data_6QES # _entry.id 6QES # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.321 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6QES WWPDB D_1292100014 BMRB 34348 # _pdbx_database_related.db_name BMRB _pdbx_database_related.details '[1-40]Gga-AvBD11' _pdbx_database_related.db_id 34348 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6QES _pdbx_database_status.recvd_initial_deposition_date 2019-01-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Meudal, H.' 1 0000-0002-9642-3643 'Loth, K.' 2 0000-0001-7058-8661 'Delmas, A.F.' 3 0000-0002-8243-8887 'Landon, C.' 4 0000-0002-0248-1990 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 117 _citation.language ? _citation.page_first 337 _citation.page_last 345 _citation.title 'Structure, function, and evolution ofGga-AvBD11, the archetype of the structural avian-double-beta-defensin family.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1912941117 _citation.pdbx_database_id_PubMed 31871151 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Guyot, N.' 1 ? primary 'Meudal, H.' 2 0000-0002-9642-3643 primary 'Trapp, S.' 3 0000-0002-2735-0217 primary 'Iochmann, S.' 4 ? primary 'Silvestre, A.' 5 ? primary 'Jousset, G.' 6 ? primary 'Labas, V.' 7 ? primary 'Reverdiau, P.' 8 ? primary 'Loth, K.' 9 ? primary 'Herve, V.' 10 ? primary 'Aucagne, V.' 11 ? primary 'Delmas, A.F.' 12 ? primary 'Rehault-Godbert, S.' 13 ? primary 'Landon, C.' 14 0000-0002-0248-1990 # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description Gallinacin-11 _entity.formula_weight 4534.363 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Gal-11,Beta-defensin 11,Vitelline membrane outer layer protein 2,Vitelline membrane outer layer protein II,VMOII' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code LPRDTSRCVGYHGYCIRSKVCPKPFAAFGTCSWRQKTCCV _entity_poly.pdbx_seq_one_letter_code_can LPRDTSRCVGYHGYCIRSKVCPKPFAAFGTCSWRQKTCCV _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 PRO n 1 3 ARG n 1 4 ASP n 1 5 THR n 1 6 SER n 1 7 ARG n 1 8 CYS n 1 9 VAL n 1 10 GLY n 1 11 TYR n 1 12 HIS n 1 13 GLY n 1 14 TYR n 1 15 CYS n 1 16 ILE n 1 17 ARG n 1 18 SER n 1 19 LYS n 1 20 VAL n 1 21 CYS n 1 22 PRO n 1 23 LYS n 1 24 PRO n 1 25 PHE n 1 26 ALA n 1 27 ALA n 1 28 PHE n 1 29 GLY n 1 30 THR n 1 31 CYS n 1 32 SER n 1 33 TRP n 1 34 ARG n 1 35 GLN n 1 36 LYS n 1 37 THR n 1 38 CYS n 1 39 CYS n 1 40 VAL n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 40 _pdbx_entity_src_syn.organism_scientific 'Gallus gallus' _pdbx_entity_src_syn.organism_common_name Chicken _pdbx_entity_src_syn.ncbi_taxonomy_id 9031 _pdbx_entity_src_syn.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GLL11_CHICK _struct_ref.pdbx_db_accession Q6IV20 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code LPRDTSRCVGYHGYCIRSKVCPKPFAAFGTCSWRQKTCCV _struct_ref.pdbx_align_begin 23 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6QES _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 40 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6IV20 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 62 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 40 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H TOCSY' 1 isotropic 2 1 1 '2D 1H-1H NOESY' 1 isotropic 3 1 1 '2D 1H-15N HSQC' 1 isotropic 4 1 1 '2D 1H-13C HSQC' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.25 