data_6QKP # _entry.id 6QKP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6QKP pdb_00006qkp 10.2210/pdb6qkp/pdb WWPDB D_1292100330 ? ? BMRB 34358 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR solution structure of LSR2 binding domain.' _pdbx_database_related.db_id 34358 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6QKP _pdbx_database_status.recvd_initial_deposition_date 2019-01-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Barthe, P.' 1 0000-0003-4282-6604 'Cohen-Gonsaud, M.' 2 0000-0002-0150-9912 'Mukamolova, G.V.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Mol.Microbiol. _citation.journal_id_ASTM MOMIEE _citation.journal_id_CSD 2007 _citation.journal_id_ISSN 1365-2958 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 112 _citation.language ? _citation.page_first 1847 _citation.page_last 1862 _citation.title ;Protein kinase B controls Mycobacterium tuberculosis growth via phosphorylation of the transcriptional regulator Lsr2 at threonine 112. ; _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1111/mmi.14398 _citation.pdbx_database_id_PubMed 31562654 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Alqaseer, K.' 1 ? primary 'Turapov, O.' 2 ? primary 'Barthe, P.' 3 ? primary 'Jagatia, H.' 4 ? primary 'De Visch, A.' 5 ? primary 'Roumestand, C.' 6 ? primary 'Wegrzyn, M.' 7 ? primary 'Bartek, I.L.' 8 ? primary 'Voskuil, M.I.' 9 ? primary ;O'Hare, H.M. ; 10 ? primary 'Ajuh, P.' 11 ? primary 'Bottrill, A.R.' 12 ? primary 'Witney, A.A.' 13 ? primary 'Cohen-Gonsaud, M.' 14 ? primary 'Waddell, S.J.' 15 ? primary 'Mukamolova, G.V.' 16 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Nucleoid-associated protein Lsr2' _entity.formula_weight 5396.921 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GHMSGSGRGRGAIDREQSAAIREWARRNGHNVSTRGRIPADVIDAYHAAT _entity_poly.pdbx_seq_one_letter_code_can GHMSGSGRGRGAIDREQSAAIREWARRNGHNVSTRGRIPADVIDAYHAAT _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 SER n 1 5 GLY n 1 6 SER n 1 7 GLY n 1 8 ARG n 1 9 GLY n 1 10 ARG n 1 11 GLY n 1 12 ALA n 1 13 ILE n 1 14 ASP n 1 15 ARG n 1 16 GLU n 1 17 GLN n 1 18 SER n 1 19 ALA n 1 20 ALA n 1 21 ILE n 1 22 ARG n 1 23 GLU n 1 24 TRP n 1 25 ALA n 1 26 ARG n 1 27 ARG n 1 28 ASN n 1 29 GLY n 1 30 HIS n 1 31 ASN n 1 32 VAL n 1 33 SER n 1 34 THR n 1 35 ARG n 1 36 GLY n 1 37 ARG n 1 38 ILE n 1 39 PRO n 1 40 ALA n 1 41 ASP n 1 42 VAL n 1 43 ILE n 1 44 ASP n 1 45 ALA n 1 46 TYR n 1 47 HIS n 1 48 ALA n 1 49 ALA n 1 50 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 50 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'lsr2, Rv3597c, MTCY07H7B.25' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83332 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LSR2_MYCTU _struct_ref.pdbx_db_accession P9WIP7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code AIDREQSAAIREWARRNGHNVSTRGRIPADVIDAYHAAT _struct_ref.pdbx_align_begin 74 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6QKP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 12 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 50 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P9WIP7 _struct_ref_seq.db_align_beg 74 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 112 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 74 _struct_ref_seq.pdbx_auth_seq_align_end 112 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6QKP GLY A 1 ? UNP P9WIP7 ? ? 'expression tag' 63 1 1 6QKP HIS A 2 ? UNP P9WIP7 ? ? 'expression tag' 64 2 1 6QKP MET A 3 ? UNP P9WIP7 ? ? 'expression tag' 65 3 1 6QKP SER A 4 ? UNP P9WIP7 ? ? 'expression tag' 66 4 1 6QKP GLY A 5 ? UNP P9WIP7 ? ? 'expression tag' 67 5 1 6QKP SER A 6 ? UNP P9WIP7 ? ? 'expression tag' 68 6 1 6QKP GLY A 7 ? UNP P9WIP7 ? ? 'expression tag' 69 7 1 6QKP ARG A 8 ? UNP P9WIP7 ? ? 'expression tag' 70 8 1 6QKP GLY A 9 ? UNP P9WIP7 ? ? 'expression tag' 71 9 1 6QKP ARG A 10 ? UNP P9WIP7 ? ? 'expression tag' 72 10 1 6QKP GLY A 11 ? UNP P9WIP7 ? ? 'expression tag' 73 11 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D 1H-15N NOESY' 2 isotropic 2 1 1 '3D 1H-15N TOCSY' 2 isotropic 3 1 2 '2D 1H-1H NOESY' 1 isotropic 4 1 2 '2D 1H-1H TOCSY' 1 isotropic 5 1 2 '2D DQF-COSY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure_units bar _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.5 mM [U-15N] LSR2 protein, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N_sample solution ? 2 '0.5 mM [U-15N] LSR2 protein, 100% D2O' '100% D2O' D2O_sample solution ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 800 ? 2 'AVANCE III' ? Bruker 700 ? # _pdbx_nmr_refine.entry_id 6QKP _pdbx_nmr_refine.method 'MDSA and refinement in explicit water' _pdbx_nmr_refine.details 'Recoord procedure' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 6QKP _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6QKP _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' CINDY ? Padilla 4 'peak picking' Gifa ? Delsuc # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6QKP _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6QKP _struct.title 'NMR solution structure of LSR2 binding domain.' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6QKP _struct_keywords.text 'Tuberculosis, DNA organisation, Transcriptional regulator, PknB substrate, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 16 ? GLY A 29 ? GLU A 78 GLY A 91 1 ? 14 HELX_P HELX_P2 AA2 PRO A 39 ? THR A 50 ? PRO A 101 THR A 112 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 6QKP _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 63 ? ? ? A . n A 1 2 HIS 2 64 ? ? ? A . n A 1 3 MET 3 65 65 MET MET A . n A 1 4 SER 4 66 66 SER SER A . n A 1 5 GLY 5 67 67 GLY GLY A . n A 1 6 SER 6 68 68 SER SER A . n A 1 7 GLY 7 69 69 GLY GLY A . n A 1 8 ARG 8 70 70 ARG ARG A . n A 1 9 GLY 9 71 71 GLY GLY A . n A 1 10 ARG 10 72 72 ARG ARG A . n A 1 11 GLY 11 73 73 GLY GLY A . n A 1 12 ALA 12 74 74 ALA ALA A . n A 1 13 ILE 13 75 75 ILE ILE A . n A 1 14 ASP 14 76 76 ASP ASP A . n A 1 15 ARG 15 77 77 ARG ARG A . n A 1 16 GLU 16 78 78 GLU GLU A . n A 1 17 GLN 17 79 79 GLN GLN A . n A 1 18 SER 18 80 80 SER SER A . n A 1 19 ALA 19 81 81 ALA ALA A . n A 1 20 ALA 20 82 82 ALA ALA A . n A 1 21 ILE 21 83 83 ILE ILE A . n A 1 22 ARG 22 84 84 ARG ARG A . n A 1 23 GLU 23 85 85 GLU GLU A . n A 1 24 TRP 24 86 86 TRP TRP A . n A 1 25 ALA 25 87 87 ALA ALA A . n A 1 26 ARG 26 88 88 ARG ARG A . n A 1 27 ARG 27 89 89 ARG ARG A . n A 1 28 ASN 28 90 90 ASN ASN A . n A 1 29 GLY 29 91 91 GLY GLY A . n A 1 30 HIS 30 92 92 HIS HIS A . n A 1 31 ASN 31 93 93 ASN ASN A . n A 1 32 VAL 32 94 94 VAL VAL A . n A 1 33 SER 33 95 95 SER SER A . n A 1 34 THR 34 96 96 THR THR A . n A 1 35 ARG 35 97 97 ARG ARG A . n A 1 36 GLY 36 98 98 GLY GLY A . n A 1 37 ARG 37 99 99 ARG ARG A . n A 1 38 ILE 38 100 100 ILE ILE A . n A 1 39 PRO 39 101 101 PRO PRO A . n A 1 40 ALA 40 102 102 ALA ALA A . n A 1 41 ASP 41 103 103 ASP ASP A . n A 1 42 VAL 42 104 104 VAL VAL A . n A 1 43 ILE 43 105 105 ILE ILE A . n A 1 44 ASP 44 106 106 ASP ASP A . n A 1 45 ALA 45 107 107 ALA ALA A . n A 1 46 TYR 46 108 108 TYR TYR A . n A 1 47 HIS 47 109 109 HIS HIS A . n A 1 48 ALA 48 110 110 ALA ALA A . n A 1 49 ALA 49 111 111 ALA ALA A . n A 1 50 THR 50 112 112 THR THR A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 4120 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-07-17 2 'Structure model' 1 1 2019-10-09 3 'Structure model' 1 2 2019-12-18 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Database references' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' database_2 5 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' 13 4 'Structure model' '_database_2.pdbx_DOI' 14 4 'Structure model' '_database_2.pdbx_database_accession' 15 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'LSR2 protein' 0.5 ? mM '[U-15N]' 2 'LSR2 protein' 0.5 ? mM '[U-15N]' # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 18 _pdbx_validate_close_contact.auth_atom_id_1 OE1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 85 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HH21 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ARG _pdbx_validate_close_contact.auth_seq_id_2 88 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 70 ? ? 60.99 84.49 2 1 ALA A 74 ? ? 61.46 -153.21 3 1 ILE A 75 ? ? -102.29 79.27 4 1 ARG A 77 ? ? -112.99 -169.39 5 1 SER A 95 ? ? -168.64 -53.68 6 2 ARG A 72 ? ? 65.62 -153.21 7 6 SER A 95 ? ? 175.79 -19.35 8 7 SER A 66 ? ? 63.29 179.96 9 8 ARG A 70 ? ? -59.53 107.27 10 8 ARG A 77 ? ? -125.11 -165.62 11 9 SER A 68 ? ? -146.06 -75.50 12 9 ARG A 72 ? ? 72.56 117.07 13 9 ARG A 77 ? ? -131.22 -156.39 14 11 SER A 66 ? ? -178.77 138.41 15 11 SER A 95 ? ? 71.64 161.94 16 12 ARG A 70 ? ? 63.51 84.57 17 12 ARG A 77 ? ? -113.68 -167.08 18 13 ARG A 70 ? ? 72.88 -172.41 19 13 VAL A 94 ? ? -141.69 -51.33 20 13 SER A 95 ? ? 63.41 -162.27 21 14 SER A 66 ? ? 70.82 89.44 22 14 ARG A 70 ? ? 54.37 82.10 23 16 SER A 66 ? ? -151.75 84.39 24 16 SER A 68 ? ? -126.99 -71.74 25 16 ASP A 76 ? ? -108.09 72.72 26 17 SER A 95 ? ? 65.94 -179.44 27 18 SER A 66 ? ? -147.10 -62.25 28 18 ARG A 70 ? ? 75.55 105.86 29 19 SER A 66 ? ? -107.56 -60.25 30 19 ARG A 70 ? ? 72.13 123.72 31 19 ARG A 72 ? ? 70.93 -65.80 32 19 ARG A 99 ? ? 79.01 125.93 33 20 ARG A 72 ? ? 63.42 -91.65 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 5 ARG A 84 ? ? 0.109 'SIDE CHAIN' 2 5 ARG A 88 ? ? 0.078 'SIDE CHAIN' 3 11 ARG A 77 ? ? 0.101 'SIDE CHAIN' 4 12 ARG A 88 ? ? 0.083 'SIDE CHAIN' 5 14 ARG A 84 ? ? 0.132 'SIDE CHAIN' 6 15 ARG A 88 ? ? 0.082 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 63 ? A GLY 1 2 1 Y 1 A HIS 64 ? A HIS 2 3 2 Y 1 A GLY 63 ? A GLY 1 4 2 Y 1 A HIS 64 ? A HIS 2 5 3 Y 1 A GLY 63 ? A GLY 1 6 3 Y 1 A HIS 64 ? A HIS 2 7 4 Y 1 A GLY 63 ? A GLY 1 8 4 Y 1 A HIS 64 ? A HIS 2 9 5 Y 1 A GLY 63 ? A GLY 1 10 5 Y 1 A HIS 64 ? A HIS 2 11 6 Y 1 A GLY 63 ? A GLY 1 12 6 Y 1 A HIS 64 ? A HIS 2 13 7 Y 1 A GLY 63 ? A GLY 1 14 7 Y 1 A HIS 64 ? A HIS 2 15 8 Y 1 A GLY 63 ? A GLY 1 16 8 Y 1 A HIS 64 ? A HIS 2 17 9 Y 1 A GLY 63 ? A GLY 1 18 9 Y 1 A HIS 64 ? A HIS 2 19 10 Y 1 A GLY 63 ? A GLY 1 20 10 Y 1 A HIS 64 ? A HIS 2 21 11 Y 1 A GLY 63 ? A GLY 1 22 11 Y 1 A HIS 64 ? A HIS 2 23 12 Y 1 A GLY 63 ? A GLY 1 24 12 Y 1 A HIS 64 ? A HIS 2 25 13 Y 1 A GLY 63 ? A GLY 1 26 13 Y 1 A HIS 64 ? A HIS 2 27 14 Y 1 A GLY 63 ? A GLY 1 28 14 Y 1 A HIS 64 ? A HIS 2 29 15 Y 1 A GLY 63 ? A GLY 1 30 15 Y 1 A HIS 64 ? A HIS 2 31 16 Y 1 A GLY 63 ? A GLY 1 32 16 Y 1 A HIS 64 ? A HIS 2 33 17 Y 1 A GLY 63 ? A GLY 1 34 17 Y 1 A HIS 64 ? A HIS 2 35 18 Y 1 A GLY 63 ? A GLY 1 36 18 Y 1 A HIS 64 ? A HIS 2 37 19 Y 1 A GLY 63 ? A GLY 1 38 19 Y 1 A HIS 64 ? A HIS 2 39 20 Y 1 A GLY 63 ? A GLY 1 40 20 Y 1 A HIS 64 ? A HIS 2 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #