data_6QDZ # _entry.id 6QDZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.321 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6QDZ WWPDB D_1292100008 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6QDZ _pdbx_database_status.recvd_initial_deposition_date 2019-01-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Brown, D.G.' 1 0000-0003-4605-4779 'Hurley, C.' 2 ? 'Irving, S.L.' 3 0000-0001-8928-5791 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'P38 alpha complex with AR117045' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Brown, D.G.' 1 0000-0003-4605-4779 primary 'Irving, S.L.' 2 0000-0001-8928-5791 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6QDZ _cell.details ? _cell.formula_units_Z ? _cell.length_a 65.351 _cell.length_a_esd ? _cell.length_b 73.990 _cell.length_b_esd ? _cell.length_c 77.671 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6QDZ _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Mitogen-activated protein kinase 14' 41487.324 1 2.7.11.24 ? ? ? 2 non-polymer syn '2-fluoro-4-[4-(4-fluorophenyl)-1H-pyrazol-3-yl]pyridine' 257.238 1 ? ? ? ? 3 non-polymer syn ;1-[5-~{tert}-butyl-2-(4-methylphenyl)pyrazol-3-yl]-3-[(1~{S},4~{S})-4-[(3-propan-2-yl-[1,2,4]triazolo[4,3-a]pyridin-6-yl)oxy]-1,2,3,4-tetrahydronaphthalen-1-yl]urea ; 577.719 1 ? ? ? ? 4 water nat water 18.015 157 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;MAPK 14,Cytokine suppressive anti-inflammatory drug-binding protein,CSBP,MAP kinase MXI2,MAX-interacting protein 2,Mitogen-activated protein kinase p38 alpha,MAP kinase p38 alpha,Stress-activated protein kinase 2a,SAPK2a ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSMSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHM KHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAV NEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRL VGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEP VADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES ; _entity_poly.pdbx_seq_one_letter_code_can ;GSMSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHM KHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAV NEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRL VGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEP VADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 SER n 1 5 GLN n 1 6 GLU n 1 7 ARG n 1 8 PRO n 1 9 THR n 1 10 PHE n 1 11 TYR n 1 12 ARG n 1 13 GLN n 1 14 GLU n 1 15 LEU n 1 16 ASN n 1 17 LYS n 1 18 THR n 1 19 ILE n 1 20 TRP n 1 21 GLU n 1 22 VAL n 1 23 PRO n 1 24 GLU n 1 25 ARG n 1 26 TYR n 1 27 GLN n 1 28 ASN n 1 29 LEU n 1 30 SER n 1 31 PRO n 1 32 VAL n 1 33 GLY n 1 34 SER n 1 35 GLY n 1 36 ALA n 1 37 TYR n 1 38 GLY n 1 39 SER n 1 40 VAL n 1 41 CYS n 1 42 ALA n 1 43 ALA n 1 44 PHE n 1 45 ASP n 1 46 THR n 1 47 LYS n 1 48 THR n 1 49 GLY n 1 50 LEU n 1 51 ARG n 1 52 VAL n 1 53 ALA n 1 54 VAL n 1 55 LYS n 1 56 LYS n 1 57 LEU n 1 58 SER n 1 59 ARG n 1 60 PRO n 1 61 PHE n 1 62 GLN n 1 63 SER n 1 64 ILE n 1 65 ILE n 1 66 HIS n 1 67 ALA n 1 68 LYS n 1 69 ARG n 1 70 THR n 1 71 TYR n 1 72 ARG n 1 73 GLU n 1 74 LEU n 1 75 ARG n 1 76 LEU n 1 77 LEU n 1 78 LYS n 1 79 HIS n 1 80 MET n 1 81 LYS n 1 82 HIS n 1 83 GLU n 1 84 ASN n 1 85 VAL n 1 86 ILE n 1 87 GLY n 1 88 LEU n 1 89 LEU n 1 90 ASP n 1 91 VAL n 1 92 PHE n 1 93 THR n 1 94 PRO n 1 95 ALA n 1 96 ARG n 1 97 SER n 1 98 LEU n 1 99 GLU n 1 100 GLU n 1 101 PHE n 1 102 ASN n 1 103 ASP n 1 104 VAL n 1 105 TYR n 1 106 LEU n 1 107 VAL n 1 108 THR n 1 109 HIS n 1 110 LEU n 1 111 MET n 1 112 GLY n 1 113 ALA n 1 114 ASP n 1 115 LEU n 1 116 ASN n 1 117 ASN n 1 118 ILE n 1 119 VAL n 1 120 LYS n 1 121 CYS n 1 122 GLN n 1 123 LYS n 1 124 LEU n 1 125 THR n 1 126 ASP n 1 127 ASP n 1 128 HIS n 1 129 VAL n 1 130 GLN n 1 131 PHE n 1 132 LEU n 1 133 ILE n 1 134 TYR n 1 135 GLN n 1 136 ILE n 1 137 LEU n 1 138 ARG n 1 139 GLY n 1 140 LEU n 1 141 LYS n 1 142 TYR n 1 143 ILE n 1 144 HIS n 1 145 SER n 1 146 ALA n 1 147 ASP n 1 148 ILE n 1 149 ILE n 1 150 HIS n 1 151 ARG n 1 152 ASP n 1 153 LEU n 1 154 LYS n 1 155 PRO n 1 156 SER n 1 157 ASN n 1 158 LEU n 1 159 ALA n 1 160 VAL n 1 161 ASN n 1 162 GLU n 1 163 ASP n 1 164 CYS n 1 165 GLU n 1 166 LEU n 1 167 LYS n 1 168 ILE n 1 169 LEU n 1 170 ASP n 1 171 PHE n 1 172 GLY n 1 173 LEU n 1 174 ALA n 1 175 ARG n 1 176 HIS n 1 177 THR n 1 178 ASP n 1 179 ASP n 1 180 GLU n 1 181 MET n 1 182 THR n 1 183 GLY n 1 184 TYR n 1 185 VAL n 1 186 ALA n 1 187 THR n 1 188 ARG n 1 189 TRP n 1 190 TYR n 1 191 ARG n 1 192 ALA n 1 193 PRO n 1 194 GLU n 1 195 ILE n 1 196 MET n 1 197 LEU n 1 198 ASN n 1 199 TRP n 1 200 MET n 1 201 HIS n 1 202 TYR n 1 203 ASN n 1 204 GLN n 1 205 THR n 1 206 VAL n 1 207 ASP n 1 208 ILE n 1 209 TRP n 1 210 SER n 1 211 VAL n 1 212 GLY n 1 213 CYS n 1 214 ILE n 1 215 MET n 1 216 ALA n 1 217 GLU n 1 218 LEU n 1 219 LEU n 1 220 THR n 1 221 GLY n 1 222 ARG n 1 223 THR n 1 224 LEU n 1 225 PHE n 1 226 PRO n 1 227 GLY n 1 228 THR n 1 229 ASP n 1 230 HIS n 1 231 ILE n 1 232 ASP n 1 233 GLN n 1 234 LEU n 1 235 LYS n 1 236 LEU n 1 237 ILE n 1 238 LEU n 1 239 ARG n 1 240 LEU n 1 241 VAL n 1 242 GLY n 1 243 THR n 1 244 PRO n 1 245 GLY n 1 246 ALA n 1 247 GLU n 1 248 LEU n 1 249 LEU n 1 250 LYS n 1 251 LYS n 1 252 ILE n 1 253 SER n 1 254 SER n 1 255 GLU n 1 256 SER n 1 257 ALA n 1 258 ARG n 1 259 ASN n 1 260 TYR n 1 261 ILE n 1 262 GLN n 1 263 SER n 1 264 LEU n 1 265 THR n 1 266 GLN n 1 267 MET n 1 268 PRO n 1 269 LYS n 1 270 MET n 1 271 ASN n 1 272 PHE n 1 273 ALA n 1 274 ASN n 1 275 VAL n 1 276 PHE n 1 277 ILE n 1 278 GLY n 1 279 ALA n 1 280 ASN n 1 281 PRO n 1 282 LEU n 1 283 ALA n 1 284 VAL n 1 285 ASP n 1 286 LEU n 1 287 LEU n 1 288 GLU n 1 289 LYS n 1 290 MET n 1 291 LEU n 1 292 VAL n 1 293 LEU n 1 294 ASP n 1 295 SER n 1 296 ASP n 1 297 LYS n 1 298 ARG n 1 299 ILE n 1 300 THR n 1 301 ALA n 1 302 ALA n 1 303 GLN n 1 304 ALA n 1 305 LEU n 1 306 ALA n 1 307 HIS n 1 308 ALA n 1 309 TYR n 1 310 PHE n 1 311 ALA n 1 312 GLN n 1 313 TYR n 1 314 HIS n 1 315 ASP n 1 316 PRO n 1 317 ASP n 1 318 ASP n 1 319 GLU n 1 320 PRO n 1 321 VAL n 1 322 ALA n 1 323 ASP n 1 324 PRO n 1 325 TYR n 1 326 ASP n 1 327 GLN n 1 328 SER n 1 329 PHE n 1 330 GLU n 1 331 SER n 1 332 ARG n 1 333 ASP n 1 334 LEU n 1 335 LEU n 1 336 ILE n 1 337 ASP n 1 338 GLU n 1 339 TRP n 1 340 LYS n 1 341 SER n 1 342 LEU n 1 343 THR n 1 344 TYR n 1 345 ASP n 1 346 GLU n 1 347 VAL n 1 348 ILE n 1 349 SER n 1 350 PHE n 1 351 VAL n 1 352 PRO n 1 353 PRO n 1 354 PRO n 1 355 LEU n 1 356 ASP n 1 357 GLN n 1 358 GLU n 1 359 GLU n 1 360 MET n 1 361 GLU n 1 362 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 362 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2, SAPK2A' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant 'Gold pLysS AG' _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MK14_HUMAN _struct_ref.pdbx_db_accession Q16539 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKH ENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNE DCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA DPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6QDZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 362 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q16539 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 360 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 360 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6QDZ GLY A 1 ? UNP Q16539 ? ? 'expression tag' -1 1 1 6QDZ SER A 2 ? UNP Q16539 ? ? 'expression tag' 0 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 HYK non-polymer . ;1-[5-~{tert}-butyl-2-(4-methylphenyl)pyrazol-3-yl]-3-[(1~{S},4~{S})-4-[(3-propan-2-yl-[1,2,4]triazolo[4,3-a]pyridin-6-yl)oxy]-1,2,3,4-tetrahydronaphthalen-1-yl]urea ; ? 'C34 H39 N7 O2' 577.719 I46 non-polymer . '2-fluoro-4-[4-(4-fluorophenyl)-1H-pyrazol-3-yl]pyridine' ? 'C14 H9 F2 N3' 257.238 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6QDZ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.26 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.65 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 9.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 3000, Calcium Chloride, CHES' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2011-12-04 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9713 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9173 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04-1 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6QDZ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.73 _reflns.d_resolution_low 27.9 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 39035 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.2 _reflns.pdbx_Rmerge_I_obs 0.136 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.099 _reflns.pdbx_Rpim_I_all 0.073 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.73 _reflns_shell.d_res_low 1.77 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.5 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2370 _reflns_shell.percent_possible_all 82.1 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.072 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.7 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 2.575 _reflns_shell.pdbx_Rpim_I_all 1.378 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -0.62 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] -0.39 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 1.01 _refine.B_iso_max ? _refine.B_iso_mean 27.854 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.959 _refine.correlation_coeff_Fo_to_Fc_free 0.933 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6QDZ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.73 _refine.ls_d_res_low 27.90 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 36804 _refine.ls_number_reflns_R_free 1947 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.41 _refine.ls_percent_reflns_R_free 5.0 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.20559 _refine.ls_R_factor_R_free 0.24630 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.20346 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.122 _refine.pdbx_overall_ESU_R_Free 0.122 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 7.613 _refine.overall_SU_ML 0.115 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 2643 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 62 _refine_hist.number_atoms_solvent 157 _refine_hist.number_atoms_total 2862 _refine_hist.d_res_high 1.73 _refine_hist.d_res_low 27.90 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.014 0.013 2776 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 2587 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.912 1.639 3775 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.423 1.574 5986 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.958 5.000 325 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 33.996 22.027 148 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.363 15.000 471 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 22.367 15.000 18 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.094 0.200 356 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.012 0.020 3050 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 589 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 1.968 2.273 1306 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.969 2.272 1305 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 2.988 3.384 1627 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 2.988 3.386 1627 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.426 2.541 1470 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.425 2.541 1471 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 3.861 3.708 2148 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 5.457 26.666 3143 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 5.424 26.524 3123 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.727 _refine_ls_shell.d_res_low 1.772 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 93 _refine_ls_shell.number_reflns_R_work 2050 _refine_ls_shell.percent_reflns_obs 73.67 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.362 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.379 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6QDZ _struct.title 'P38 alpha complex with AR117045' _struct.pdbx_descriptor 'Mitogen-activated protein kinase 14 (E.C.2.7.11.24)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6QDZ _struct_keywords.text 'Inhibitor, Complex, Kinase, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 63 ? MET A 80 ? SER A 61 MET A 78 1 ? 18 HELX_P HELX_P2 AA2 THR A 125 ? ALA A 146 ? THR A 123 ALA A 144 1 ? 22 HELX_P HELX_P3 AA3 LYS A 154 ? SER A 156 ? LYS A 152 SER A 154 5 ? 3 HELX_P HELX_P4 AA4 ALA A 186 ? ARG A 191 ? ALA A 184 ARG A 189 5 ? 6 HELX_P HELX_P5 AA5 ALA A 192 ? LEU A 197 ? ALA A 190 LEU A 195 1 ? 6 HELX_P HELX_P6 AA6 THR A 205 ? GLY A 221 ? THR A 203 GLY A 219 1 ? 17 HELX_P HELX_P7 AA7 ASP A 229 ? GLY A 242 ? ASP A 227 GLY A 240 1 ? 14 HELX_P HELX_P8 AA8 GLY A 245 ? LYS A 250 ? GLY A 243 LYS A 248 1 ? 6 HELX_P HELX_P9 AA9 SER A 254 ? LEU A 264 ? SER A 252 LEU A 262 1 ? 11 HELX_P HELX_P10 AB1 ASN A 271 ? PHE A 276 ? ASN A 269 PHE A 274 1 ? 6 HELX_P HELX_P11 AB2 ASN A 280 ? LEU A 291 ? ASN A 278 LEU A 289 1 ? 12 HELX_P HELX_P12 AB3 ASP A 294 ? ARG A 298 ? ASP A 292 ARG A 296 5 ? 5 HELX_P HELX_P13 AB4 THR A 300 ? ALA A 306 ? THR A 298 ALA A 304 1 ? 7 HELX_P HELX_P14 AB5 HIS A 307 ? ALA A 311 ? HIS A 305 ALA A 309 5 ? 5 HELX_P HELX_P15 AB6 ASP A 315 ? GLU A 319 ? ASP A 313 GLU A 317 5 ? 5 HELX_P HELX_P16 AB7 GLN A 327 ? ARG A 332 ? GLN A 325 ARG A 330 5 ? 6 HELX_P HELX_P17 AB8 LEU A 335 ? SER A 349 ? LEU A 333 SER A 347 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 5 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 10 ? LEU A 15 ? PHE A 8 LEU A 13 AA1 2 THR A 18 ? PRO A 23 ? THR A 16 PRO A 21 AA2 1 TYR A 26 ? GLY A 33 ? TYR A 24 GLY A 31 AA2 2 SER A 39 ? ASP A 45 ? SER A 37 ASP A 43 AA2 3 ARG A 51 ? LYS A 56 ? ARG A 49 LYS A 54 AA2 4 TYR A 105 ? HIS A 109 ? TYR A 103 HIS A 107 AA2 5 ASP A 90 ? PHE A 92 ? ASP A 88 PHE A 90 AA3 1 ALA A 113 ? ASP A 114 ? ALA A 111 ASP A 112 AA3 2 LEU A 158 ? VAL A 160 ? LEU A 156 VAL A 158 AA3 3 LEU A 166 ? ILE A 168 ? LEU A 164 ILE A 166 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLN A 13 ? N GLN A 11 O TRP A 20 ? O TRP A 18 AA2 1 2 N GLN A 27 ? N GLN A 25 O PHE A 44 ? O PHE A 42 AA2 2 3 N CYS A 41 ? N CYS A 39 O VAL A 54 ? O VAL A 52 AA2 3 4 N LYS A 55 ? N LYS A 53 O LEU A 106 ? O LEU A 104 AA2 4 5 O VAL A 107 ? O VAL A 105 N ASP A 90 ? N ASP A 88 AA3 1 2 N ALA A 113 ? N ALA A 111 O VAL A 160 ? O VAL A 158 AA3 2 3 N ALA A 159 ? N ALA A 157 O LYS A 167 ? O LYS A 165 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A I46 401 ? 