mM [1-40]Gga-AvBD11, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label unlabelled _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III HD' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details cryoprobe # _pdbx_nmr_refine.entry_id 6QES _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 6QES _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'total energies and restraint violation statistics' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6QES _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 2 'structure calculation' ARIA ? ;Linge, O'Donoghue and Nilges ; 3 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 4 'peak picking' 'CcpNmr Analysis' ? CCPN # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6QES _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6QES _struct.title '[1-40]Gga-AvBD11' _struct.pdbx_descriptor Gallinacin-11 _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6QES _struct_keywords.text 'new fold, double-beta-defensin, defensin, avian egg, ANTIMICROBIAL PROTEIN' _struct_keywords.pdbx_keywords 'ANTIMICROBIAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 4 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 10 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 4 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 10 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 8 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 8 A CYS 38 1_555 ? ? ? ? ? ? ? 2.152 ? disulf2 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 31 SG ? ? A CYS 15 A CYS 31 1_555 ? ? ? ? ? ? ? 2.184 ? disulf3 disulf ? ? A CYS 21 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 21 A CYS 39 1_555 ? ? ? ? ? ? ? 2.222 ? disulf4 disulf ? ? A CYS 31 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 31 A CYS 38 1_555 ? ? ? ? ? ? ? 2.544 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LYS 23 A . ? LYS 23 A PRO 24 A ? PRO 24 A 1 -1.67 2 LYS 23 A . ? LYS 23 A PRO 24 A ? PRO 24 A 2 -2.50 3 LYS 23 A . ? LYS 23 A PRO 24 A ? PRO 24 A 3 -6.03 4 LYS 23 A . ? LYS 23 A PRO 24 A ? PRO 24 A 4 -6.54 5 LYS 23 A . ? LYS 23 A PRO 24 A ? PRO 24 A 5 -4.96 6 LYS 23 A . ? LYS 23 A PRO 24 A ? PRO 24 A 6 -4.61 7 LYS 23 A . ? LYS 23 A PRO 24 A ? PRO 24 A 7 -3.83 8 LYS 23 A . ? LYS 23 A PRO 24 A ? PRO 24 A 8 -5.79 9 LYS 23 A . ? LYS 23 A PRO 24 A ? PRO 24 A 9 -3.99 10 LYS 23 A . ? LYS 23 A PRO 24 A ? PRO 24 A 10 -2.53 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 14 ? ILE A 16 ? TYR A 14 ILE A 16 AA1 2 THR A 37 ? VAL A 40 ? THR A 37 VAL A 40 AA1 3 ALA A 26 ? PHE A 28 ? ALA A 26 PHE A 28 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TYR A 14 ? N TYR A 14 O CYS A 39 ? O CYS A 39 AA1 2 3 O CYS A 38 ? O CYS A 38 N PHE A 28 ? N PHE A 28 # _atom_sites.entry_id 6QES _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 1 1 LEU LEU A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 TRP 33 33 33 TRP TRP A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 VAL 40 40 40 VAL VAL A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 2950 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-12-18 2 'Structure model' 1 1 2019-12-25 3 'Structure model' 1 2 2020-01-01 4 'Structure model' 1 3 2020-01-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' citation 5 4 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_DOI' 2 3 'Structure model' '_citation.pdbx_database_id_PubMed' 3 3 'Structure model' '_citation.title' 4 3 'Structure model' '_citation_author.identifier_ORCID' 5 4 'Structure model' '_citation.journal_volume' 6 4 'Structure model' '_citation.page_first' 7 4 'Structure model' '_citation.page_last' 8 4 'Structure model' '_citation.year' 9 4 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component '[1-40]Gga-AvBD11' _pdbx_nmr_exptl_sample.concentration 1.25 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling 'natural abundance' # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 7 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ARG _pdbx_validate_close_contact.auth_seq_id_1 17 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HG _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 SER _pdbx_validate_close_contact.auth_seq_id_2 18 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 2 ? ? -33.00 -83.03 2 1 ARG A 3 ? ? -161.31 -52.75 3 1 TYR A 11 ? ? -89.50 -117.73 4 1 SER A 18 ? ? 178.30 153.13 5 1 SER A 32 ? ? -21.89 107.09 6 1 TRP A 33 ? ? 61.30 -120.70 7 2 PRO A 2 ? ? -35.90 -81.88 8 2 ARG A 3 ? ? -161.05 -47.50 9 2 TYR A 11 ? ? -86.23 -117.75 10 2 SER A 18 ? ? 176.62 152.61 11 2 CYS A 31 ? ? -115.18 -157.98 12 2 SER A 32 ? ? -31.50 104.78 13 2 TRP A 33 ? ? 57.10 169.60 14 2 ARG A 34 ? ? -76.57 25.34 15 3 PRO A 2 ? ? -26.53 -81.55 16 3 ARG A 3 ? ? -161.92 -51.14 17 3 TYR A 11 ? ? -95.24 -125.74 18 3 SER A 18 ? ? 178.92 178.00 19 3 CYS A 31 ? ? -104.85 -157.60 20 3 SER A 32 ? ? -29.75 104.25 21 3 TRP A 33 ? ? 55.96 169.78 22 4 PRO A 2 ? ? -42.17 -79.56 23 4 ARG A 3 ? ? -160.49 -49.10 24 4 TYR A 11 ? ? -79.26 -106.88 25 4 SER A 18 ? ? 177.88 149.35 26 4 CYS A 31 ? ? -89.56 -158.03 27 4 SER A 32 ? ? -34.23 103.53 28 4 TRP A 33 ? ? 55.78 172.87 29 4 ARG A 34 ? ? -78.72 26.57 30 5 PRO A 2 ? ? -39.43 -78.21 31 5 ARG A 3 ? ? -161.66 -47.29 32 5 TYR A 11 ? ? -93.53 -116.92 33 5 SER A 18 ? ? 179.15 162.15 34 5 CYS A 31 ? ? -111.62 -158.37 35 5 SER A 32 ? ? -34.28 104.43 36 5 TRP A 33 ? ? 57.79 167.85 37 5 ARG A 34 ? ? -76.95 26.19 38 6 PRO A 2 ? ? -35.22 -81.80 39 6 ARG A 3 ? ? -162.78 -51.98 40 6 TYR A 11 ? ? -90.20 -116.90 41 6 HIS A 12 ? ? -160.34 106.52 42 6 SER A 18 ? ? 177.70 171.97 43 6 CYS A 31 ? ? -109.24 -158.13 44 6 SER A 32 ? ? -31.97 105.10 45 6 TRP A 33 ? ? 56.57 167.75 46 6 ARG A 34 ? ? -76.09 25.82 47 7 PRO A 2 ? ? -41.58 -78.55 48 7 ARG A 3 ? ? -161.30 -77.20 49 7 TYR A 11 ? ? -92.01 -120.64 50 7 CYS A 31 ? ? -110.72 -160.64 51 7 SER A 32 ? ? -20.78 108.06 52 7 TRP A 33 ? ? 61.85 -116.31 53 8 PRO A 2 ? ? -26.83 -82.90 54 8 ARG A 3 ? ? -161.44 -39.62 55 8 TYR A 11 ? ? -89.73 -120.61 56 8 CYS A 31 ? ? -117.53 -158.09 57 8 SER A 32 ? ? -32.02 104.51 58 8 TRP A 33 ? ? 56.19 172.66 59 8 ARG A 34 ? ? -78.36 26.16 60 9 PRO A 2 ? ? -39.62 -75.59 61 9 ARG A 3 ? ? -160.91 -80.18 62 9 TYR A 11 ? ? -99.00 -117.23 63 9 SER A 18 ? ? 177.83 165.97 64 9 CYS A 31 ? ? -111.33 -158.75 65 9 SER A 32 ? ? -33.03 104.77 66 9 TRP A 33 ? ? 58.57 167.94 67 9 ARG A 34 ? ? -76.33 26.04 68 10 PRO A 2 ? ? -28.87 -81.05 69 10 ARG A 3 ? ? -161.65 -53.99 70 10 TYR A 11 ? ? -91.02 -121.89 71 10 CYS A 31 ? ? -111.37 -157.20 72 10 SER A 32 ? ? -32.09 105.09 73 10 TRP A 33 ? ? 56.05 175.86 74 10 ARG A 34 ? ? -78.02 25.36 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #