data_6QET # _entry.id 6QET # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6QET pdb_00006qet 10.2210/pdb6qet/pdb WWPDB D_1292100017 ? ? BMRB 34349 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details '[41-82]Gga-AvBD11' _pdbx_database_related.db_id 34349 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6QET _pdbx_database_status.recvd_initial_deposition_date 2019-01-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Meudal, H.' 1 0000-0002-9642-3643 'Loth, K.' 2 0000-0001-7058-8661 'Delmas, A.F.' 3 0000-0002-8243-8887 'Landon, C.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 117 _citation.language ? _citation.page_first 337 _citation.page_last 345 _citation.title 'Structure, function, and evolution ofGga-AvBD11, the archetype of the structural avian-double-beta-defensin family.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1912941117 _citation.pdbx_database_id_PubMed 31871151 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Guyot, N.' 1 ? primary 'Meudal, H.' 2 0000-0002-9642-3643 primary 'Trapp, S.' 3 0000-0002-2735-0217 primary 'Iochmann, S.' 4 ? primary 'Silvestre, A.' 5 ? primary 'Jousset, G.' 6 ? primary 'Labas, V.' 7 ? primary 'Reverdiau, P.' 8 ? primary 'Loth, K.' 9 ? primary 'Herve, V.' 10 ? primary 'Aucagne, V.' 11 ? primary 'Delmas, A.F.' 12 ? primary 'Rehault-Godbert, S.' 13 ? primary 'Landon, C.' 14 0000-0002-0248-1990 # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description Gallinacin-11 _entity.formula_weight 4788.552 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Gal-11,Beta-defensin 11,Vitelline membrane outer layer protein 2,Vitelline membrane outer layer protein II,VMOII' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code DTTSDFHTCQDKGGHCVSPKIRCLEEQLGLCPLKRWTCCKEI _entity_poly.pdbx_seq_one_letter_code_can DTTSDFHTCQDKGGHCVSPKIRCLEEQLGLCPLKRWTCCKEI _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 THR n 1 3 THR n 1 4 SER n 1 5 ASP n 1 6 PHE n 1 7 HIS n 1 8 THR n 1 9 CYS n 1 10 GLN n 1 11 ASP n 1 12 LYS n 1 13 GLY n 1 14 GLY n 1 15 HIS n 1 16 CYS n 1 17 VAL n 1 18 SER n 1 19 PRO n 1 20 LYS n 1 21 ILE n 1 22 ARG n 1 23 CYS n 1 24 LEU n 1 25 GLU n 1 26 GLU n 1 27 GLN n 1 28 LEU n 1 29 GLY n 1 30 LEU n 1 31 CYS n 1 32 PRO n 1 33 LEU n 1 34 LYS n 1 35 ARG n 1 36 TRP n 1 37 THR n 1 38 CYS n 1 39 CYS n 1 40 LYS n 1 41 GLU n 1 42 ILE n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 42 _pdbx_entity_src_syn.organism_scientific 'Gallus gallus' _pdbx_entity_src_syn.organism_common_name Chicken _pdbx_entity_src_syn.ncbi_taxonomy_id 9031 _pdbx_entity_src_syn.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GLL11_CHICK _struct_ref.pdbx_db_accession Q6IV20 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DTTSDFHTCQDKGGHCVSPKIRCLEEQLGLCPLKRWTCCKEI _struct_ref.pdbx_align_begin 63 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6QET _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 42 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6IV20 _struct_ref_seq.db_align_beg 63 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 104 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 42 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H TOCSY' 1 isotropic 2 1 1 '2D 1H-1H NOESY' 1 isotropic 3 1 1 '2D 1H-15N HSQC' 1 isotropic 4 1 1 '2D 1H-13C HSQC' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.4 