9 'binding site for residue I46 A 401' AC2 Software A HYK 402 ? 14 'binding site for residue HYK A 402' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 LEU A 197 ? LEU A 195 . ? 1_555 ? 2 AC1 9 TRP A 199 ? TRP A 197 . ? 1_555 ? 3 AC1 9 PRO A 244 ? PRO A 242 . ? 1_555 ? 4 AC1 9 LYS A 251 ? LYS A 249 . ? 1_555 ? 5 AC1 9 ILE A 261 ? ILE A 259 . ? 1_555 ? 6 AC1 9 LEU A 293 ? LEU A 291 . ? 1_555 ? 7 AC1 9 SER A 295 ? SER A 293 . ? 1_555 ? 8 AC1 9 HOH D . ? HOH A 550 . ? 1_555 ? 9 AC1 9 HOH D . ? HOH A 554 . ? 4_445 ? 10 AC2 14 ALA A 53 ? ALA A 51 . ? 1_555 ? 11 AC2 14 LYS A 55 ? LYS A 53 . ? 1_555 ? 12 AC2 14 GLU A 73 ? GLU A 71 . ? 1_555 ? 13 AC2 14 LEU A 76 ? LEU A 74 . ? 1_555 ? 14 AC2 14 ILE A 86 ? ILE A 84 . ? 1_555 ? 15 AC2 14 LEU A 106 ? LEU A 104 . ? 1_555 ? 16 AC2 14 THR A 108 ? THR A 106 . ? 1_555 ? 17 AC2 14 HIS A 109 ? HIS A 107 . ? 1_555 ? 18 AC2 14 MET A 111 ? MET A 109 . ? 1_555 ? 19 AC2 14 GLY A 112 ? GLY A 110 . ? 1_555 ? 20 AC2 14 ALA A 113 ? ALA A 111 . ? 1_555 ? 21 AC2 14 LEU A 169 ? LEU A 167 . ? 1_555 ? 22 AC2 14 ASP A 170 ? ASP A 168 . ? 1_555 ? 23 AC2 14 HOH D . ? HOH A 579 . ? 1_555 ? # _atom_sites.entry_id 6QDZ _atom_sites.fract_transf_matrix[1][1] 0.015302 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013515 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012875 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C F N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 SER 2 0 ? ? ? A . n A 1 3 MET 3 1 ? ? ? A . n A 1 4 SER 4 2 ? ? ? A . n A 1 5 GLN 5 3 ? ? ? A . n A 1 6 GLU 6 4 ? ? ? A . n A 1 7 ARG 7 5 5 ARG ARG A . n A 1 8 PRO 8 6 6 PRO PRO A . n A 1 9 THR 9 7 7 THR THR A . n A 1 10 PHE 10 8 8 PHE PHE A . n A 1 11 TYR 11 9 9 TYR TYR A . n A 1 12 ARG 12 10 10 ARG ARG A . n A 1 13 GLN 13 11 11 GLN GLN A . n A 1 14 GLU 14 12 12 GLU GLU A . n A 1 15 LEU 15 13 13 LEU LEU A . n A 1 16 ASN 16 14 14 ASN ASN A . n A 1 17 LYS 17 15 15 LYS LYS A . n A 1 18 THR 18 16 16 THR THR A . n A 1 19 ILE 19 17 17 ILE ILE A . n A 1 20 TRP 20 18 18 TRP TRP A . n A 1 21 GLU 21 19 19 GLU GLU A . n A 1 22 VAL 22 20 20 VAL VAL A . n A 1 23 PRO 23 21 21 PRO PRO A . n A 1 24 GLU 24 22 22 GLU GLU A . n A 1 25 ARG 25 23 23 ARG ARG A . n A 1 26 TYR 26 24 24 TYR TYR A . n A 1 27 GLN 27 25 25 GLN GLN A . n A 1 28 ASN 28 26 26 ASN ASN A . n A 1 29 LEU 29 27 27 LEU LEU A . n A 1 30 SER 30 28 28 SER SER A . n A 1 31 PRO 31 29 29 PRO PRO A . n A 1 32 VAL 32 30 30 VAL VAL A . n A 1 33 GLY 33 31 31 GLY GLY A . n A 1 34 SER 34 32 32 SER SER A . n A 1 35 GLY 35 33 ? ? ? A . n A 1 36 ALA 36 34 ? ? ? A . n A 1 37 TYR 37 35 ? ? ? A . n A 1 38 GLY 38 36 36 GLY GLY A . n A 1 39 SER 39 37 37 SER SER A . n A 1 40 VAL 40 38 38 VAL VAL A . n A 1 41 CYS 41 39 39 CYS CYS A . n A 1 42 ALA 42 40 40 ALA ALA A . n A 1 43 ALA 43 41 41 ALA ALA A . n A 1 44 PHE 44 42 42 PHE PHE A . n A 1 45 ASP 45 43 43 ASP ASP A . n A 1 46 THR 46 44 44 THR THR A . n A 1 47 LYS 47 45 45 LYS LYS A . n A 1 48 THR 48 46 46 THR THR A . n A 1 49 GLY 49 47 47 GLY GLY A . n A 1 50 LEU 50 48 48 LEU LEU A . n A 1 51 ARG 51 49 49 ARG ARG A . n A 1 52 VAL 52 50 50 VAL VAL A . n A 1 53 ALA 53 51 51 ALA ALA A . n A 1 54 VAL 54 52 52 VAL VAL A . n A 1 55 LYS 55 53 53 LYS LYS A . n A 1 56 LYS 56 54 54 LYS LYS A . n A 1 57 LEU 57 55 55 LEU LEU A . n A 1 58 SER 58 56 56 SER SER A . n A 1 59 ARG 59 57 57 ARG ARG A . n A 1 60 PRO 60 58 58 PRO PRO A . n A 1 61 PHE 61 59 59 PHE PHE A . n A 1 62 GLN 62 60 60 GLN GLN A . n A 1 63 SER 63 61 61 SER SER A . n A 1 64 ILE 64 62 62 ILE ILE A . n A 1 65 ILE 65 63 63 ILE ILE A . n A 1 66 HIS 66 64 64 HIS HIS A . n A 1 67 ALA 67 65 65 ALA ALA A . n A 1 68 LYS 68 66 66 LYS LYS A . n A 1 69 ARG 69 67 67 ARG ARG A . n A 1 70 THR 70 68 68 THR THR A . n A 1 71 TYR 71 69 69 TYR TYR A . n A 1 72 ARG 72 70 70 ARG ARG A . n A 1 73 GLU 73 71 71 GLU GLU A . n A 1 74 LEU 74 72 72 LEU LEU A . n A 1 75 ARG 75 73 73 ARG ARG A . n A 1 76 LEU 76 74 74 LEU LEU A . n A 1 77 LEU 77 75 75 LEU LEU A . n A 1 78 LYS 78 76 76 LYS LYS A . n A 1 79 HIS 79 77 77 HIS HIS A . n A 1 80 MET 80 78 78 MET MET A . n A 1 81 LYS 81 79 79 LYS LYS A . n A 1 82 HIS 82 80 80 HIS HIS A . n A 1 83 GLU 83 81 81 GLU GLU A . n A 1 84 ASN 84 82 82 ASN ASN A . n A 1 85 VAL 85 83 83 VAL VAL A . n A 1 86 ILE 86 84 84 ILE ILE A . n A 1 87 GLY 87 85 85 GLY GLY A . n A 1 88 LEU 88 86 86 LEU LEU A . n A 1 89 LEU 89 87 87 LEU LEU A . n A 1 90 ASP 90 88 88 ASP ASP A . n A 1 91 VAL 91 89 89 VAL VAL A . n A 1 92 PHE 92 90 90 PHE PHE A . n A 1 93 THR 93 91 91 THR THR A . n A 1 94 PRO 94 92 92 PRO PRO A . n A 1 95 ALA 95 93 93 ALA ALA A . n A 1 96 ARG 96 94 94 ARG ARG A . n A 1 97 SER 97 95 95 SER SER A . n A 1 98 LEU 98 96 96 LEU LEU A . n A 1 99 GLU 99 97 97 GLU GLU A . n A 1 100 GLU 100 98 98 GLU GLU A . n A 1 101 PHE 101 99 99 PHE PHE A . n A 1 102 ASN 102 100 100 ASN ASN A . n A 1 103 ASP 103 101 101 ASP ASP A . n A 1 104 VAL 104 102 102 VAL VAL A . n A 1 105 TYR 105 103 103 TYR TYR A . n A 1 106 LEU 106 104 104 LEU LEU A . n A 1 107 VAL 107 105 105 VAL VAL A . n A 1 108 THR 108 106 106 THR THR A . n A 1 109 HIS 109 107 107 HIS HIS A . n A 1 110 LEU 110 108 108 LEU LEU A . n A 1 111 MET 111 109 109 MET MET A . n A 1 112 GLY 112 110 110 GLY GLY A . n A 1 113 ALA 113 111 111 ALA ALA A . n A 1 114 ASP 114 112 112 ASP ASP A . n A 1 115 LEU 115 113 113 LEU LEU A . n A 1 116 ASN 116 114 114 ASN ASN A . n A 1 117 ASN 117 115 115 ASN ASN A . n A 1 118 ILE 118 116 116 ILE ILE A . n A 1 119 VAL 119 117 ? ? ? A . n A 1 120 LYS 120 118 ? ? ? A . n A 1 121 CYS 121 119 ? ? ? A . n A 1 122 GLN 122 120 ? ? ? A . n A 1 123 LYS 123 121 ? ? ? A . n A 1 124 LEU 124 122 122 LEU LEU A . n A 1 125 THR 125 123 123 THR THR A . n A 1 126 ASP 126 124 124 ASP ASP A . n A 1 127 ASP 127 125 125 ASP ASP A . n A 1 128 HIS 128 126 126 HIS HIS A . n A 1 129 VAL 129 127 127 VAL VAL A . n A 1 130 GLN 130 128 128 GLN GLN A . n A 1 131 PHE 131 129 129 PHE PHE A . n A 1 132 LEU 132 130 130 LEU LEU A . n A 1 133 ILE 133 131 131 ILE ILE A . n A 1 134 TYR 134 132 132 TYR TYR A . n A 1 135 GLN 135 133 133 GLN GLN A . n A 1 136 ILE 136 134 134 ILE ILE A . n A 1 137 LEU 137 135 135 LEU LEU A . n A 1 138 ARG 138 136 136 ARG ARG A . n A 1 139 GLY 139 137 137 GLY GLY A . n A 1 140 LEU 140 138 138 LEU LEU A . n A 1 141 LYS 141 139 139 LYS LYS A . n A 1 142 TYR 142 140 140 TYR TYR A . n A 1 143 ILE 143 141 141 ILE ILE A . n A 1 144 HIS 144 142 142 HIS HIS A . n A 1 145 SER 145 143 143 SER SER A . n A 1 146 ALA 146 144 144 ALA ALA A . n A 1 147 ASP 147 145 145 ASP ASP A . n A 1 148 ILE 148 146 146 ILE ILE A . n A 1 149 ILE 149 147 147 ILE ILE A . n A 1 150 HIS 150 148 148 HIS HIS A . n A 1 151 ARG 151 149 149 ARG ARG A . n A 1 152 ASP 152 150 150 ASP ASP A . n A 1 153 LEU 153 151 151 LEU LEU A . n A 1 154 LYS 154 152 152 LYS LYS A . n A 1 155 PRO 155 153 153 PRO PRO A . n A 1 156 SER 156 154 154 SER SER A . n A 1 157 ASN 157 155 155 ASN ASN A . n A 1 158 LEU 158 156 156 LEU LEU A . n A 1 159 ALA 159 157 157 ALA ALA A . n A 1 160 VAL 160 158 158 VAL VAL A . n A 1 161 ASN 161 159 159 ASN ASN A . n A 1 162 GLU 162 160 160 GLU GLU A . n A 1 163 ASP 163 161 161 ASP ASP A . n A 1 164 CYS 164 162 162 CYS CYS A . n A 1 165 GLU 165 163 163 GLU GLU A . n A 1 166 LEU 166 164 164 LEU LEU A . n A 1 167 LYS 167 165 165 LYS LYS A . n A 1 168 ILE 168 166 166 ILE ILE A . n A 1 169 LEU 169 167 167 LEU LEU A . n A 1 170 ASP 170 168 168 ASP ASP A . n A 1 171 PHE 171 169 169 PHE PHE A . n A 1 172 GLY 172 170 170 GLY GLY A . n A 1 173 LEU 173 171 ? ? ? A . n A 1 174 ALA 174 172 ? ? ? A . n A 1 175 ARG 175 173 ? ? ? A . n A 1 176 HIS 176 174 ? ? ? A . n A 1 177 THR 177 175 ? ? ? A . n A 1 178 ASP 178 176 ? ? ? A . n A 1 179 ASP 179 177 ? ? ? A . n A 1 180 GLU 180 178 ? ? ? A . n A 1 181 MET 181 179 ? ? ? A . n A 1 182 THR 182 180 ? ? ? A . n A 1 183 GLY 183 181 ? ? ? A . n A 1 184 TYR 184 182 ? ? ? A . n A 1 185 VAL 185 183 ? ? ? A . n A 1 186 ALA 186 184 184 ALA ALA A . n A 1 187 THR 187 185 185 THR THR A . n A 1 188 ARG 188 186 186 ARG ARG A . n A 1 189 TRP 189 187 187 TRP TRP A . n A 1 190 TYR 190 188 188 TYR TYR A . n A 1 191 ARG 191 189 189 ARG ARG A . n A 1 192 ALA 192 190 190 ALA ALA A . n A 1 193 PRO 193 191 191 PRO PRO A . n A 1 194 GLU 194 192 192 GLU GLU A . n A 1 195 ILE 195 193 193 ILE ILE A . n A 1 196 MET 196 194 194 MET MET A . n A 1 197 LEU 197 195 195 LEU LEU A . n A 1 198 ASN 198 196 196 ASN ASN A . n A 1 199 TRP 199 197 197 TRP TRP A . n A 1 200 MET 200 198 198 MET MET A . n A 1 201 HIS 201 199 199 HIS HIS A . n A 1 202 TYR 202 200 200 TYR TYR A . n A 1 203 ASN 203 201 201 ASN ASN A . n A 1 204 GLN 204 202 202 GLN GLN A . n A 1 205 THR 205 203 203 THR THR A . n A 1 206 VAL 206 204 204 VAL VAL A . n A 1 207 ASP 207 205 205 ASP ASP A . n A 1 208 ILE 208 206 206 ILE ILE A . n A 1 209 TRP 209 207 207 TRP TRP A . n A 1 210 SER 210 208 208 SER SER A . n A 1 211 VAL 211 209 209 VAL VAL A . n A 1 212 GLY 212 210 210 GLY GLY A . n A 1 213 CYS 213 211 211 CYS CYS A . n A 1 214 ILE 214 212 212 ILE ILE A . n A 1 215 MET 215 213 213 MET MET A . n A 1 216 ALA 216 214 214 ALA ALA A . n A 1 217 GLU 217 215 215 GLU GLU A . n A 1 218 LEU 218 216 216 LEU LEU A . n A 1 219 LEU 219 217 217 LEU LEU A . n A 1 220 THR 220 218 218 THR THR A . n A 1 221 GLY 221 219 219 GLY GLY A . n A 1 222 ARG 222 220 220 ARG ARG A . n A 1 223 THR 223 221 221 THR THR A . n A 1 224 LEU 224 222 222 LEU LEU A . n A 1 225 PHE 225 223 223 PHE PHE A . n A 1 226 PRO 226 224 224 PRO PRO A . n A 1 227 GLY 227 225 225 GLY GLY A . n A 1 228 THR 228 226 226 THR THR A . n A 1 229 ASP 229 227 227 ASP ASP A . n A 1 230 HIS 230 228 228 HIS HIS A . n A 1 231 ILE 231 229 229 ILE ILE A . n A 1 232 ASP 232 230 230 ASP ASP A . n A 1 233 GLN 233 231 231 GLN GLN A . n A 1 234 LEU 234 232 232 LEU LEU A . n A 1 235 LYS 235 233 233 LYS LYS A . n A 1 236 LEU 236 234 234 LEU LEU A . n A 1 237 ILE 237 235 235 ILE ILE A . n A 1 238 LEU 238 236 236 LEU LEU A . n A 1 239 ARG 239 237 237 ARG ARG A . n A 1 240 LEU 240 238 238 LEU LEU A . n A 1 241 VAL 241 239 239 VAL VAL A . n A 1 242 GLY 242 240 240 GLY GLY A . n A 1 243 THR 243 241 241 THR THR A . n A 1 244 PRO 244 242 242 PRO PRO A . n A 1 245 GLY 245 243 243 GLY GLY A . n A 1 246 ALA 246 244 244 ALA ALA A . n A 1 247 GLU 247 245 245 GLU GLU A . n A 1 248 LEU 248 246 246 LEU LEU A . n A 1 249 LEU 249 247 247 LEU LEU A . n A 1 250 LYS 250 248 248 LYS LYS A . n A 1 251 LYS 251 249 249 LYS LYS A . n A 1 252 ILE 252 250 250 ILE ILE A . n A 1 253 SER 253 251 251 SER SER A . n A 1 254 SER 254 252 252 SER SER A . n A 1 255 GLU 255 253 253 GLU GLU A . n A 1 256 SER 256 254 254 SER SER A . n A 1 257 ALA 257 255 255 ALA ALA A . n A 1 258 ARG 258 256 256 ARG ARG A . n A 1 259 ASN 259 257 257 ASN ASN A . n A 1 260 TYR 260 258 258 TYR TYR A . n A 1 261 ILE 261 259 259 ILE ILE A . n A 1 262 GLN 262 260 260 GLN GLN A . n A 1 263 SER 263 261 261 SER SER A . n A 1 264 LEU 264 262 262 LEU LEU A . n A 1 265 THR 265 263 263 THR THR A . n A 1 266 GLN 266 264 264 GLN GLN A . n A 1 267 MET 267 265 265 MET MET A . n A 1 268 PRO 268 266 266 PRO PRO A . n A 1 269 LYS 269 267 267 LYS LYS A . n A 1 270 MET 270 268 268 MET MET A . n A 1 271 ASN 271 269 269 ASN ASN A . n A 1 272 PHE 272 270 270 PHE PHE A . n A 1 273 ALA 273 271 271 ALA ALA A . n A 1 274 ASN 274 272 272 ASN ASN A . n A 1 275 VAL 275 273 273 VAL VAL A . n A 1 276 PHE 276 274 274 PHE PHE A . n A 1 277 ILE 277 275 275 ILE ILE A . n A 1 278 GLY 278 276 276 GLY GLY A . n A 1 279 ALA 279 277 277 ALA ALA A . n A 1 280 ASN 280 278 278 ASN ASN A . n A 1 281 PRO 281 279 279 PRO PRO A . n A 1 282 LEU 282 280 280 LEU LEU A . n A 1 283 ALA 283 281 281 ALA ALA A . n A 1 284 VAL 284 282 282 VAL VAL A . n A 1 285 ASP 285 283 283 ASP ASP A . n A 1 286 LEU 286 284 284 LEU LEU A . n A 1 287 LEU 287 285 285 LEU LEU A . n A 1 288 GLU 288 286 286 GLU GLU A . n A 1 289 LYS 289 287 287 LYS LYS A . n A 1 290 MET 290 288 288 MET MET A . n A 1 291 LEU 291 289 289 LEU LEU A . n A 1 292 VAL 292 290 290 VAL VAL A . n A 1 293 LEU 293 291 291 LEU LEU A . n A 1 294 ASP 294 292 292 ASP ASP A . n A 1 295 SER 295 293 293 SER SER A . n A 1 296 ASP 296 294 294 ASP ASP A . n A 1 297 LYS 297 295 295 LYS LYS A . n A 1 298 ARG 298 296 296 ARG ARG A . n A 1 299 ILE 299 297 297 ILE ILE A . n A 1 300 THR 300 298 298 THR THR A . n A 1 301 ALA 301 299 299 ALA ALA A . n A 1 302 ALA 302 300 300 ALA ALA A . n A 1 303 GLN 303 301 301 GLN GLN A . n A 1 304 ALA 304 302 302 ALA ALA A . n A 1 305 LEU 305 303 303 LEU LEU A . n A 1 306 ALA 306 304 304 ALA ALA A . n A 1 307 HIS 307 305 305 HIS HIS A . n A 1 308 ALA 308 306 306 ALA ALA A . n A 1 309 TYR 309 307 307 TYR TYR A . n A 1 310 PHE 310 308 308 PHE PHE A . n A 1 311 ALA 311 309 309 ALA ALA A . n A 1 312 GLN 312 310 310 GLN GLN A . n A 1 313 TYR 313 311 311 TYR TYR A . n A 1 314 HIS 314 312 312 HIS HIS A . n A 1 315 ASP 315 313 313 ASP ASP A . n A 1 316 PRO 316 314 314 PRO PRO A . n A 1 317 ASP 317 315 315 ASP ASP A . n A 1 318 ASP 318 316 316 ASP ASP A . n A 1 319 GLU 319 317 317 GLU GLU A . n A 1 320 PRO 320 318 318 PRO PRO A . n A 1 321 VAL 321 319 319 VAL VAL A . n A 1 322 ALA 322 320 320 ALA ALA A . n A 1 323 ASP 323 321 321 ASP ASP A . n A 1 324 PRO 324 322 322 PRO PRO A . n A 1 325 TYR 325 323 323 TYR TYR A . n A 1 326 ASP 326 324 324 ASP ASP A . n A 1 327 GLN 327 325 325 GLN GLN A . n A 1 328 SER 328 326 326 SER SER A . n A 1 329 PHE 329 327 327 PHE PHE A . n A 1 330 GLU 330 328 328 GLU GLU A . n A 1 331 SER 331 329 329 SER SER A . n A 1 332 ARG 332 330 330 ARG ARG A . n A 1 333 ASP 333 331 331 ASP ASP A . n A 1 334 LEU 334 332 332 LEU LEU A . n A 1 335 LEU 335 333 333 LEU LEU A . n A 1 336 ILE 336 334 334 ILE ILE A . n A 1 337 ASP 337 335 335 ASP ASP A . n A 1 338 GLU 338 336 336 GLU GLU A . n A 1 339 TRP 339 337 337 TRP TRP A . n A 1 340 LYS 340 338 338 LYS LYS A . n A 1 341 SER 341 339 339 SER SER A . n A 1 342 LEU 342 340 340 LEU LEU A . n A 1 343 THR 343 341 341 THR THR A . n A 1 344 TYR 344 342 342 TYR TYR A . n A 1 345 ASP 345 343 343 ASP ASP A . n A 1 346 GLU 346 344 344 GLU GLU A . n A 1 347 VAL 347 345 345 VAL VAL A . n A 1 348 ILE 348 346 346 ILE ILE A . n A 1 349 SER 349 347 347 SER SER A . n A 1 350 PHE 350 348 348 PHE PHE A . n A 1 351 VAL 351 349 349 VAL VAL A . n A 1 352 PRO 352 350 350 PRO PRO A . n A 1 353 PRO 353 351 351 PRO PRO A . n A 1 354 PRO 354 352 352 PRO PRO A . n A 1 355 LEU 355 353 ? ? ? A . n A 1 356 ASP 356 354 ? ? ? A . n A 1 357 GLN 357 355 ? ? ? A . n A 1 358 GLU 358 356 ? ? ? A . n A 1 359 GLU 359 357 ? ? ? A . n A 1 360 MET 360 358 ? ? ? A . n A 1 361 GLU 361 359 ? ? ? A . n A 1 362 SER 362 360 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 I46 1 401 1354 I46 I46 A . C 3 HYK 1 402 1 HYK LIG A . D 4 HOH 1 501 122 HOH HOH A . D 4 HOH 2 502 136 HOH HOH A . D 4 HOH 3 503 131 HOH HOH A . D 4 HOH 4 504 138 HOH HOH A . D 4 HOH 5 505 152 HOH HOH A . D 4 HOH 6 506 80 HOH HOH A . D 4 HOH 7 507 139 HOH HOH A . D 4 HOH 8 508 7 HOH HOH A . D 4 HOH 9 509 12 HOH HOH A . D 4 HOH 10 510 66 HOH HOH A . D 4 HOH 11 511 55 HOH HOH A . D 4 HOH 12 512 73 HOH HOH A . D 4 HOH 13 513 123 HOH HOH A . D 4 HOH 14 514 97 HOH HOH A . D 4 HOH 15 515 20 HOH HOH A . D 4 HOH 16 516 78 HOH HOH A . D 4 HOH 17 517 107 HOH HOH A . D 4 HOH 18 518 40 HOH HOH A . D 4 HOH 19 519 38 HOH HOH A . D 4 HOH 20 520 58 HOH HOH A . D 4 HOH 21 521 88 HOH HOH A . D 4 HOH 22 522 18 HOH HOH A . D 4 HOH 23 523 94 HOH HOH A . D 4 HOH 24 524 46 HOH HOH A . D 4 HOH 25 525 49 HOH HOH A . D 4 HOH 26 526 153 HOH HOH A . D 4 HOH 27 527 16 HOH HOH A . D 4 HOH 28 528 53 HOH HOH A . D 4 HOH 29 529 142 HOH HOH A . D 4 HOH 30 530 59 HOH HOH A . D 4 HOH 31 531 118 HOH HOH A . D 4 HOH 32 532 71 HOH HOH A . D 4 HOH 33 533 130 HOH HOH A . D 4 HOH 34 534 114 HOH HOH A . D 4 HOH 35 535 125 HOH HOH A . D 4 HOH 36 536 6 HOH HOH A . D 4 HOH 37 537 70 HOH HOH A . D 4 HOH 38 538 151 HOH HOH A . D 4 HOH 39 539 150 HOH HOH A . D 4 HOH 40 540 42 HOH HOH A . D 4 HOH 41 541 115 HOH HOH A . D 4 HOH 42 542 82 HOH HOH A . D 4 HOH 43 543 113 HOH HOH A . D 4 HOH 44 544 63 HOH HOH A . D 4 HOH 45 545 48 HOH HOH A . D 4 HOH 46 546 116 HOH HOH A . D 4 HOH 47 547 157 HOH HOH A . D 4 HOH 48 548 19 HOH HOH A . D 4 HOH 49 549 17 HOH HOH A . D 4 HOH 50 550 21 HOH HOH A . D 4 HOH 51 551 9 HOH HOH A . D 4 HOH 52 552 68 HOH HOH A . D 4 HOH 53 553 109 HOH HOH A . D 4 HOH 54 554 36 HOH HOH A . D 4 HOH 55 555 5 HOH HOH A . D 4 HOH 56 556 45 HOH HOH A . D 4 HOH 57 557 35 HOH HOH A . D 4 HOH 58 558 101 HOH HOH A . D 4 HOH 59 559 32 HOH HOH A . D 4 HOH 60 560 92 HOH HOH A . D 4 HOH 61 561 57 HOH HOH A . D 4 HOH 62 562 65 HOH HOH A . D 4 HOH 63 563 22 HOH HOH A . D 4 HOH 64 564 76 HOH HOH A . D 4 HOH 65 565 28 HOH HOH A . D 4 HOH 66 566 44 HOH HOH A . D 4 HOH 67 567 52 HOH HOH A . D 4 HOH 68 568 112 HOH HOH A . D 4 HOH 69 569 4 HOH HOH A . D 4 HOH 70 570 87 HOH HOH A . D 4 HOH 71 571 99 HOH HOH A . D 4 HOH 72 572 121 HOH HOH A . D 4 HOH 73 573 37 HOH HOH A . D 4 HOH 74 574 77 HOH HOH A . D 4 HOH 75 575 27 HOH HOH A . D 4 HOH 76 576 69 HOH HOH A . D 4 HOH 77 577 86 HOH HOH A . D 4 HOH 78 578 100 HOH HOH A . D 4 HOH 79 579 15 HOH HOH A . D 4 HOH 80 580 106 HOH HOH A . D 4 HOH 81 581 64 HOH HOH A . D 4 HOH 82 582 3 HOH HOH A . D 4 HOH 83 583 11 HOH HOH A . D 4 HOH 84 584 2 HOH HOH A . D 4 HOH 85 585 10 HOH HOH A . D 4 HOH 86 586 14 HOH HOH A . D 4 HOH 87 587 56 HOH HOH A . D 4 HOH 88 588 54 HOH HOH A . D 4 HOH 89 589 154 HOH HOH A . D 4 HOH 90 590 105 HOH HOH A . D 4 HOH 91 591 41 HOH HOH A . D 4 HOH 92 592 29 HOH HOH A . D 4 HOH 93 593 24 HOH HOH A . D 4 HOH 94 594 8 HOH HOH A . D 4 HOH 95 595 81 HOH HOH A . D 4 HOH 96 596 83 HOH HOH A . D 4 HOH 97 597 67 HOH HOH A . D 4 HOH 98 598 51 HOH HOH A . D 4 HOH 99 599 91 HOH HOH A . D 4 HOH 100 600 84 HOH HOH A . D 4 HOH 101 601 34 HOH HOH A . D 4 HOH 102 602 61 HOH HOH A . D 4 HOH 103 603 110 HOH HOH A . D 4 HOH 104 604 33 HOH HOH A . D 4 HOH 105 605 124 HOH HOH A . D 4 HOH 106 606 31 HOH HOH A . D 4 HOH 107 607 104 HOH HOH A . D 4 HOH 108 608 108 HOH HOH A . D 4 HOH 109 609 25 HOH HOH A . D 4 HOH 110 610 26 HOH HOH A . D 4 HOH 111 611 72 HOH HOH A . D 4 HOH 112 612 141 HOH HOH A . D 4 HOH 113 613 23 HOH HOH A . D 4 HOH 114 614 74 HOH HOH A . D 4 HOH 115 615 60 HOH HOH A . D 4 HOH 116 616 119 HOH HOH A . D 4 HOH 117 617 98 HOH HOH A . D 4 HOH 118 618 90 HOH HOH A . D 4 HOH 119 619 43 HOH HOH A . D 4 HOH 120 620 47 HOH HOH A . D 4 HOH 121 621 39 HOH HOH A . D 4 HOH 122 622 13 HOH HOH A . D 4 HOH 123 623 1 HOH HOH A . D 4 HOH 124 624 62 HOH HOH A . D 4 HOH 125 625 102 HOH HOH A . D 4 HOH 126 626 111 HOH HOH A . D 4 HOH 127 627 155 HOH HOH A . D 4 HOH 128 628 117 HOH HOH A . D 4 HOH 129 629 95 HOH HOH A . D 4 HOH 130 630 103 HOH HOH A . D 4 HOH 131 631 93 HOH HOH A . D 4 HOH 132 632 89 HOH HOH A . D 4 HOH 133 633 30 HOH HOH A . D 4 HOH 134 634 144 HOH HOH A . D 4 HOH 135 635 75 HOH HOH A . D 4 HOH 136 636 156 HOH HOH A . D 4 HOH 137 637 126 HOH HOH A . D 4 HOH 138 638 128 HOH HOH A . D 4 HOH 139 639 96 HOH HOH A . D 4 HOH 140 640 133 HOH HOH A . D 4 HOH 141 641 135 HOH HOH A . D 4 HOH 142 642 129 HOH HOH A . D 4 HOH 143 643 120 HOH HOH A . D 4 HOH 144 644 79 HOH HOH A . D 4 HOH 145 645 140 HOH HOH A . D 4 HOH 146 646 149 HOH HOH A . D 4 HOH 147 647 143 HOH HOH A . D 4 HOH 148 648 85 HOH HOH A . D 4 HOH 149 649 147 HOH HOH A . D 4 HOH 150 650 148 HOH HOH A . D 4 HOH 151 651 132 HOH HOH A . D 4 HOH 152 652 50 HOH HOH A . D 4 HOH 153 653 145 HOH HOH A . D 4 HOH 154 654 137 HOH HOH A . D 4 HOH 155 655 134 HOH HOH A . D 4 HOH 156 656 146 HOH HOH A . D 4 HOH 157 657 127 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 16070 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2020-01-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -6.9053 _pdbx_refine_tls.origin_y -3.0740 _pdbx_refine_tls.origin_z 15.2654 _pdbx_refine_tls.T[1][1] 0.0016 _pdbx_refine_tls.T[2][2] 0.0502 _pdbx_refine_tls.T[3][3] 0.0812 _pdbx_refine_tls.T[1][2] -0.0011 _pdbx_refine_tls.T[1][3] 0.0063 _pdbx_refine_tls.T[2][3] -0.0241 _pdbx_refine_tls.L[1][1] 0.5505 _pdbx_refine_tls.L[2][2] 0.3029 _pdbx_refine_tls.L[3][3] 0.0502 _pdbx_refine_tls.L[1][2] 0.0041 _pdbx_refine_tls.L[1][3] 0.0568 _pdbx_refine_tls.L[2][3] 0.0615 _pdbx_refine_tls.S[1][1] 0.0255 _pdbx_refine_tls.S[1][2] -0.0598 _pdbx_refine_tls.S[1][3] 0.0452 _pdbx_refine_tls.S[2][1] -0.0034 _pdbx_refine_tls.S[2][2] -0.0082 _pdbx_refine_tls.S[2][3] -0.0124 _pdbx_refine_tls.S[3][1] 0.0013 _pdbx_refine_tls.S[3][2] -0.0079 _pdbx_refine_tls.S[3][3] -0.0173 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 5 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 401 _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0238 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 509 ? ? O A HOH 603 ? ? 2.06 2 1 O A LEU 55 ? ? O A HOH 501 ? ? 2.14 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 508 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 646 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 3_455 _pdbx_validate_symm_contact.dist 2.06 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 C _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 THR _pdbx_validate_rmsd_bond.auth_seq_id_1 185 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 O _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 THR _pdbx_validate_rmsd_bond.auth_seq_id_2 185 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.346 _pdbx_validate_rmsd_bond.bond_target_value 1.229 _pdbx_validate_rmsd_bond.bond_deviation 0.117 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.019 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 189 ? ? CZ A ARG 189 ? ? NH1 A ARG 189 ? ? 123.55 120.30 3.25 0.50 N 2 1 NE A ARG 189 ? ? CZ A ARG 189 ? ? NH2 A ARG 189 ? ? 116.48 120.30 -3.82 0.50 N 3 1 NE A ARG 296 ? ? CZ A ARG 296 ? ? NH1 A ARG 296 ? ? 116.63 120.30 -3.67 0.50 N 4 1 NE A ARG 330 ? ? CZ A ARG 330 ? ? NH2 A ARG 330 ? ? 116.25 120.30 -4.05 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 15 ? ? 73.30 -19.73 2 1 ASN A 100 ? ? -145.90 12.05 3 1 ARG A 149 ? ? 84.01 -14.16 4 1 ASP A 150 ? ? -140.14 45.51 5 1 ASN A 196 ? ? 75.77 36.94 6 1 LEU A 289 ? ? -98.45 30.16 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A SER 0 ? A SER 2 3 1 Y 1 A MET 1 ? A MET 3 4 1 Y 1 A SER 2 ? A SER 4 5 1 Y 1 A GLN 3 ? A GLN 5 6 1 Y 1 A GLU 4 ? A GLU 6 7 1 Y 1 A GLY 33 ? A GLY 35 8 1 Y 1 A ALA 34 ? A ALA 36 9 1 Y 1 A TYR 35 ? A TYR 37 10 1 Y 1 A VAL 117 ? A VAL 119 11 1 Y 1 A LYS 118 ? A LYS 120 12 1 Y 1 A CYS 119 ? A CYS 121 13 1 Y 1 A GLN 120 ? A GLN 122 14 1 Y 1 A LYS 121 ? A LYS 123 15 1 Y 1 A LEU 171 ? A LEU 173 16 1 Y 1 A ALA 172 ? A ALA 174 17 1 Y 1 A ARG 173 ? A ARG 175 18 1 Y 1 A HIS 174 ? A HIS 176 19 1 Y 1 A THR 175 ? A THR 177 20 1 Y 1 A ASP 176 ? A ASP 178 21 1 Y 1 A ASP 177 ? A ASP 179 22 1 Y 1 A GLU 178 ? A GLU 180 23 1 Y 1 A MET 179 ? A MET 181 24 1 Y 1 A THR 180 ? A THR 182 25 1 Y 1 A GLY 181 ? A GLY 183 26 1 Y 1 A TYR 182 ? A TYR 184 27 1 Y 1 A VAL 183 ? A VAL 185 28 1 Y 1 A LEU 353 ? A LEU 355 29 1 Y 1 A ASP 354 ? A ASP 356 30 1 Y 1 A GLN 355 ? A GLN 357 31 1 Y 1 A GLU 356 ? A GLU 358 32 1 Y 1 A GLU 357 ? A GLU 359 33 1 Y 1 A MET 358 ? A MET 360 34 1 Y 1 A GLU 359 ? A GLU 361 35 1 Y 1 A SER 360 ? A SER 362 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id HYK _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id HYK _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '2-fluoro-4-[4-(4-fluorophenyl)-1H-pyrazol-3-yl]pyridine' I46 3 ;1-[5-~{tert}-butyl-2-(4-methylphenyl)pyrazol-3-yl]-3-[(1~{S},4~{S})-4-[(3-propan-2-yl-[1,2,4]triazolo[4,3-a]pyridin-6-yl)oxy]-1,2,3,4-tetrahydronaphthalen-1-yl]urea ; HYK 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #