data_6QFT # _entry.id 6QFT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6QFT pdb_00006qft 10.2210/pdb6qft/pdb WWPDB D_1292100011 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-05-22 2 'Structure model' 1 1 2019-05-29 3 'Structure model' 1 2 2019-06-12 4 'Structure model' 1 3 2019-06-26 5 'Structure model' 1 4 2024-01-24 6 'Structure model' 1 5 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' 9 5 'Structure model' 'Refinement description' 10 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' pdbx_database_proc 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 3 'Structure model' pdbx_database_proc 6 4 'Structure model' citation 7 4 'Structure model' citation_author 8 4 'Structure model' pdbx_database_proc 9 5 'Structure model' chem_comp_atom 10 5 'Structure model' chem_comp_bond 11 5 'Structure model' database_2 12 5 'Structure model' pdbx_initial_refinement_model 13 6 'Structure model' pdbx_entry_details 14 6 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.title' 11 3 'Structure model' '_citation_author.identifier_ORCID' 12 4 'Structure model' '_citation.journal_volume' 13 4 'Structure model' '_citation.page_first' 14 4 'Structure model' '_citation.page_last' 15 4 'Structure model' '_citation_author.identifier_ORCID' 16 5 'Structure model' '_database_2.pdbx_DOI' 17 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6QFT _pdbx_database_status.recvd_initial_deposition_date 2019-01-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 6QFL unspecified PDB . 6QFR unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wolle, P.' 1 0000-0001-6309-6773 'Mueller, M.P.' 2 0000-0002-1529-8933 'Rauh, D.' 3 0000-0002-1970-7642 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 62 _citation.language ? _citation.page_first 5541 _citation.page_last 5546 _citation.title ;Characterization of Covalent Pyrazolopyrimidine-MKK7 Complexes and a Report on a Unique DFG-in/Leu-in Conformation of Mitogen-Activated Protein Kinase Kinase 7 (MKK7). ; _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.9b00472 _citation.pdbx_database_id_PubMed 31083997 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wolle, P.' 1 ? primary 'Engel, J.' 2 ? primary 'Smith, S.' 3 ? primary 'Goebel, L.' 4 ? primary 'Hennes, E.' 5 ? primary 'Lategahn, J.' 6 ? primary 'Rauh, D.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Dual specificity mitogen-activated protein kinase kinase 7' 36146.859 1 2.7.12.2 ? ? ? 2 non-polymer syn '1-[(3~{R})-3-(4-azanyl-3-iodanyl-pyrazolo[3,4-d]pyrimidin-1-yl)piperidin-1-yl]propan-1-one' 400.218 1 ? ? ? ? 3 water nat water 18.015 34 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;MAPKK 7,JNK-activating kinase 2,MAPK/ERK kinase 7,MEK 7,Stress-activated protein kinase kinase 4,SAPKK4,c-Jun N-terminal kinase kinase 2,JNKK 2 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGHHHHHHSAKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVV LKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNIL LDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFE VLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSG ; _entity_poly.pdbx_seq_one_letter_code_can ;MGHHHHHHSAKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVV LKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNIL LDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFE VLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '1-[(3~{R})-3-(4-azanyl-3-iodanyl-pyrazolo[3,4-d]pyrimidin-1-yl)piperidin-1-yl]propan-1-one' J0B 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 SER n 1 10 ALA n 1 11 LYS n 1 12 GLN n 1 13 THR n 1 14 GLY n 1 15 TYR n 1 16 LEU n 1 17 THR n 1 18 ILE n 1 19 GLY n 1 20 GLY n 1 21 GLN n 1 22 ARG n 1 23 TYR n 1 24 GLN n 1 25 ALA n 1 26 GLU n 1 27 ILE n 1 28 ASN n 1 29 ASP n 1 30 LEU n 1 31 GLU n 1 32 ASN n 1 33 LEU n 1 34 GLY n 1 35 GLU n 1 36 MET n 1 37 GLY n 1 38 SER n 1 39 GLY n 1 40 THR n 1 41 CYS n 1 42 GLY n 1 43 GLN n 1 44 VAL n 1 45 TRP n 1 46 LYS n 1 47 MET n 1 48 ARG n 1 49 PHE n 1 50 ARG n 1 51 LYS n 1 52 THR n 1 53 GLY n 1 54 HIS n 1 55 VAL n 1 56 ILE n 1 57 ALA n 1 58 VAL n 1 59 LYS n 1 60 GLN n 1 61 MET n 1 62 ARG n 1 63 ARG n 1 64 SER n 1 65 GLY n 1 66 ASN n 1 67 LYS n 1 68 GLU n 1 69 GLU n 1 70 ASN n 1 71 LYS n 1 72 ARG n 1 73 ILE n 1 74 LEU n 1 75 MET n 1 76 ASP n 1 77 LEU n 1 78 ASP n 1 79 VAL n 1 80 VAL n 1 81 LEU n 1 82 LYS n 1 83 SER n 1 84 HIS n 1 85 ASP n 1 86 CYS n 1 87 PRO n 1 88 TYR n 1 89 ILE n 1 90 VAL n 1 91 GLN n 1 92 CYS n 1 93 PHE n 1 94 GLY n 1 95 THR n 1 96 PHE n 1 97 ILE n 1 98 THR n 1 99 ASN n 1 100 THR n 1 101 ASP n 1 102 VAL n 1 103 PHE n 1 104 ILE n 1 105 ALA n 1 106 MET n 1 107 GLU n 1 108 LEU n 1 109 MET n 1 110 GLY n 1 111 THR n 1 112 CYS n 1 113 ALA n 1 114 GLU n 1 115 LYS n 1 116 LEU n 1 117 LYS n 1 118 LYS n 1 119 ARG n 1 120 MET n 1 121 GLN n 1 122 GLY n 1 123 PRO n 1 124 ILE n 1 125 PRO n 1 126 GLU n 1 127 ARG n 1 128 ILE n 1 129 LEU n 1 130 GLY n 1 131 LYS n 1 132 MET n 1 133 THR n 1 134 VAL n 1 135 ALA n 1 136 ILE n 1 137 VAL n 1 138 LYS n 1 139 ALA n 1 140 LEU n 1 141 TYR n 1 142 TYR n 1 143 LEU n 1 144 LYS n 1 145 GLU n 1 146 LYS n 1 147 HIS n 1 148 GLY n 1 149 VAL n 1 150 ILE n 1 151 HIS n 1 152 ARG n 1 153 ASP n 1 154 VAL n 1 155 LYS n 1 156 PRO n 1 157 SER n 1 158 ASN n 1 159 ILE n 1 160 LEU n 1 161 LEU n 1 162 ASP n 1 163 GLU n 1 164 ARG n 1 165 GLY n 1 166 GLN n 1 167 ILE n 1 168 LYS n 1 169 LEU n 1 170 CYS n 1 171 ASP n 1 172 PHE n 1 173 GLY n 1 174 ILE n 1 175 SER n 1 176 GLY n 1 177 ARG n 1 178 LEU n 1 179 VAL n 1 180 ASP n 1 181 SER n 1 182 LYS n 1 183 ALA n 1 184 LYS n 1 185 THR n 1 186 ARG n 1 187 SER n 1 188 ALA n 1 189 GLY n 1 190 CYS n 1 191 ALA n 1 192 ALA n 1 193 TYR n 1 194 MET n 1 195 ALA n 1 196 PRO n 1 197 GLU n 1 198 ARG n 1 199 ILE n 1 200 ASP n 1 201 PRO n 1 202 PRO n 1 203 ASP n 1 204 PRO n 1 205 THR n 1 206 LYS n 1 207 PRO n 1 208 ASP n 1 209 TYR n 1 210 ASP n 1 211 ILE n 1 212 ARG n 1 213 ALA n 1 214 ASP n 1 215 VAL n 1 216 TRP n 1 217 SER n 1 218 LEU n 1 219 GLY n 1 220 ILE n 1 221 SER n 1 222 LEU n 1 223 VAL n 1 224 GLU n 1 225 LEU n 1 226 ALA n 1 227 THR n 1 228 GLY n 1 229 GLN n 1 230 PHE n 1 231 PRO n 1 232 TYR n 1 233 LYS n 1 234 ASN n 1 235 CYS n 1 236 LYS n 1 237 THR n 1 238 ASP n 1 239 PHE n 1 240 GLU n 1 241 VAL n 1 242 LEU n 1 243 THR n 1 244 LYS n 1 245 VAL n 1 246 LEU n 1 247 GLN n 1 248 GLU n 1 249 GLU n 1 250 PRO n 1 251 PRO n 1 252 LEU n 1 253 LEU n 1 254 PRO n 1 255 GLY n 1 256 HIS n 1 257 MET n 1 258 GLY n 1 259 PHE n 1 260 SER n 1 261 GLY n 1 262 ASP n 1 263 PHE n 1 264 GLN n 1 265 SER n 1 266 PHE n 1 267 VAL n 1 268 LYS n 1 269 ASP n 1 270 CYS n 1 271 LEU n 1 272 THR n 1 273 LYS n 1 274 ASP n 1 275 HIS n 1 276 ARG n 1 277 LYS n 1 278 ARG n 1 279 PRO n 1 280 LYS n 1 281 TYR n 1 282 ASN n 1 283 LYS n 1 284 LEU n 1 285 LEU n 1 286 GLU n 1 287 HIS n 1 288 SER n 1 289 PHE n 1 290 ILE n 1 291 LYS n 1 292 ARG n 1 293 TYR n 1 294 GLU n 1 295 THR n 1 296 LEU n 1 297 GLU n 1 298 VAL n 1 299 ASP n 1 300 VAL n 1 301 ALA n 1 302 SER n 1 303 TRP n 1 304 PHE n 1 305 LYS n 1 306 ASP n 1 307 VAL n 1 308 MET n 1 309 ALA n 1 310 LYS n 1 311 THR n 1 312 GLU n 1 313 SER n 1 314 PRO n 1 315 ARG n 1 316 THR n 1 317 SER n 1 318 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 318 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MAP2K7, JNKK2, MEK7, MKK7, PRKMK7, SKK4' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 J0B non-polymer . '1-[(3~{R})-3-(4-azanyl-3-iodanyl-pyrazolo[3,4-d]pyrimidin-1-yl)piperidin-1-yl]propan-1-one' ? 'C13 H17 I N6 O' 400.218 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 107 ? ? ? A . n A 1 2 GLY 2 108 ? ? ? A . n A 1 3 HIS 3 109 ? ? ? A . n A 1 4 HIS 4 110 ? ? ? A . n A 1 5 HIS 5 111 ? ? ? A . n A 1 6 HIS 6 112 ? ? ? A . n A 1 7 HIS 7 113 ? ? ? A . n A 1 8 HIS 8 114 ? ? ? A . n A 1 9 SER 9 115 ? ? ? A . n A 1 10 ALA 10 116 ? ? ? A . n A 1 11 LYS 11 117 ? ? ? A . n A 1 12 GLN 12 118 118 GLN GLN A . n A 1 13 THR 13 119 119 THR THR A . n A 1 14 GLY 14 120 120 GLY GLY A . n A 1 15 TYR 15 121 121 TYR TYR A . n A 1 16 LEU 16 122 122 LEU LEU A . n A 1 17 THR 17 123 123 THR THR A . n A 1 18 ILE 18 124 124 ILE ILE A . n A 1 19 GLY 19 125 ? ? ? A . n A 1 20 GLY 20 126 126 GLY GLY A . n A 1 21 GLN 21 127 127 GLN GLN A . n A 1 22 ARG 22 128 128 ARG ARG A . n A 1 23 TYR 23 129 129 TYR TYR A . n A 1 24 GLN 24 130 130 GLN GLN A . n A 1 25 ALA 25 131 131 ALA ALA A . n A 1 26 GLU 26 132 132 GLU GLU A . n A 1 27 ILE 27 133 133 ILE ILE A . n A 1 28 ASN 28 134 134 ASN ASN A . n A 1 29 ASP 29 135 135 ASP ASP A . n A 1 30 LEU 30 136 136 LEU LEU A . n A 1 31 GLU 31 137 137 GLU GLU A . n A 1 32 ASN 32 138 138 ASN ASN A . n A 1 33 LEU 33 139 139 LEU LEU A . n A 1 34 GLY 34 140 140 GLY GLY A . n A 1 35 GLU 35 141 141 GLU GLU A . n A 1 36 MET 36 142 142 MET MET A . n A 1 37 GLY 37 143 143 GLY GLY A . n A 1 38 SER 38 144 144 SER SER A . n A 1 39 GLY 39 145 145 GLY GLY A . n A 1 40 THR 40 146 146 THR THR A . n A 1 41 CYS 41 147 147 CYS CYS A . n A 1 42 GLY 42 148 148 GLY GLY A . n A 1 43 GLN 43 149 149 GLN GLN A . n A 1 44 VAL 44 150 150 VAL VAL A . n A 1 45 TRP 45 151 151 TRP TRP A . n A 1 46 LYS 46 152 152 LYS LYS A . n A 1 47 MET 47 153 153 MET MET A . n A 1 48 ARG 48 154 154 ARG ARG A . n A 1 49 PHE 49 155 155 PHE PHE A . n A 1 50 ARG 50 156 156 ARG ARG A . n A 1 51 LYS 51 157 157 LYS LYS A . n A 1 52 THR 52 158 158 THR THR A . n A 1 53 GLY 53 159 159 GLY GLY A . n A 1 54 HIS 54 160 160 HIS HIS A . n A 1 55 VAL 55 161 161 VAL VAL A . n A 1 56 ILE 56 162 162 ILE ILE A . n A 1 57 ALA 57 163 163 ALA ALA A . n A 1 58 VAL 58 164 164 VAL VAL A . n A 1 59 LYS 59 165 165 LYS LYS A . n A 1 60 GLN 60 166 166 GLN GLN A . n A 1 61 MET 61 167 167 MET MET A . n A 1 62 ARG 62 168 168 ARG ARG A . n A 1 63 ARG 63 169 169 ARG ARG A . n A 1 64 SER 64 170 170 SER SER A . n A 1 65 GLY 65 171 171 GLY GLY A . n A 1 66 ASN 66 172 172 ASN ASN A . n A 1 67 LYS 67 173 173 LYS LYS A . n A 1 68 GLU 68 174 174 GLU GLU A . n A 1 69 GLU 69 175 175 GLU GLU A . n A 1 70 ASN 70 176 176 ASN ASN A . n A 1 71 LYS 71 177 177 LYS LYS A . n A 1 72 ARG 72 178 178 ARG ARG A . n A 1 73 ILE 73 179 179 ILE ILE A . n A 1 74 LEU 74 180 180 LEU LEU A . n A 1 75 MET 75 181 181 MET MET A . n A 1 76 ASP 76 182 182 ASP ASP A . n A 1 77 LEU 77 183 183 LEU LEU A . n A 1 78 ASP 78 184 184 ASP ASP A . n A 1 79 VAL 79 185 185 VAL VAL A . n A 1 80 VAL 80 186 186 VAL VAL A . n A 1 81 LEU 81 187 187 LEU LEU A . n A 1 82 LYS 82 188 188 LYS LYS A . n A 1 83 SER 83 189 189 SER SER A . n A 1 84 HIS 84 190 190 HIS HIS A . n A 1 85 ASP 85 191 191 ASP ASP A . n A 1 86 CYS 86 192 192 CYS CYS A . n A 1 87 PRO 87 193 193 PRO PRO A . n A 1 88 TYR 88 194 194 TYR TYR A . n A 1 89 ILE 89 195 195 ILE ILE A . n A 1 90 VAL 90 196 196 VAL VAL A . n A 1 91 GLN 91 197 197 GLN GLN A . n A 1 92 CYS 92 198 198 CYS CYS A . n A 1 93 PHE 93 199 199 PHE PHE A . n A 1 94 GLY 94 200 200 GLY GLY A . n A 1 95 THR 95 201 201 THR THR A . n A 1 96 PHE 96 202 202 PHE PHE A . n A 1 97 ILE 97 203 203 ILE ILE A . n A 1 98 THR 98 204 204 THR THR A . n A 1 99 ASN 99 205 205 ASN ASN A . n A 1 100 THR 100 206 206 THR THR A . n A 1 101 ASP 101 207 207 ASP ASP A . n A 1 102 VAL 102 208 208 VAL VAL A . n A 1 103 PHE 103 209 