mM [41-82]Gga-AvBD11, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label unlabelled _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III HD' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details cryoprobe # _pdbx_nmr_refine.entry_id 6QET _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 6QET _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'total energies and restraint violation statistics' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6QET _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 2 'structure calculation' ARIA ? ;Linge, O'Donoghue and Nilges ; 3 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 4 'peak picking' 'CcpNmr Analysis' ? CCPN # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6QET _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6QET _struct.title '[41-82]Gga-AvBD11' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6QET _struct_keywords.text 'new fold, double-beta-defensin, defensin, avian egg, ANTIMICROBIAL PROTEIN' _struct_keywords.pdbx_keywords 'ANTIMICROBIAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 31 SG ? ? A CYS 9 A CYS 31 1_555 ? ? ? ? ? ? ? 2.218 ? ? disulf2 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 9 A CYS 38 1_555 ? ? ? ? ? ? ? 2.165 ? ? disulf3 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 31 SG ? ? A CYS 16 A CYS 31 1_555 ? ? ? ? ? ? ? 2.328 ? ? disulf4 disulf ? ? A CYS 23 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 23 A CYS 39 1_555 ? ? ? ? ? ? ? 2.174 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 HIS A 15 ? VAL A 17 ? HIS A 15 VAL A 17 AA1 2 THR A 37 ? LYS A 40 ? THR A 37 LYS A 40 AA1 3 GLU A 25 ? GLN A 27 ? GLU A 25 GLN A 27 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 17 ? N VAL A 17 O THR A 37 ? O THR A 37 AA1 2 3 O LYS A 40 ? O LYS A 40 N GLU A 25 ? N GLU A 25 # _atom_sites.entry_id 6QET _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 1 ASP ASP A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 HIS 15 15 15 HIS HIS A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 TRP 36 36 36 TRP TRP A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ILE 42 42 42 ILE ILE A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 3460 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-12-18 2 'Structure model' 1 1 2019-12-25 3 'Structure model' 1 2 2020-01-01 4 'Structure model' 1 3 2020-01-15 5 'Structure model' 1 4 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Database references' 5 5 'Structure model' 'Derived calculations' 6 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' citation 5 4 'Structure model' citation_author 6 5 'Structure model' database_2 7 5 'Structure model' pdbx_database_status 8 5 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_DOI' 2 3 'Structure model' '_citation.pdbx_database_id_PubMed' 3 3 'Structure model' '_citation.title' 4 3 'Structure model' '_citation_author.identifier_ORCID' 5 4 'Structure model' '_citation.journal_volume' 6 4 'Structure model' '_citation.page_first' 7 4 'Structure model' '_citation.page_last' 8 4 'Structure model' '_citation.year' 9 4 'Structure model' '_citation_author.identifier_ORCID' 10 5 'Structure model' '_database_2.pdbx_DOI' 11 5 'Structure model' '_database_2.pdbx_database_accession' 12 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 13 5 'Structure model' '_struct_conn.pdbx_dist_value' 14 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 15 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component '[41-82]Gga-AvBD11' _pdbx_nmr_exptl_sample.concentration 1.4 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling 'natural abundance' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 HZ3 A LYS 40 ? ? OE1 A GLU 41 ? ? 