 214 214 PHE PHE A . n A 1 215 ILE 215 215 215 ILE ILE A . n A 1 216 VAL 216 216 216 VAL VAL A . n A 1 217 SER 217 217 217 SER SER A . n A 1 218 ASP 218 218 218 ASP ASP A . n A 1 219 LEU 219 219 219 LEU LEU A . n A 1 220 ARG 220 220 220 ARG ARG A . n A 1 221 GLU 221 221 221 GLU GLU A . n A 1 222 VAL 222 222 222 VAL VAL A . n A 1 223 ILE 223 223 223 ILE ILE A . n A 1 224 LYS 224 224 224 LYS LYS A . n A 1 225 ILE 225 225 225 ILE ILE A . n A 1 226 VAL 226 226 226 VAL VAL A . n A 1 227 ASP 227 227 227 ASP ASP A . n A 1 228 GLU 228 228 228 GLU GLU A . n A 1 229 LEU 229 229 229 LEU LEU A . n A 1 230 ASN 230 230 230 ASN ASN A . n A 1 231 GLY 231 231 ? ? ? A . n A 1 232 GLN 232 232 ? ? ? A . n A 1 233 GLY 233 233 ? ? ? A . n A 1 234 SER 234 234 ? ? ? A . n A 1 235 LEU 235 235 ? ? ? A . n A 1 236 GLU 236 236 ? ? ? A . n A 1 237 HIS 237 237 ? ? ? A . n A 1 238 HIS 238 238 ? ? ? A . n A 1 239 HIS 239 239 ? ? ? A . n A 1 240 HIS 240 240 ? ? ? A . n A 1 241 HIS 241 241 ? ? ? A . n A 1 242 HIS 242 242 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 AC0 1 301 301 AC0 AC0 A . C 3 HOH 1 401 150 HOH HOH A . C 3 HOH 2 402 48 HOH HOH A . C 3 HOH 3 403 141 HOH HOH A . C 3 HOH 4 404 64 HOH HOH A . C 3 HOH 5 405 39 HOH HOH A . C 3 HOH 6 406 28 HOH HOH A . C 3 HOH 7 407 13 HOH HOH A . C 3 HOH 8 408 5 HOH HOH A . C 3 HOH 9 409 66 HOH HOH A . C 3 HOH 10 410 6 HOH HOH A . C 3 HOH 11 411 1 HOH HOH A . C 3 HOH 12 412 7 HOH HOH A . C 3 HOH 13 413 12 HOH HOH A . C 3 HOH 14 414 22 HOH HOH A . C 3 HOH 15 415 33 HOH HOH A . C 3 HOH 16 416 37 HOH HOH A . C 3 HOH 17 417 20 HOH HOH A . C 3 HOH 18 418 3 HOH HOH A . C 3 HOH 19 419 52 HOH HOH A . C 3 HOH 20 420 139 HOH HOH A . C 3 HOH 21 421 73 HOH HOH A . C 3 HOH 22 422 118 HOH HOH A . C 3 HOH 23 423 42 HOH HOH A . C 3 HOH 24 424 151 HOH HOH A . C 3 HOH 25 425 97 HOH HOH A . C 3 HOH 26 426 14 HOH HOH A . C 3 HOH 27 427 19 HOH HOH A . C 3 HOH 28 428 145 HOH HOH A . C 3 HOH 29 429 4 HOH HOH A . C 3 HOH 30 430 2 HOH HOH A . C 3 HOH 31 431 71 HOH HOH A . C 3 HOH 32 432 140 HOH HOH A . C 3 HOH 33 433 149 HOH HOH A . C 3 HOH 34 434 34 HOH HOH A . C 3 HOH 35 435 26 HOH HOH A . C 3 HOH 36 436 47 HOH HOH A . C 3 HOH 37 437 35 HOH HOH A . C 3 HOH 38 438 11 HOH HOH A . C 3 HOH 39 439 146 HOH HOH A . C 3 HOH 40 440 38 HOH HOH A . C 3 HOH 41 441 96 HOH HOH A . C 3 HOH 42 442 21 HOH HOH A . C 3 HOH 43 443 77 HOH HOH A . C 3 HOH 44 444 10 HOH HOH A . C 3 HOH 45 445 49 HOH HOH A . C 3 HOH 46 446 8 HOH HOH A . C 3 HOH 47 447 60 HOH HOH A . C 3 HOH 48 448 25 HOH HOH A . C 3 HOH 49 449 54 HOH HOH A . C 3 HOH 50 450 93 HOH HOH A . C 3 HOH 51 451 69 HOH HOH A . C 3 HOH 52 452 57 HOH HOH A . C 3 HOH 53 453 80 HOH HOH A . C 3 HOH 54 454 65 HOH HOH A . C 3 HOH 55 455 88 HOH HOH A . C 3 HOH 56 456 98 HOH HOH A . C 3 HOH 57 457 144 HOH HOH A . C 3 HOH 58 458 61 HOH HOH A . C 3 HOH 59 459 45 HOH HOH A . C 3 HOH 60 460 55 HOH HOH A . C 3 HOH 61 461 43 HOH HOH A . C 3 HOH 62 462 86 HOH HOH A . C 3 HOH 63 463 16 HOH HOH A . C 3 HOH 64 464 40 HOH HOH A . C 3 HOH 65 465 41 HOH HOH A . C 3 HOH 66 466 78 HOH HOH A . C 3 HOH 67 467 15 HOH HOH A . C 3 HOH 68 468 119 HOH HOH A . C 3 HOH 69 469 70 HOH HOH A . C 3 HOH 70 470 101 HOH HOH A . C 3 HOH 71 471 147 HOH HOH A . C 3 HOH 72 472 83 HOH HOH A . C 3 HOH 73 473 99 HOH HOH A . C 3 HOH 74 474 79 HOH HOH A . C 3 HOH 75 475 143 HOH HOH A . C 3 HOH 76 476 95 HOH HOH A . C 3 HOH 77 477 53 HOH HOH A . C 3 HOH 78 478 126 HOH HOH A . C 3 HOH 79 479 127 HOH HOH A . C 3 HOH 80 480 103 HOH HOH A . C 3 HOH 81 481 24 HOH HOH A . C 3 HOH 82 482 132 HOH HOH A . C 3 HOH 83 483 102 HOH HOH A . C 3 HOH 84 484 134 HOH HOH A . C 3 HOH 85 485 82 HOH HOH A . C 3 HOH 86 486 75 HOH HOH A . C 3 HOH 87 487 122 HOH HOH A . C 3 HOH 88 488 100 HOH HOH A . C 3 HOH 89 489 32 HOH HOH A . C 3 HOH 90 490 131 HOH HOH A . C 3 HOH 91 491 120 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 370 ? 1 MORE 7 ? 1 'SSA (A^2)' 11090 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-06-05 2 'Structure model' 1 1 2019-06-26 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' pdbx_database_proc # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 7.27997535064 _pdbx_refine_tls.origin_y 1.53184445598 _pdbx_refine_tls.origin_z 14.8505346468 _pdbx_refine_tls.T[1][1] 0.255215767284 _pdbx_refine_tls.T[2][2] 0.275675967213 _pdbx_refine_tls.T[3][3] 0.303814145227 _pdbx_refine_tls.T[1][2] -0.0389871757573 _pdbx_refine_tls.T[1][3] -0.00589302955672 _pdbx_refine_tls.T[2][3] 0.0727357584198 _pdbx_refine_tls.L[1][1] 1.40342659248 _pdbx_refine_tls.L[2][2] 2.26370235287 _pdbx_refine_tls.L[3][3] 2.05776496022 _pdbx_refine_tls.L[1][2] -0.174088575467 _pdbx_refine_tls.L[1][3] -0.226127693775 _pdbx_refine_tls.L[2][3] 0.901962625799 _pdbx_refine_tls.S[1][1] 0.0160617821199 _pdbx_refine_tls.S[1][2] 0.200885969158 _pdbx_refine_tls.S[1][3] 0.165710443398 _pdbx_refine_tls.S[2][1] 0.0102139796337 _pdbx_refine_tls.S[2][2] -0.0304404292955 _pdbx_refine_tls.S[2][3] 0.0275751255767 _pdbx_refine_tls.S[3][1] -0.0493064566324 _pdbx_refine_tls.S[3][2] -0.142118319918 _pdbx_refine_tls.S[3][3] 0.0223766448434 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? dev_3304 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD2 A ASP 125 ? ? O A HOH 401 ? ? 2.03 2 1 O A LYS 82 ? ? O A HOH 402 ? ? 2.08 3 1 O A HOH 404 ? ? O A HOH 470 ? ? 2.15 4 1 NZ A LYS 184 ? ? O A HOH 403 ? ? 2.16 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 9 ? ? -99.95 -87.96 2 1 ASP A 185 ? ? -101.13 -66.69 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 491 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.04 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 231 ? A GLY 231 2 1 Y 1 A GLN 232 ? A GLN 232 3 1 Y 1 A GLY 233 ? A GLY 233 4 1 Y 1 A SER 234 ? A SER 234 5 1 Y 1 A LEU 235 ? A LEU 235 6 1 Y 1 A GLU 236 ? A GLU 236 7 1 Y 1 A HIS 237 ? A HIS 237 8 1 Y 1 A HIS 238 ? A HIS 238 9 1 Y 1 A HIS 239 ? A HIS 239 10 1 Y 1 A HIS 240 ? A HIS 240 11 1 Y 1 A HIS 241 ? A HIS 241 12 1 Y 1 A HIS 242 ? A HIS 242 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Biotechnology and Biological Sciences Research Council' 'United Kingdom' BB/M027023/1 1 'European Research Council' 'United Kingdom' 757991 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1-PHENYLETHANONE AC0 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 1 21 1' _space_group.name_Hall 'P 2yb' _space_group.IT_number 4 _space_group.crystal_system monoclinic _space_group.id 1 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -x,y+1/2,-z #