209 PHE PHE A . n A 1 104 ILE 104 210 210 ILE ILE A . n A 1 105 ALA 105 211 211 ALA ALA A . n A 1 106 MET 106 212 212 MET MET A . n A 1 107 GLU 107 213 213 GLU GLU A . n A 1 108 LEU 108 214 214 LEU LEU A . n A 1 109 MET 109 215 215 MET MET A . n A 1 110 GLY 110 216 216 GLY GLY A . n A 1 111 THR 111 217 217 THR THR A . n A 1 112 CYS 112 218 218 CYS CYS A . n A 1 113 ALA 113 219 219 ALA ALA A . n A 1 114 GLU 114 220 220 GLU GLU A . n A 1 115 LYS 115 221 221 LYS LYS A . n A 1 116 LEU 116 222 222 LEU LEU A . n A 1 117 LYS 117 223 223 LYS LYS A . n A 1 118 LYS 118 224 224 LYS LYS A . n A 1 119 ARG 119 225 225 ARG ARG A . n A 1 120 MET 120 226 226 MET MET A . n A 1 121 GLN 121 227 227 GLN GLN A . n A 1 122 GLY 122 228 228 GLY GLY A . n A 1 123 PRO 123 229 229 PRO PRO A . n A 1 124 ILE 124 230 230 ILE ILE A . n A 1 125 PRO 125 231 231 PRO PRO A . n A 1 126 GLU 126 232 232 GLU GLU A . n A 1 127 ARG 127 233 233 ARG ARG A . n A 1 128 ILE 128 234 234 ILE ILE A . n A 1 129 LEU 129 235 235 LEU LEU A . n A 1 130 GLY 130 236 236 GLY GLY A . n A 1 131 LYS 131 237 237 LYS LYS A . n A 1 132 MET 132 238 238 MET MET A . n A 1 133 THR 133 239 239 THR THR A . n A 1 134 VAL 134 240 240 VAL VAL A . n A 1 135 ALA 135 241 241 ALA ALA A . n A 1 136 ILE 136 242 242 ILE ILE A . n A 1 137 VAL 137 243 243 VAL VAL A . n A 1 138 LYS 138 244 244 LYS LYS A . n A 1 139 ALA 139 245 245 ALA ALA A . n A 1 140 LEU 140 246 246 LEU LEU A . n A 1 141 TYR 141 247 247 TYR TYR A . n A 1 142 TYR 142 248 248 TYR TYR A . n A 1 143 LEU 143 249 249 LEU LEU A . n A 1 144 LYS 144 250 250 LYS LYS A . n A 1 145 GLU 145 251 251 GLU GLU A . n A 1 146 LYS 146 252 252 LYS LYS A . n A 1 147 HIS 147 253 253 HIS HIS A . n A 1 148 GLY 148 254 254 GLY GLY A . n A 1 149 VAL 149 255 255 VAL VAL A . n A 1 150 ILE 150 256 256 ILE ILE A . n A 1 151 HIS 151 257 257 HIS HIS A . n A 1 152 ARG 152 258 258 ARG ARG A . n A 1 153 ASP 153 259 259 ASP ASP A . n A 1 154 VAL 154 260 260 VAL VAL A . n A 1 155 LYS 155 261 261 LYS LYS A . n A 1 156 PRO 156 262 262 PRO PRO A . n A 1 157 SER 157 263 263 SER SER A . n A 1 158 ASN 158 264 264 ASN ASN A . n A 1 159 ILE 159 265 265 ILE ILE A . n A 1 160 LEU 160 266 266 LEU LEU A . n A 1 161 LEU 161 267 267 LEU LEU A . n A 1 162 ASP 162 268 268 ASP ASP A . n A 1 163 GLU 163 269 269 GLU GLU A . n A 1 164 ARG 164 270 270 ARG ARG A . n A 1 165 GLY 165 271 271 GLY GLY A . n A 1 166 GLN 166 272 272 GLN GLN A . n A 1 167 ILE 167 273 273 ILE ILE A . n A 1 168 LYS 168 274 274 LYS LYS A . n A 1 169 LEU 169 275 275 LEU LEU A . n A 1 170 CYS 170 276 276 CYS CYS A . n A 1 171 ASP 171 277 277 ASP ASP A . n A 1 172 PHE 172 278 278 PHE PHE A . n A 1 173 GLY 173 279 279 GLY GLY A . n A 1 174 ILE 174 280 280 ILE ILE A . n A 1 175 SER 175 281 281 SER SER A . n A 1 176 GLY 176 282 282 GLY GLY A . n A 1 177 ARG 177 283 283 ARG ALA A . n A 1 178 LEU 178 284 ? ? ? A . n A 1 179 VAL 179 285 ? ? ? A . n A 1 180 ASP 180 286 ? ? ? A . n A 1 181 SER 181 287 ? ? ? A . n A 1 182 LYS 182 288 ? ? ? A . n A 1 183 ALA 183 289 ? ? ? A . n A 1 184 LYS 184 290 ? ? ? A . n A 1 185 THR 185 291 ? ? ? A . n A 1 186 ARG 186 292 ? ? ? A . n A 1 187 SER 187 293 ? ? ? A . n A 1 188 ALA 188 294 ? ? ? A . n A 1 189 GLY 189 295 ? ? ? A . n A 1 190 CYS 190 296 296 CYS CYS A . n A 1 191 ALA 191 297 297 ALA ALA A . n A 1 192 ALA 192 298 298 ALA ALA A . n A 1 193 TYR 193 299 299 TYR TYR A . n A 1 194 MET 194 300 300 MET MET A . n A 1 195 ALA 195 301 301 ALA ALA A . n A 1 196 PRO 196 302 302 PRO PRO A . n A 1 197 GLU 197 303 303 GLU GLU A . n A 1 198 ARG 198 304 304 ARG ARG A . n A 1 199 ILE 199 305 305 ILE ILE A . n A 1 200 ASP 200 306 306 ASP ASP A . n A 1 201 PRO 201 307 307 PRO PRO A . n A 1 202 PRO 202 308 ? ? ? A . n A 1 203 ASP 203 309 ? ? ? A . n A 1 204 PRO 204 310 ? ? ? A . n A 1 205 THR 205 311 ? ? ? A . n A 1 206 LYS 206 312 ? ? ? A . n A 1 207 PRO 207 313 ? ? ? A . n A 1 208 ASP 208 314 ? ? ? A . n A 1 209 TYR 209 315 ? ? ? A . n A 1 210 ASP 210 316 ? ? ? A . n A 1 211 ILE 211 317 ? ? ? A . n A 1 212 ARG 212 318 318 ARG ARG A . n A 1 213 ALA 213 319 319 ALA ALA A . n A 1 214 ASP 214 320 320 ASP ASP A . n A 1 215 VAL 215 321 321 VAL VAL A . n A 1 216 TRP 216 322 322 TRP TRP A . n A 1 217 SER 217 323 323 SER SER A . n A 1 218 LEU 218 324 324 LEU LEU A . n A 1 219 GLY 219 325 325 GLY GLY A . n A 1 220 ILE 220 326 326 ILE ILE A . n A 1 221 SER 221 327 327 SER SER A . n A 1 222 LEU 222 328 328 LEU LEU A . n A 1 223 VAL 223 329 329 VAL VAL A . n A 1 224 GLU 224 330 330 GLU GLU A . n A 1 225 LEU 225 331 331 LEU LEU A . n A 1 226 ALA 226 332 332 ALA ALA A . n A 1 227 THR 227 333 333 THR THR A . n A 1 228 GLY 228 334 334 GLY GLY A . n A 1 229 GLN 229 335 335 GLN GLN A . n A 1 230 PHE 230 336 336 PHE PHE A . n A 1 231 PRO 231 337 337 PRO PRO A . n A 1 232 TYR 232 338 338 TYR TYR A . n A 1 233 LYS 233 339 339 LYS LYS A . n A 1 234 ASN 234 340 340 ASN ASN A . n A 1 235 CYS 235 341 341 CYS CYS A . n A 1 236 LYS 236 342 342 LYS LYS A . n A 1 237 THR 237 343 343 THR THR A . n A 1 238 ASP 238 344 344 ASP ASP A . n A 1 239 PHE 239 345 345 PHE PHE A . n A 1 240 GLU 240 346 346 GLU GLU A . n A 1 241 VAL 241 347 347 VAL VAL A . n A 1 242 LEU 242 348 348 LEU LEU A . n A 1 243 THR 243 349 349 THR THR A . n A 1 244 LYS 244 350 350 LYS LYS A . n A 1 245 VAL 245 351 351 VAL VAL A . n A 1 246 LEU 246 352 352 LEU LEU A . n A 1 247 GLN 247 353 353 GLN GLN A . n A 1 248 GLU 248 354 354 GLU GLU A . n A 1 249 GLU 249 355 355 GLU GLU A . n A 1 250 PRO 250 356 356 PRO PRO A . n A 1 251 PRO 251 357 357 PRO PRO A . n A 1 252 LEU 252 358 358 LEU LEU A . n A 1 253 LEU 253 359 359 LEU LEU A . n A 1 254 PRO 254 360 360 PRO PRO A . n A 1 255 GLY 255 361 361 GLY GLY A . n A 1 256 HIS 256 362 362 HIS HIS A . n A 1 257 MET 257 363 363 MET MET A . n A 1 258 GLY 258 364 364 GLY GLY A . n A 1 259 PHE 259 365 365 PHE PHE A . n A 1 260 SER 260 366 366 SER SER A . n A 1 261 GLY 261 367 367 GLY GLY A . n A 1 262 ASP 262 368 368 ASP ASP A . n A 1 263 PHE 263 369 369 PHE PHE A . n A 1 264 GLN 264 370 370 GLN GLN A . n A 1 265 SER 265 371 371 SER SER A . n A 1 266 PHE 266 372 372 PHE PHE A . n A 1 267 VAL 267 373 373 VAL VAL A . n A 1 268 LYS 268 374 374 LYS LYS A . n A 1 269 ASP 269 375 375 ASP ASP A . n A 1 270 CYS 270 376 376 CYS CYS A . n A 1 271 LEU 271 377 377 LEU LEU A . n A 1 272 THR 272 378 378 THR THR A . n A 1 273 LYS 273 379 379 LYS LYS A . n A 1 274 ASP 274 380 380 ASP ASP A . n A 1 275 HIS 275 381 381 HIS HIS A . n A 1 276 ARG 276 382 382 ARG ARG A . n A 1 277 LYS 277 383 383 LYS LYS A . n A 1 278 ARG 278 384 384 ARG ARG A . n A 1 279 PRO 279 385 385 PRO PRO A . n A 1 280 LYS 280 386 386 LYS LYS A . n A 1 281 TYR 281 387 387 TYR TYR A . n A 1 282 ASN 282 388 388 ASN ASN A . n A 1 283 LYS 283 389 389 LYS LYS A . n A 1 284 LEU 284 390 390 LEU LEU A . n A 1 285 LEU 285 391 391 LEU LEU A . n A 1 286 GLU 286 392 392 GLU GLU A . n A 1 287 HIS 287 393 393 HIS HIS A . n A 1 288 SER 288 394 394 SER SER A . n A 1 289 PHE 289 395 395 PHE PHE A . n A 1 290 ILE 290 396 396 ILE ILE A . n A 1 291 LYS 291 397 397 LYS LYS A . n A 1 292 ARG 292 398 398 ARG ARG A . n A 1 293 TYR 293 399 399 TYR TYR A . n A 1 294 GLU 294 400 400 GLU GLU A . n A 1 295 THR 295 401 401 THR THR A . n A 1 296 LEU 296 402 402 LEU LEU A . n A 1 297 GLU 297 403 403 GLU GLU A . n A 1 298 VAL 298 404 404 VAL VAL A . n A 1 299 ASP 299 405 405 ASP ASP A . n A 1 300 VAL 300 406 406 VAL VAL A . n A 1 301 ALA 301 407 407 ALA ALA A . n A 1 302 SER 302 408 408 SER SER A . n A 1 303 TRP 303 409 409 TRP TRP A . n A 1 304 PHE 304 410 410 PHE PHE A . n A 1 305 LYS 305 411 411 LYS LYS A . n A 1 306 ASP 306 412 412 ASP ASP A . n A 1 307 VAL 307 413 413 VAL VAL A . n A 1 308 MET 308 414 414 MET MET A . n A 1 309 ALA 309 415 415 ALA ALA A . n A 1 310 LYS 310 416 416 LYS LYS A . n A 1 311 THR 311 417 ? ? ? A . n A 1 312 GLU 312 418 ? ? ? A . n A 1 313 SER 313 419 ? ? ? A . n A 1 314 PRO 314 420 ? ? ? A . n A 1 315 ARG 315 421 ? ? ? A . n A 1 316 THR 316 422 ? ? ? A . n A 1 317 SER 317 423 ? ? ? A . n A 1 318 GLY 318 424 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 J0B 1 501 1 J0B 084 A . C 3 HOH 1 601 25 HOH HOH A . C 3 HOH 2 602 33 HOH HOH A . C 3 HOH 3 603 26 HOH HOH A . C 3 HOH 4 604 6 HOH HOH A . C 3 HOH 5 605 24 HOH HOH A . C 3 HOH 6 606 7 HOH HOH A . C 3 HOH 7 607 15 HOH HOH A . C 3 HOH 8 608 34 HOH HOH A . C 3 HOH 9 609 30 HOH HOH A . C 3 HOH 10 610 9 HOH HOH A . C 3 HOH 11 611 32 HOH HOH A . C 3 HOH 12 612 10 HOH HOH A . C 3 HOH 13 613 17 HOH HOH A . C 3 HOH 14 614 8 HOH HOH A . C 3 HOH 15 615 5 HOH HOH A . C 3 HOH 16 616 12 HOH HOH A . C 3 HOH 17 617 11 HOH HOH A . C 3 HOH 18 618 13 HOH HOH A . C 3 HOH 19 619 1 HOH HOH A . C 3 HOH 20 620 4 HOH HOH A . C 3 HOH 21 621 31 HOH HOH A . C 3 HOH 22 622 16 HOH HOH A . C 3 HOH 23 623 2 HOH HOH A . C 3 HOH 24 624 29 HOH HOH A . C 3 HOH 25 625 14 HOH HOH A . C 3 HOH 26 626 23 HOH HOH A . C 3 HOH 27 627 21 HOH HOH A . C 3 HOH 28 628 27 HOH HOH A . C 3 HOH 29 629 20 HOH HOH A . C 3 HOH 30 630 19 HOH HOH A . C 3 HOH 31 631 18 HOH HOH A . C 3 HOH 32 632 35 HOH HOH A . C 3 HOH 33 633 3 HOH HOH A . C 3 HOH 34 634 22 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 118 ? CG ? A GLN 12 CG 2 1 Y 1 A GLN 118 ? CD ? A GLN 12 CD 3 1 Y 1 A GLN 118 ? OE1 ? A GLN 12 OE1 4 1 Y 1 A GLN 118 ? NE2 ? A GLN 12 NE2 5 1 Y 1 A GLN 127 ? CG ? A GLN 21 CG 6 1 Y 1 A GLN 127 ? CD ? A GLN 21 CD 7 1 Y 1 A GLN 127 ? OE1 ? A GLN 21 OE1 8 1 Y 1 A GLN 127 ? NE2 ? A GLN 21 NE2 9 1 Y 1 A ARG 128 ? CG ? A ARG 22 CG 10 1 Y 1 A ARG 128 ? CD ? A ARG 22 CD 11 1 Y 1 A ARG 128 ? NE ? A ARG 22 NE 12 1 Y 1 A ARG 128 ? CZ ? A ARG 22 CZ 13 1 Y 1 A ARG 128 ? NH1 ? A ARG 22 NH1 14 1 Y 1 A ARG 128 ? NH2 ? A ARG 22 NH2 15 1 Y 1 A GLN 130 ? CG ? A GLN 24 CG 16 1 Y 1 A GLN 130 ? CD ? A GLN 24 CD 17 1 Y 1 A GLN 130 ? OE1 ? A GLN 24 OE1 18 1 Y 1 A GLN 130 ? NE2 ? A GLN 24 NE2 19 1 Y 1 A GLU 132 ? CG ? A GLU 26 CG 20 1 Y 1 A GLU 132 ? CD ? A GLU 26 CD 21 1 Y 1 A GLU 132 ? OE1 ? A GLU 26 OE1 22 1 Y 1 A GLU 132 ? OE2 ? A GLU 26 OE2 23 1 Y 1 A LYS 157 ? CG ? A LYS 51 CG 24 1 Y 1 A LYS 157 ? CD ? A LYS 51 CD 25 1 Y 1 A LYS 157 ? CE ? A LYS 51 CE 26 1 Y 1 A LYS 157 ? NZ ? A LYS 51 NZ 27 1 Y 1 A LYS 173 ? CG ? A LYS 67 CG 28 1 Y 1 A LYS 173 ? CD ? A LYS 67 CD 29 1 Y 1 A LYS 173 ? CE ? A LYS 67 CE 30 1 Y 1 A LYS 173 ? NZ ? A LYS 67 NZ 31 1 Y 1 A LYS 177 ? CG ? A LYS 71 CG 32 1 Y 1 A LYS 177 ? CD ? A LYS 71 CD 33 1 Y 1 A LYS 177 ? CE ? A LYS 71 CE 34 1 Y 1 A LYS 177 ? NZ ? A LYS 71 NZ 35 1 Y 1 A LYS 221 ? CG ? A LYS 115 CG 36 1 Y 1 A LYS 221 ? CD ? A LYS 115 CD 37 1 Y 1 A LYS 221 ? CE ? A LYS 115 CE 38 1 Y 1 A LYS 221 ? NZ ? A LYS 115 NZ 39 1 Y 1 A LYS 252 ? CG ? A LYS 146 CG 40 1 Y 1 A LYS 252 ? CD ? A LYS 146 CD 41 1 Y 1 A LYS 252 ? CE ? A LYS 146 CE 42 1 Y 1 A LYS 252 ? NZ ? A LYS 146 NZ 43 1 Y 1 A ARG 258 ? CG ? A ARG 152 CG 44 1 Y 1 A ARG 258 ? CD ? A ARG 152 CD 45 1 Y 1 A ARG 258 ? NE ? A ARG 152 NE 46 1 Y 1 A ARG 258 ? CZ ? A ARG 152 CZ 47 1 Y 1 A ARG 258 ? NH1 ? A ARG 152 NH1 48 1 Y 1 A ARG 258 ? NH2 ? A ARG 152 NH2 49 1 Y 1 A LYS 261 ? CG ? A LYS 155 CG 50 1 Y 1 A LYS 261 ? CD ? A LYS 155 CD 51 1 Y 1 A LYS 261 ? CE ? A LYS 155 CE 52 1 Y 1 A LYS 261 ? NZ ? A LYS 155 NZ 53 1 Y 1 A ARG 283 ? CG ? A ARG 177 CG 54 1 Y 1 A ARG 283 ? CD ? A ARG 177 CD 55 1 Y 1 A ARG 283 ? NE ? A ARG 177 NE 56 1 Y 1 A ARG 283 ? CZ ? A ARG 177 CZ 57 1 Y 1 A ARG 283 ? NH1 ? A ARG 177 NH1 58 1 Y 1 A ARG 283 ? NH2 ? A ARG 177 NH2 59 1 Y 1 A ILE 305 ? CG1 ? A ILE 199 CG1 60 1 Y 1 A ILE 305 ? CG2 ? A ILE 199 CG2 61 1 Y 1 A ILE 305 ? CD1 ? A ILE 199 CD1 62 1 Y 1 A ARG 318 ? CG ? A ARG 212 CG 63 1 Y 1 A ARG 318 ? CD ? A ARG 212 CD 64 1 Y 1 A ARG 318 ? NE ? A ARG 212 NE 65 1 Y 1 A ARG 318 ? CZ ? A ARG 212 CZ 66 1 Y 1 A ARG 318 ? NH1 ? A ARG 212 NH1 67 1 Y 1 A ARG 318 ? NH2 ? A ARG 212 NH2 68 1 Y 1 A LYS 339 ? CG ? A LYS 233 CG 69 1 Y 1 A LYS 339 ? CD ? A LYS 233 CD 70 1 Y 1 A LYS 339 ? CE ? A LYS 233 CE 71 1 Y 1 A LYS 339 ? NZ ? A LYS 233 NZ 72 1 Y 1 A LEU 358 ? CG ? A LEU 252 CG 73 1 Y 1 A LEU 358 ? CD1 ? A LEU 252 CD1 74 1 Y 1 A LEU 358 ? CD2 ? A LEU 252 CD2 75 1 Y 1 A ARG 382 ? CG ? A ARG 276 CG 76 1 Y 1 A ARG 382 ? CD ? A ARG 276 CD 77 1 Y 1 A ARG 382 ? NE ? A ARG 276 NE 78 1 Y 1 A ARG 382 ? CZ ? A ARG 276 CZ 79 1 Y 1 A ARG 382 ? NH1 ? A ARG 276 NH1 80 1 Y 1 A ARG 382 ? NH2 ? A ARG 276 NH2 81 1 Y 1 A LYS 386 ? CG ? A LYS 280 CG 82 1 Y 1 A LYS 386 ? CD ? A LYS 280 CD 83 1 Y 1 A LYS 386 ? CE ? A LYS 280 CE 84 1 Y 1 A LYS 386 ? NZ ? A LYS 280 NZ 85 1 Y 1 A GLU 392 ? CG ? A GLU 286 CG 86 1 Y 1 A GLU 392 ? CD ? A GLU 286 CD 87 1 Y 1 A GLU 392 ? OE1 ? A GLU 286 OE1 88 1 Y 1 A GLU 392 ? OE2 ? A GLU 286 OE2 89 1 Y 1 A LYS 397 ? CG ? A LYS 291 CG 90 1 Y 1 A LYS 397 ? CD ? A LYS 291 CD 91 1 Y 1 A LYS 397 ? CE ? A LYS 291 CE 92 1 Y 1 A LYS 397 ? NZ ? A LYS 291 NZ 93 1 Y 1 A GLU 403 ? CG ? A GLU 297 CG 94 1 Y 1 A GLU 403 ? CD ? A GLU 297 CD 95 1 Y 1 A GLU 403 ? OE1 ? A GLU 297 OE1 96 1 Y 1 A GLU 403 ? OE2 ? A GLU 297 OE2 97 1 Y 1 A LYS 416 ? CG ? A LYS 310 CG 98 1 Y 1 A LYS 416 ? CD ? A LYS 310 CD 99 1 Y 1 A LYS 416 ? CE ? A LYS 310 CE 100 1 Y 1 A LYS 416 ? NZ ? A LYS 310 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.15.2_3472: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6QFT _cell.details ? _cell.formula_units_Z ? _cell.length_a 60.400 _cell.length_a_esd ? _cell.length_b 67.100 _cell.length_b_esd ? _cell.length_c 85.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6QFT _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6QFT _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.38 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.38 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.2 M Sodiumcitrate 20% PEG3350 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-08-12 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X10SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X10SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6QFT _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.7 _reflns.d_resolution_low 49.235 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9940 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.3 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.088 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.096 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.7 _reflns_shell.d_res_low 2.8 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.15 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 997 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.5 _reflns_shell.pdbx_Rsym_value 0.877 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.953 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.885 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6QFT _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.7 _refine.ls_d_res_low 49.235 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9940 _refine.ls_number_reflns_R_free 871 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.94 _refine.ls_percent_reflns_R_free 7.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2396 _refine.ls_R_factor_R_free 0.2869 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2361 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2DYL _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.13 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.44 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.7 _refine_hist.d_res_low 49.235 _refine_hist.number_atoms_solvent 34 _refine_hist.number_atoms_total 2165 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2110 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 21 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 2174 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.656 ? 2940 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 13.455 ? 1296 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.039 ? 329 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 375 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.5000 2.6566 . . 142 1880 100.00 . . . 0.4023 . 0.3500 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6566 2.8617 . . 141 1884 100.00 . . . 0.3442 . 0.3108 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8617 3.1497 . . 144 1910 100.00 . . . 0.3217 . 0.2964 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1497 3.6053 . . 144 1920 100.00 . . . 0.3565 . 0.2596 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6053 4.5418 . . 146 1938 100.00 . . . 0.2494 . 0.2030 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.5418 49.2450 . . 154 2039 100.00 . . . 0.2495 . 0.2045 . . . . . . . . . . # _struct.entry_id 6QFT _struct.title 'Structure of the mitogen activated kinase kinase 7 in complex with pyrazolopyrimidin 1b' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6QFT _struct_keywords.text 'Protein Kinase, Kinase, MKK7, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MP2K7_HUMAN _struct_ref.pdbx_db_accession O14733 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIV QCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLC DFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEP PLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSG ; _struct_ref.pdbx_align_begin 101 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6QFT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 11 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 318 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O14733 _struct_ref_seq.db_align_beg 101 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 408 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 117 _struct_ref_seq.pdbx_auth_seq_align_end 424 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6QFT MET A 1 ? UNP O14733 ? ? 'initiating methionine' 107 1 1 6QFT GLY A 2 ? UNP O14733 ? ? 'expression tag' 108 2 1 6QFT HIS A 3 ? UNP O14733 ? ? 'expression tag' 109 3 1 6QFT HIS A 4 ? UNP O14733 ? ? 'expression tag' 110 4 1 6QFT HIS A 5 ? UNP O14733 ? ? 'expression tag' 111 5 1 6QFT HIS A 6 ? UNP O14733 ? ? 'expression tag' 112 6 1 6QFT HIS A 7 ? UNP O14733 ? ? 'expression tag' 113 7 1 6QFT HIS A 8 ? UNP O14733 ? ? 'expression tag' 114 8 1 6QFT SER A 9 ? UNP O14733 ? ? 'expression tag' 115 9 1 6QFT ALA A 10 ? UNP O14733 ? ? 'expression tag' 116 10 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 13060 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 26 ? ASN A 28 ? GLU A 132 ASN A 134 5 ? 3 HELX_P HELX_P2 AA2 ASN A 66 ? SER A 83 ? ASN A 172 SER A 189 1 ? 18 HELX_P HELX_P3 AA3 ALA A 113 ? GLN A 121 ? ALA A 219 GLN A 227 1 ? 9 HELX_P HELX_P4 AA4 PRO A 125 ? LYS A 146 ? PRO A 231 LYS A 252 1 ? 22 HELX_P HELX_P5 AA5 LYS A 155 ? SER A 157 ? LYS A 261 SER A 263 5 ? 3 HELX_P HELX_P6 AA6 CYS A 190 ? MET A 194 ? CYS A 296 MET A 300 5 ? 5 HELX_P HELX_P7 AA7 ALA A 195 ? ASP A 200 ? ALA A 301 ASP A 306 1 ? 6 HELX_P HELX_P8 AA8 ALA A 213 ? GLY A 228 ? ALA A 319 GLY A 334 1 ? 16 HELX_P HELX_P9 AA9 THR A 237 ? GLU A 248 ? THR A 343 GLU A 354 1 ? 12 HELX_P HELX_P10 AB1 SER A 260 ? LEU A 271 ? SER A 366 LEU A 377 1 ? 12 HELX_P HELX_P11 AB2 LYS A 280 ? LEU A 285 ? LYS A 386 LEU A 391 1 ? 6 HELX_P HELX_P12 AB3 HIS A 287 ? LEU A 296 ? HIS A 393 LEU A 402 1 ? 10 HELX_P HELX_P13 AB4 ASP A 299 ? LYS A 310 ? ASP A 405 LYS A 416 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 112 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id J0B _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C12 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 218 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id J0B _struct_conn.ptnr2_auth_seq_id 501 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.735 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id J0B _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 112 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id J0B _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 501 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 218 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom C12 _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id J0B _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Covalent chemical modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 5 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 15 ? THR A 17 ? TYR A 121 THR A 123 AA1 2 ARG A 22 ? GLN A 24 ? ARG A 128 GLN A 130 AA2 1 LEU A 30 ? MET A 36 ? LEU A 136 MET A 142 AA2 2 GLN A 43 ? PHE A 49 ? GLN A 149 PHE A 155 AA2 3 VAL A 55 ? ARG A 62 ? VAL A 161 ARG A 168 AA2 4 ASP A 101 ? MET A 106 ? ASP A 207 MET A 212 AA2 5 CYS A 92 ? ILE A 97 ? CYS A 198 ILE A 203 AA3 1 THR A 111 ? CYS A 112 ? THR A 217 CYS A 218 AA3 2 ILE A 159 ? LEU A 161 ? ILE A 265 LEU A 267 AA3 3 ILE A 167 ? LEU A 169 ? ILE A 273 LEU A 275 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 16 ? N LEU A 122 O TYR A 23 ? O TYR A 129 AA2 1 2 N GLY A 34 ? N GLY A 140 O LYS A 46 ? O LYS A 152 AA2 2 3 N TRP A 45 ? N TRP A 151 O VAL A 58 ? O VAL A 164 AA2 3 4 N ALA A 57 ? N ALA A 163 O MET A 106 ? O MET A 212 AA2 4 5 O ALA A 105 ? O ALA A 211 N PHE A 93 ? N PHE A 199 AA3 1 2 N THR A 111 ? N THR A 217 O LEU A 161 ? O LEU A 267 AA3 2 3 N LEU A 160 ? N LEU A 266 O LYS A 168 ? O LYS A 274 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id J0B _struct_site.pdbx_auth_seq_id 501 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'binding site for residue J0B A 501' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 MET A 36 ? MET A 142 . ? 1_555 ? 2 AC1 6 THR A 40 ? THR A 146 . ? 1_555 ? 3 AC1 6 VAL A 44 ? VAL A 150 . ? 1_555 ? 4 AC1 6 GLU A 107 ? GLU A 213 . ? 1_555 ? 5 AC1 6 MET A 109 ? MET A 215 . ? 1_555 ? 6 AC1 6 CYS A 112 ? CYS A 218 . ? 1_555 ? # _pdbx_entry_details.entry_id 6QFT _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 146 ? ? 58.50 -124.03 2 1 HIS A 253 ? ? -142.12 -8.90 3 1 ASP A 259 ? ? -165.20 63.00 4 1 CYS A 276 ? ? -132.50 -47.39 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 107 ? A MET 1 2 1 Y 1 A GLY 108 ? A GLY 2 3 1 Y 1 A HIS 109 ? A HIS 3 4 1 Y 1 A HIS 110 ? A HIS 4 5 1 Y 1 A HIS 111 ? A HIS 5 6 1 Y 1 A HIS 112 ? A HIS 6 7 1 Y 1 A HIS 113 ? A HIS 7 8 1 Y 1 A HIS 114 ? A HIS 8 9 1 Y 1 A SER 115 ? A SER 9 10 1 Y 1 A ALA 116 ? A ALA 10 11 1 Y 1 A LYS 117 ? A LYS 11 12 1 Y 1 A GLY 125 ? A GLY 19 13 1 Y 1 A LEU 284 ? A LEU 178 14 1 Y 1 A VAL 285 ? A VAL 179 15 1 Y 1 A ASP 286 ? A ASP 180 16 1 Y 1 A SER 287 ? A SER 181 17 1 Y 1 A LYS 288 ? A LYS 182 18 1 Y 1 A ALA 289 ? A ALA 183 19 1 Y 1 A LYS 290 ? A LYS 184 20 1 Y 1 A THR 291 ? A THR 185 21 1 Y 1 A ARG 292 ? A ARG 186 22 1 Y 1 A SER 293 ? A SER 187 23 1 Y 1 A ALA 294 ? A ALA 188 24 1 Y 1 A GLY 295 ? A GLY 189 25 1 Y 1 A PRO 308 ? A PRO 202 26 1 Y 1 A ASP 309 ? A ASP 203 27 1 Y 1 A PRO 310 ? A PRO 204 28 1 Y 1 A THR 311 ? A THR 205 29 1 Y 1 A LYS 312 ? A LYS 206 30 1 Y 1 A PRO 313 ? A PRO 207 31 1 Y 1 A ASP 314 ? A ASP 208 32 1 Y 1 A TYR 315 ? A TYR 209 33 1 Y 1 A ASP 316 ? A ASP 210 34 1 Y 1 A ILE 317 ? A ILE 211 35 1 Y 1 A THR 417 ? A THR 311 36 1 Y 1 A GLU 418 ? A GLU 312 37 1 Y 1 A SER 419 ? A SER 313 38 1 Y 1 A PRO 420 ? A PRO 314 39 1 Y 1 A ARG 421 ? A ARG 315 40 1 Y 1 A THR 422 ? A THR 316 41 1 Y 1 A SER 423 ? A SER 317 42 1 Y 1 A GLY 424 ? A GLY 318 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 J0B C12 C N N 183 J0B C1 C Y N 184 J0B C5 C N R 185 J0B N4 N N N 186 J0B C3 C Y N 187 J0B C10 C N N 188 J0B N2 N Y N 189 J0B C6 C N N 190 J0B C11 C N N 191 J0B N N Y N 192 J0B C C Y N 193 J0B O O N N 194 J0B C2 C Y N 195 J0B C4 C Y N 196 J0B C7 C N N 197 J0B C8 C N N 198 J0B C9 C N N 199 J0B I I N N 200 J0B N1 N Y N 201 J0B N3 N Y N 202 J0B N5 N N N 203 J0B H1 H N N 204 J0B H2 H N N 205 J0B H3 H N N 206 J0B H4 H N N 207 J0B H5 H N N 208 J0B H6 H N N 209 J0B H7 H N N 210 J0B H8 H N N 211 J0B H9 H N N 212 J0B H10 H N N 213 J0B H11 H N N 214 J0B H12 H N N 215 J0B H13 H N N 216 J0B H14 H N N 217 J0B H15 H N N 218 J0B H16 H N N 219 J0B H17 H N N 220 LEU N N N N 221 LEU CA C N S 222 LEU C C N N 223 LEU O O N N 224 LEU CB C N N 225 LEU CG C N N 226 LEU CD1 C N N 227 LEU CD2 C N N 228 LEU OXT O N N 229 LEU H H N N 230 LEU H2 H N N 231 LEU HA H N N 232 LEU HB2 H N N 233 LEU HB3 H N N 234 LEU HG H N N 235 LEU HD11 H N N 236 LEU HD12 H N N 237 LEU HD13 H N N 238 LEU HD21 H N N 239 LEU HD22 H N N 240 LEU HD23 H N N 241 LEU HXT H N N 242 LYS N N N N 243 LYS CA C N S 244 LYS C C N N 245 LYS O O N N 246 LYS CB C N N 247 LYS CG C N N 248 LYS CD C N N 249 LYS CE C N N 250 LYS NZ N N N 251 LYS OXT O N N 252 LYS H H N N 253 LYS H2 H N N 254 LYS HA H N N 255 LYS HB2 H N N 256 LYS HB3 H N N 257 LYS HG2 H N N 258 LYS HG3 H N N 259 LYS HD2 H N N 260 LYS HD3 H N N 261 LYS HE2 H N N 262 LYS HE3 H N N 263 LYS HZ1 H N N 264 LYS HZ2 H N N 265 LYS HZ3 H N N 266 LYS HXT H N N 267 MET N N N N 268 MET CA C N S 269 MET C C N N 270 MET O O N N 271 MET CB C N N 272 MET CG C N N 273 MET SD S N N 274 MET CE C N N 275 MET OXT O N N 276 MET H H N N 277 MET H2 H N N 278 MET HA H N N 279 MET HB2 H N N 280 MET HB3 H N N 281 MET HG2 H N N 282 MET HG3 H N N 283 MET HE1 H N N 284 MET HE2 H N N 285 MET HE3 H N N 286 MET HXT H N N 287 PHE N N N N 288 PHE CA C N S 289 PHE C C N N 290 PHE O O N N 291 PHE CB C N N 292 PHE CG C Y N 293 PHE CD1 C Y N 294 PHE CD2 C Y N 295 PHE CE1 C Y N 296 PHE CE2 C Y N 297 PHE CZ C Y N 298 PHE OXT O N N 299 PHE H H N N 300 PHE H2 H N N 301 PHE HA H N N 302 PHE HB2 H N N 303 PHE HB3 H N N 304 PHE HD1 H N N 305 PHE HD2 H N N 306 PHE HE1 H N N 307 PHE HE2 H N N 308 PHE HZ H N N 309 PHE HXT H N N 310 PRO N N N N 311 PRO CA C N S 312 PRO C C N N 313 PRO O O N N 314 PRO CB C N N 315 PRO CG C N N 316 PRO CD C N N 317 PRO OXT O N N 318 PRO H H N N 319 PRO HA H N N 320 PRO HB2 H N N 321 PRO HB3 H N N 322 PRO HG2 H N N 323 PRO HG3 H N N 324 PRO HD2 H N N 325 PRO HD3 H N N 326 PRO HXT H N N 327 SER N N N N 328 SER CA C N S 329 SER C C N N 330 SER O O N N 331 SER CB C N N 332 SER OG O N N 333 SER OXT O N N 334 SER H H N N 335 SER H2 H N N 336 SER HA H N N 337 SER HB2 H N N 338 SER HB3 H N N 339 SER HG H N N 340 SER HXT H N N 341 THR N N N N 342 THR CA C N S 343 THR C C N N 344 THR O O N N 345 THR CB C N R 346 THR OG1 O N N 347 THR CG2 C N N 348 THR OXT O N N 349 THR H H N N 350 THR H2 H N N 351 THR HA H N N 352 THR HB H N N 353 THR HG1 H N N 354 THR HG21 H N N 355 THR HG22 H N N 356 THR HG23 H N N 357 THR HXT H N N 358 TRP N N N N 359 TRP CA C N S 360 TRP C C N N 361 TRP O O N N 362 TRP CB C N N 363 TRP CG C Y N 364 TRP CD1 C Y N 365 TRP CD2 C Y N 366 TRP NE1 N Y N 367 TRP CE2 C Y N 368 TRP CE3 C Y N 369 TRP CZ2 C Y N 370 TRP CZ3 C Y N 371 TRP CH2 C Y N 372 TRP OXT O N N 373 TRP H H N N 374 TRP H2 H N N 375 TRP HA H N N 376 TRP HB2 H N N 377 TRP HB3 H N N 378 TRP HD1 H N N 379 TRP HE1 H N N 380 TRP HE3 H N N 381 TRP HZ2 H N N 382 TRP HZ3 H N N 383 TRP HH2 H N N 384 TRP HXT H N N 385 TYR N N N N 386 TYR CA C N S 387 TYR C C N N 388 TYR O O N N 389 TYR CB C N N 390 TYR CG C Y N 391 TYR CD1 C Y N 392 TYR CD2 C Y N 393 TYR CE1 C Y N 394 TYR CE2 C Y N 395 TYR CZ C Y N 396 TYR OH O N N 397 TYR OXT O N N 398 TYR H H N N 399 TYR H2 H N N 400 TYR HA H N N 401 TYR HB2 H N N 402 TYR HB3 H N N 403 TYR HD1 H N N 404 TYR HD2 H N N 405 TYR HE1 H N N 406 TYR HE2 H N N 407 TYR HH H N N 408 TYR HXT H N N 409 VAL N N N N 410 VAL CA C N S 411 VAL C C N N 412 VAL O O N N 413 VAL CB C N N 414 VAL CG1 C N N 415 VAL CG2 C N N 416 VAL OXT O N N 417 VAL H H N N 418 VAL H2 H N N 419 VAL HA H N N 420 VAL HB H N N 421 VAL HG11 H N N 422 VAL HG12 H N N 423 VAL HG13 H N N 424 VAL HG21 H N N 425 VAL HG22 H N N 426 VAL HG23 H N N 427 VAL HXT H N N 428 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 J0B I C4 sing N N 173 J0B N3 C4 doub Y N 174 J0B N3 N2 sing Y N 175 J0B C8 N5 sing N N 176 J0B C8 C7 sing N N 177 J0B C9 N5 sing N N 178 J0B C9 C5 sing N N 179 J0B C4 C2 sing Y N 180 J0B C12 C11 sing N N 181 J0B N5 C10 sing N N 182 J0B C11 C10 sing N N 183 J0B C10 O doub N N 184 J0B C6 C7 sing N N 185 J0B C6 C5 sing N N 186 J0B N2 C5 sing N N 187 J0B N2 C1 sing Y N 188 J0B C2 C1 doub Y N 189 J0B C2 C3 sing Y N 190 J0B N4 C3 sing N N 191 J0B C1 N1 sing Y N 192 J0B C3 N doub Y N 193 J0B N1 C doub Y N 194 J0B N C sing Y N 195 J0B C12 H1 sing N N 196 J0B C12 H2 sing N N 197 J0B C12 H3 sing N N 198 J0B C5 H4 sing N N 199 J0B N4 H5 sing N N 200 J0B N4 H6 sing N N 201 J0B C6 H7 sing N N 202 J0B C6 H8 sing N N 203 J0B C11 H9 sing N N 204 J0B C11 H10 sing N N 205 J0B C H11 sing N N 206 J0B C7 H12 sing N N 207 J0B C7 H13 sing N N 208 J0B C8 H14 sing N N 209 J0B C8 H15 sing N N 210 J0B C9 H16 sing N N 211 J0B C9 H17 sing N N 212 LEU N CA sing N N 213 LEU N H sing N N 214 LEU N H2 sing N N 215 LEU CA C sing N N 216 LEU CA CB sing N N 217 LEU CA HA sing N N 218 LEU C O doub N N 219 LEU C OXT sing N N 220 LEU CB CG sing N N 221 LEU CB HB2 sing N N 222 LEU CB HB3 sing N N 223 LEU CG CD1 sing N N 224 LEU CG CD2 sing N N 225 LEU CG HG sing N N 226 LEU CD1 HD11 sing N N 227 LEU CD1 HD12 sing N N 228 LEU CD1 HD13 sing N N 229 LEU CD2 HD21 sing N N 230 LEU CD2 HD22 sing N N 231 LEU CD2 HD23 sing N N 232 LEU OXT HXT sing N N 233 LYS N CA sing N N 234 LYS N H sing N N 235 LYS N H2 sing N N 236 LYS CA C sing N N 237 LYS CA CB sing N N 238 LYS CA HA sing N N 239 LYS C O doub N N 240 LYS C OXT sing N N 241 LYS CB CG sing N N 242 LYS CB HB2 sing N N 243 LYS CB HB3 sing N N 244 LYS CG CD sing N N 245 LYS CG HG2 sing N N 246 LYS CG HG3 sing N N 247 LYS CD CE sing N N 248 LYS CD HD2 sing N N 249 LYS CD HD3 sing N N 250 LYS CE NZ sing N N 251 LYS CE HE2 sing N N 252 LYS CE HE3 sing N N 253 LYS NZ HZ1 sing N N 254 LYS NZ HZ2 sing N N 255 LYS NZ HZ3 sing N N 256 LYS OXT HXT sing N N 257 MET N CA sing N N 258 MET N H sing N N 259 MET N H2 sing N N 260 MET CA C sing N N 261 MET CA CB sing N N 262 MET CA HA sing N N 263 MET C O doub N N 264 MET C OXT sing N N 265 MET CB CG sing N N 266 MET CB HB2 sing N N 267 MET CB HB3 sing N N 268 MET CG SD sing N N 269 MET CG HG2 sing N N 270 MET CG HG3 sing N N 271 MET SD CE sing N N 272 MET CE HE1 sing N N 273 MET CE HE2 sing N N 274 MET CE HE3 sing N N 275 MET OXT HXT sing N N 276 PHE N CA sing N N 277 PHE N H sing N N 278 PHE N H2 sing N N 279 PHE CA C sing N N 280 PHE CA CB sing N N 281 PHE CA HA sing N N 282 PHE C O doub N N 283 PHE C OXT sing N N 284 PHE CB CG sing N N 285 PHE CB HB2 sing N N 286 PHE CB HB3 sing N N 287 PHE CG CD1 doub Y N 288 PHE CG CD2 sing Y N 289 PHE CD1 CE1 sing Y N 290 PHE CD1 HD1 sing N N 291 PHE CD2 CE2 doub Y N 292 PHE CD2 HD2 sing N N 293 PHE CE1 CZ doub Y N 294 PHE CE1 HE1 sing N N 295 PHE CE2 CZ sing Y N 296 PHE CE2 HE2 sing N N 297 PHE CZ HZ sing N N 298 PHE OXT HXT sing N N 299 PRO N CA sing N N 300 PRO N CD sing N N 301 PRO N H sing N N 302 PRO CA C sing N N 303 PRO CA CB sing N N 304 PRO CA HA sing N N 305 PRO C O doub N N 306 PRO C OXT sing N N 307 PRO CB CG sing N N 308 PRO CB HB2 sing N N 309 PRO CB HB3 sing N N 310 PRO CG CD sing N N 311 PRO CG HG2 sing N N 312 PRO CG HG3 sing N N 313 PRO CD HD2 sing N N 314 PRO CD HD3 sing N N 315 PRO OXT HXT sing N N 316 SER N CA sing N N 317 SER N H sing N N 318 SER N H2 sing N N 319 SER CA C sing N N 320 SER CA CB sing N N 321 SER CA HA sing N N 322 SER C O doub N N 323 SER C OXT sing N N 324 SER CB OG sing N N 325 SER CB HB2 sing N N 326 SER CB HB3 sing N N 327 SER OG HG sing N N 328 SER OXT HXT sing N N 329 THR N CA sing N N 330 THR N H sing N N 331 THR N H2 sing N N 332 THR CA C sing N N 333 THR CA CB sing N N 334 THR CA HA sing N N 335 THR C O doub N N 336 THR C OXT sing N N 337 THR CB OG1 sing N N 338 THR CB CG2 sing N N 339 THR CB HB sing N N 340 THR OG1 HG1 sing N N 341 THR CG2 HG21 sing N N 342 THR CG2 HG22 sing N N 343 THR CG2 HG23 sing N N 344 THR OXT HXT sing N N 345 TRP N CA sing N N 346 TRP N H sing N N 347 TRP N H2 sing N N 348 TRP CA C sing N N 349 TRP CA CB sing N N 350 TRP CA HA sing N N 351 TRP C O doub N N 352 TRP C OXT sing N N 353 TRP CB CG sing N N 354 TRP CB HB2 sing N N 355 TRP CB HB3 sing N N 356 TRP CG CD1 doub Y N 357 TRP CG CD2 sing Y N 358 TRP CD1 NE1 sing Y N 359 TRP CD1 HD1 sing N N 360 TRP CD2 CE2 doub Y N 361 TRP CD2 CE3 sing Y N 362 TRP NE1 CE2 sing Y N 363 TRP NE1 HE1 sing N N 364 TRP CE2 CZ2 sing Y N 365 TRP CE3 CZ3 doub Y N 366 TRP CE3 HE3 sing N N 367 TRP CZ2 CH2 doub Y N 368 TRP CZ2 HZ2 sing N N 369 TRP CZ3 CH2 sing Y N 370 TRP CZ3 HZ3 sing N N 371 TRP CH2 HH2 sing N N 372 TRP OXT HXT sing N N 373 TYR N CA sing N N 374 TYR N H sing N N 375 TYR N H2 sing N N 376 TYR CA C sing N N 377 TYR CA CB sing N N 378 TYR CA HA sing N N 379 TYR C O doub N N 380 TYR C OXT sing N N 381 TYR CB CG sing N N 382 TYR CB HB2 sing N N 383 TYR CB HB3 sing N N 384 TYR CG CD1 doub Y N 385 TYR CG CD2 sing Y N 386 TYR CD1 CE1 sing Y N 387 TYR CD1 HD1 sing N N 388 TYR CD2 CE2 doub Y N 389 TYR CD2 HD2 sing N N 390 TYR CE1 CZ doub Y N 391 TYR CE1 HE1 sing N N 392 TYR CE2 CZ sing Y N 393 TYR CE2 HE2 sing N N 394 TYR CZ OH sing N N 395 TYR OH HH sing N N 396 TYR OXT HXT sing N N 397 VAL N CA sing N N 398 VAL N H sing N N 399 VAL N H2 sing N N 400 VAL CA C sing N N 401 VAL CA CB sing N N 402 VAL CA HA sing N N 403 VAL C O doub N N 404 VAL C OXT sing N N 405 VAL CB CG1 sing N N 406 VAL CB CG2 sing N N 407 VAL CB HB sing N N 408 VAL CG1 HG11 sing N N 409 VAL CG1 HG12 sing N N 410 VAL CG1 HG13 sing N N 411 VAL CG2 HG21 sing N N 412 VAL CG2 HG22 sing N N 413 VAL CG2 HG23 sing N N 414 VAL OXT HXT sing N N 415 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2DYL _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6QFT _atom_sites.fract_transf_matrix[1][1] 0.016556 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014903 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011765 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C I N O S # loop_ #