1.60 2 5 OD1 A ASP 11 ? ? HZ2 A LYS 12 ? ? 1.59 3 7 HZ1 A LYS 40 ? ? OE2 A GLU 41 ? ? 1.59 4 9 OD2 A ASP 11 ? ? HZ3 A LYS 12 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 6 ? ? -178.25 -174.37 2 1 ASP A 11 ? ? 160.60 -52.19 3 1 PRO A 19 ? ? -61.04 32.23 4 1 LYS A 20 ? ? -151.94 35.82 5 1 LEU A 33 ? ? -175.11 -96.78 6 1 LYS A 34 ? ? -136.10 -132.15 7 1 ARG A 35 ? ? -74.79 35.16 8 1 GLU A 41 ? ? 74.17 149.71 9 2 CYS A 9 ? ? -95.86 -70.65 10 2 ASP A 11 ? ? 160.65 -50.86 11 2 PRO A 19 ? ? -61.93 32.95 12 2 LEU A 33 ? ? -168.88 -97.77 13 2 LYS A 34 ? ? -120.44 -97.67 14 2 GLU A 41 ? ? 72.89 146.78 15 3 PHE A 6 ? ? -174.17 -178.70 16 3 THR A 8 ? ? -68.45 -173.28 17 3 CYS A 9 ? ? -93.73 -70.39 18 3 ASP A 11 ? ? 161.19 -54.76 19 3 PRO A 19 ? ? -62.94 32.33 20 3 LYS A 20 ? ? -146.09 15.29 21 3 LEU A 33 ? ? -167.83 -95.84 22 3 LYS A 34 ? ? -124.82 -93.96 23 3 GLU A 41 ? ? 72.72 140.15 24 4 PHE A 6 ? ? -178.94 -172.75 25 4 CYS A 9 ? ? -91.14 -67.98 26 4 ASP A 11 ? ? 161.56 -50.98 27 4 PRO A 19 ? ? -62.68 32.42 28 4 LEU A 33 ? ? -172.36 -95.52 29 4 LYS A 34 ? ? -137.51 -120.51 30 4 ARG A 35 ? ? -86.16 33.30 31 4 GLU A 41 ? ? 69.07 150.34 32 5 PHE A 6 ? ? -176.90 -173.37 33 5 THR A 8 ? ? -68.82 -174.14 34 5 CYS A 9 ? ? -93.35 -69.07 35 5 ASP A 11 ? ? 157.33 -49.33 36 5 PRO A 19 ? ? -61.86 31.95 37 5 LYS A 20 ? ? -146.11 16.37 38 5 LEU A 33 ? ? -174.25 -107.55 39 5 LYS A 34 ? ? -121.85 -129.49 40 5 ARG A 35 ? ? -76.87 34.30 41 5 GLU A 41 ? ? 70.25 152.10 42 6 THR A 3 ? ? -172.20 -177.96 43 6 SER A 4 ? ? -54.45 98.16 44 6 ASP A 5 ? ? -65.68 98.39 45 6 THR A 8 ? ? -69.95 -173.17 46 6 CYS A 9 ? ? -91.79 -64.66 47 6 ASP A 11 ? ? 163.90 -44.92 48 6 PRO A 19 ? ? -57.99 24.52 49 6 LYS A 20 ? ? -151.28 42.95 50 6 LEU A 33 ? ? -170.05 -102.18 51 6 LYS A 34 ? ? -118.71 -93.51 52 6 GLU A 41 ? ? 65.69 162.10 53 7 THR A 2 ? ? 73.91 -56.09 54 7 PHE A 6 ? ? -175.78 -171.42 55 7 CYS A 9 ? ? -91.35 -70.07 56 7 ASP A 11 ? ? 166.36 -44.87 57 7 PRO A 19 ? ? -61.77 34.18 58 7 LEU A 33 ? ? -174.81 -99.74 59 7 LYS A 34 ? ? -128.72 -120.87 60 7 ARG A 35 ? ? -79.82 31.88 61 7 GLU A 41 ? ? 71.05 154.34 62 8 PHE A 6 ? ? -173.47 -169.75 63 8 CYS A 9 ? ? -90.31 -66.42 64 8 ASP A 11 ? ? 162.05 -50.72 65 8 PRO A 19 ? ? -62.00 30.21 66 8 LYS A 20 ? ? -145.03 12.30 67 8 LEU A 33 ? ? -171.25 -101.26 68 8 LYS A 34 ? ? -129.68 -119.05 69 8 ARG A 35 ? ? -83.24 32.28 70 8 GLU A 41 ? ? 68.42 147.05 71 9 PHE A 6 ? ? -178.96 -173.55 72 9 THR A 8 ? ? -68.95 -174.12 73 9 CYS A 9 ? ? -93.41 -70.73 74 9 ASP A 11 ? ? 158.20 -51.15 75 9 LYS A 20 ? ? -95.21 44.84 76 9 LEU A 33 ? ? -179.77 -151.74 77 9 LYS A 34 ? ? -77.78 -128.13 78 9 ARG A 35 ? ? -80.92 35.41 79 9 GLU A 41 ? ? 70.74 159.40 80 10 CYS A 9 ? ? -92.13 -69.75 81 10 ASP A 11 ? ? 161.64 -51.14 82 10 PRO A 19 ? ? -63.19 35.38 83 10 LYS A 20 ? ? -142.48 -0.29 84 10 LEU A 33 ? ? -172.41 -89.58 85 10 LYS A 34 ? ? -137.73 -86.37 86 10 GLU A 41 ? ? 66.01 159.38 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #